spacer

EBI Dbfetch

ID   FR693748; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR693748;
XX
DT   27-SEP-2010 (Rel. 106, Created)
DT   27-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*14, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Masson D.M.;
RT   ;
RL   Submitted (24-SEP-2010) to the INSDC.
RL   Masson D.M., HLA Laboratory, EFS Rhone Alpes, BP35, 38701, FRANCE.
XX
RN   [2]
RA   Masson D.;
RT   "x";
RL   Unpublished.
XX
DR   MD5; 15e94f0c6b84213681e673ea5e0ed46c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1Y6P7"
FT                   /db_xref="IMGT/HLA:DRB1*14:101"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1Y6P7"
FT                   /protein_id="CBX24516.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 54 A; 64 C; 100 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer