spacer

EBI Dbfetch

ID   FR693755; SV 1; linear; mRNA; STD; VRT; 984 BP.
XX
AC   FR693755;
XX
DT   10-JAN-2011 (Rel. 107, Created)
DT   10-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Scyliorhinus canicula mRNA for neurotrophin type 3 (nt3 gene)
XX
KW   .
XX
OS   Scyliorhinus canicula (smaller spotted catshark)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;
OC   Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes; Scyliorhinidae;
OC   Scyliorhinus.
XX
RN   [1]
RP   1-984
RA   Querat B.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   Querat B., Univ Paris-Diderot, Paris 7, BFA, eq PAG, 4, rue Marie-Andre
RL   Lagroua Weill-Halle, 75205 Paris cedex 13, FRANCE.
XX
RN   [2]
RA   Dos Santos S., Mazan S., Venkatesh B., Cohen-Tannoudji J., Querat B.;
RT   "Emergence and evolution in vertebrates of the glycoprotein hormone related
RT   subunit and neurotrophin genes in their genomic environment";
RL   Unpublished.
XX
DR   MD5; b92b0dee6687945979278758ccae9d45.
DR   EuropePMC; PMC3280201; 22085792.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..984
FT                   /organism="Scyliorhinus canicula"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryonic stages 19-25"
FT                   /db_xref="taxon:7830"
FT   CDS             143..955
FT                   /gene="nt3"
FT                   /product="neurotrophin type 3"
FT                   /db_xref="GOA:E7AXS1"
FT                   /db_xref="InterPro:IPR002072"
FT                   /db_xref="InterPro:IPR015578"
FT                   /db_xref="InterPro:IPR019846"
FT                   /db_xref="InterPro:IPR020408"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="UniProtKB/TrEMBL:E7AXS1"
FT                   /protein_id="CBX24523.1"
FT                   /translation="MVSSVTLLQVNKVMSVLFYGMLLTYLGGIQATTMDKRRSSEDSVN
FT                   SIIIKILQADILKGRLAKQSEEVKEKYQDTKQKDDTHRNTNSLGNTISDFQPIVLVDAE
FT                   LLRQKKRYHSPRVLLSDRLPLQPPPLYLIEDFAESLEMDNRTARRKRYADRRGHRGEYS
FT                   VCDSESRWVTDKTAAIDIRGKQVTVLGEIKTGNSAIKQYFYETRCREAKPVKNGCRGID
FT                   DKHWNSQCKTSQTYVRALSTENNKYVGWRWIRIDTSCLCALSRKLGKS"
XX
SQ   Sequence 984 BP; 268 A; 257 C; 249 G; 210 T; 0 other;
     cgagactcat cgacaagatg agccgtctcc agttgcgctc cgtcgccagc tcagaccatt        60
     gaggccacag ctttttcttt taaacgacaa cattttcttt caccttcatg tcggcgcgca       120
     tccaccgatt cacacggatg ccatggtcag ctctgtcacg cttttacagg tgaacaaagt       180
     aatgtctgtc ctgttttacg gcatgcttct cacttatctt ggtggcatcc aggctacaac       240
     tatggacaaa agacgttctt ccgaggactc cgtgaactcg atcatcatca aaatcctcca       300
     ggcggacatc ttgaaaggcc gactcgccaa gcagagcgaa gaggtgaagg agaagtacca       360
     ggacaccaag cagaaggatg acacccacag gaatacaaac tcgctgggaa atacaatatc       420
     tgacttccag ccaatcgtgt tggtcgatgc cgagttactg aggcagaaga agcgttacca       480
     ctcgccccga gtgctgctga gcgatcggct gcctttacag ccgcctcctt tgtatttaat       540
     cgaggatttt gcagagagtt tggagatgga caatagaaca gccaggcgaa agcggtatgc       600
     agaccggagg ggccaccgtg gcgagtactc cgtgtgtgac agcgagagcc gctgggtgac       660
     ggataaaaca gcggcgatcg acatccgggg gaagcaggtg accgtcctgg gagagattaa       720
     aacgggcaac tctgccatca aacaatattt ttacgagacg cgttgcagag aggccaaacc       780
     agtcaagaac ggatgcaggg gcatcgatga caaacactgg aattcccaat gtaaaaccag       840
     ccagacctat gtcagagcac tgagcacaga gaacaataag tatgtcggct ggaggtggat       900
     caggatagac acctcctgcc tctgtgcatt atccagaaaa ctaggcaaat cctgattccc       960
     tgtcccaccc cttttctctt tcta                                              984
//


spacer
spacer