spacer

EBI Dbfetch

ID   FR693760; SV 1; linear; mRNA; STD; VRT; 662 BP.
XX
AC   FR693760;
XX
DT   10-JAN-2011 (Rel. 107, Created)
DT   10-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Petromyzon marinus mRNA for glycoprotein hormone alpha type 2 (gpa2 gene)
XX
KW   .
XX
OS   Petromyzon marinus (sea lamprey)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Cyclostomata;
OC   Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
XX
RN   [1]
RP   1-662
RA   Querat B.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   Querat B., Univ Paris-Diderot, Paris 7, BFA, eq PAG, 4, rue Marie-Andre
RL   Lagroua Weill-Halle, 75205 Paris cedex 13, FRANCE.
XX
RN   [2]
RA   Dos Santos S., Mazan S., Venkatesh B., Cohen-Tannoudji J., Querat B.;
RT   "Emergence and evolution in vertebrates of the glycoprotein hormone related
RT   subunit and neurotrophin genes in their genomic environment";
RL   Unpublished.
XX
DR   MD5; 4f7721bfd6b2c64ba2cff4e2c2b635af.
DR   Ensembl-Gn; ENSPMAG00000002562; petromyzon_marinus.
DR   Ensembl-Tr; ENSPMAT00000002803; petromyzon_marinus.
DR   EuropePMC; PMC3280201; 22085792.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..662
FT                   /organism="Petromyzon marinus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="larvae F7 + 8"
FT                   /db_xref="taxon:7757"
FT   CDS             7..372
FT                   /gene="gpa2"
FT                   /product="glycoprotein hormone alpha type 2"
FT                   /db_xref="GOA:D3G8E2"
FT                   /db_xref="InterPro:IPR000476"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/TrEMBL:D3G8E2"
FT                   /protein_id="CBX24528.1"
FT                   /translation="MQRVTMPMLSLLCLLGAAMPAISKPGCHPYPFELALRRERGACLA
FT                   RVHACVGFCESSAFPSKYSVLQASHYRHNITSVAQCCTIRRLEKVRTRVKCGTSNHVME
FT                   VFTAKECQCDVCRRARY"
XX
SQ   Sequence 662 BP; 124 A; 213 C; 208 G; 117 T; 0 other;
     gccttgatgc agcgcgtcac catgcccatg ctttccctct tgtgcctcct gggcgctgcg        60
     atgccggcca tctccaagcc cggatgccac ccttacccgt tcgagctggc gctgcgtcgc       120
     gagcggggcg cgtgcctggc gcgcgtgcac gcctgcgtgg ggttctgcga gtcgagcgcg       180
     ttcccctcca agtactcggt gctgcaggcc agccactacc gccacaacat cacctcggtc       240
     gcgcagtgct gcaccatccg gcggctcgag aaggtgcgaa cgcgagtgaa gtgcgggacg       300
     agcaaccacg tgatggaggt gttcaccgcc aaggagtgcc agtgcgatgt gtgccggcga       360
     gcgcgctact gactcctcct cccggctccc ggctcccgcc gagcggacga cggcatggcc       420
     aagtacagca actaggacga ggcgtgttca cggatacgcc gatttaccga cttaccaaac       480
     aaaaaaaagc acgtgagttg tgaagccggc ggcgacgcgc gcgatggtga atctcgcgcg       540
     cgtcgagaga gtgcatcgta cgtgccggtt tgcgatcggt ccgtgtcgac ctcttcagcc       600
     ggtcactagg gagggcgctc gctgggttta ccgcaatgag tttaaaacaa caacaacaac       660
     aa                                                                      662
//


spacer
spacer