spacer

EBI Dbfetch

ID   FR693759; SV 1; linear; mRNA; STD; VRT; 1106 BP.
XX
AC   FR693759;
XX
DT   10-JAN-2011 (Rel. 107, Created)
DT   10-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Scyliorhinus canicula mRNA for Lin7 type C (lin7c gene)
XX
KW   .
XX
OS   Scyliorhinus canicula (smaller spotted catshark)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;
OC   Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes; Scyliorhinidae;
OC   Scyliorhinus.
XX
RN   [1]
RP   1-1106
RA   Querat B.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   Querat B., Univ Paris-Diderot, Paris 7, BFA, eq PAG, 4, rue Marie-Andre
RL   Lagroua Weill-Halle, 75205 Paris cedex 13, FRANCE.
XX
RN   [2]
RA   Dos Santos S., Mazan S., Venkatesh B., Cohen-Tannoudji J., Querat B.;
RT   "Emergence and evolution in vertebrates of the glycoprotein hormone related
RT   subunit and neurotrophin genes in their genomic environment";
RL   Unpublished.
XX
DR   MD5; e56d74102d7dff7a03a7674cdf92b8ce.
DR   EuropePMC; PMC3280201; 22085792.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1106
FT                   /organism="Scyliorhinus canicula"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryonic stages 19-25"
FT                   /db_xref="taxon:7830"
FT   CDS             5..610
FT                   /gene="lin7c"
FT                   /product="Lin7 type C"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004172"
FT                   /db_xref="InterPro:IPR014775"
FT                   /db_xref="InterPro:IPR017365"
FT                   /db_xref="UniProtKB/TrEMBL:E7AXS5"
FT                   /protein_id="CBX24527.1"
FT                   /translation="MEMALAMEPIRLDRYVSRAIELLEKLQRSGEVPPQKLQALQRVLQ
FT                   SEFCIAVREVYEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTDEG
FT                   LGFNIMGGKEQNSPIYISRIIPAGIADRPGGLKRGDQLLSVNGVSVEGEHHEKAVELLK
FT                   AAHGTVKLVVRYTPKVLEEMESRFEKMRSAKHKQQINY"
XX
SQ   Sequence 1106 BP; 323 A; 228 C; 256 G; 299 T; 0 other;
     ggctatggaa atggcgctgg cgatggagcc gatccgcctg gaccgatatg tttcccgggc        60
     tattgaacta ctggagaagt tgcagaggag tggggaggtg ccaccccaga agctacaggc       120
     tttgcaaaga gtacttcaga gtgaattctg cattgctgtg cgagaagttt acgagcatgt       180
     gtatgaaacg gtggatatta atagtagtcc cgaggtgaga gccaatgcta ctgctaaggc       240
     aacagtggca gcatttgctg caagtgaggg tcactcccat ccaagagttg tggaactgcc       300
     caaaacagat gaaggactag gattcaatat catgggtgga aaggagcaaa attcgccgat       360
     atatatatcc cgcataatcc ctgcaggcat tgctgatcgt cctggaggac tgaaacgtgg       420
     ggaccagctc ctctctgtca atggagtgag cgtggaagga gaacaccatg aaaaagcagt       480
     tgagctcctg aaagctgccc atggaactgt taaattagtg gttagataca caccaaaagt       540
     gctggaagaa atggaatcgc gatttgagaa aatgaggtca gcaaaacaca agcagcaaat       600
     caactattaa tcgtttgcat gcttcaatac tttatcttac atgaccgctg ggatttctta       660
     atgtgttcta ctcactattg atgtaacatg atcaggcagt atcatactca aattagttag       720
     tcacactgac actacaacac agtaatgcat ttctgcttat tgttaatcca gtgttagatt       780
     tacagtgaaa gccagtttta atatgtttcg agtattcata tttttaaatc aagtaattat       840
     tttattttcc ctaatttgca agtgctgaaa aatattgcaa gggcacttct gtgtccatgg       900
     gaatagccgt cgatggtaaa gaatgaggca tttcccttct ggcctccctt gtattggtta       960
     tcgctctttt gaagctccaa ccctgcccac cagttgaaaa aaaccgatta ccttggctaa      1020
     aaaacgtaag ctattctttc ccattccaga attttggagt tagcccaacc gaacacgctc      1080
     acaggcttta acatgctgtc atgcta                                           1106
//


spacer
spacer