spacer

EBI Dbfetch

ID   FR692275; SV 1; linear; genomic DNA; STD; VRL; 207 BP.
XX
AC   FR692275;
XX
DT   10-JAN-2011 (Rel. 107, Created)
DT   10-JAN-2011 (Rel. 107, Last updated, Version 1)
XX
DE   Chimpanzee polyomavirus partial VP1 gene, isolate Lot
XX
KW   .
XX
OS   Chimpanzee polyomavirus
OC   Viruses; dsDNA viruses, no RNA stage; Polyomaviridae; Polyomavirus;
OC   unclassified Polyomavirus.
XX
RN   [1]
RP   1-207
RA   Verschoor E.J.;
RT   ;
RL   Submitted (21-SEP-2010) to the INSDC.
RL   Verschoor E.J., Virology, Biomedical Primate Research Centre, Lange Kleiweg
RL   139 Rijswijk, 2288GJ, NETHERLANDS.
XX
RN   [2]
RA   Deuzing I., Fagrouch Z., Groenewoud M.J., Niphuis H., Bogers W.,
RA   Verschoor E.J.;
RT   "Characterization of three chimpanzee polyomavirus genotypes from different
RT   Pan troglodytes subspecies";
RL   Unpublished.
XX
DR   MD5; 9a6346fa587b5cc784c07af047577dd0.
DR   EuropePMC; PMC3003640; 21110837.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..207
FT                   /organism="Chimpanzee polyomavirus"
FT                   /host="Pan troglodytes troglodytes"
FT                   /isolate="Lot"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="host blood"
FT                   /db_xref="taxon:305677"
FT   CDS             <1..>207
FT                   /codon_start=3
FT                   /gene="VP1"
FT                   /product="VP1 protein"
FT                   /function="structural protein"
FT                   /db_xref="GOA:E7AXR2"
FT                   /db_xref="InterPro:IPR000662"
FT                   /db_xref="InterPro:IPR011222"
FT                   /db_xref="UniProtKB/TrEMBL:E7AXR2"
FT                   /protein_id="CBX23435.1"
FT                   /translation="TLMMWEAVSCKTEIVGIGSLISVHLLEAKMAAKEGGDGPSQPIEG
FT                   MNYHMFAVGGEPLDLQGIESNAL"
XX
SQ   Sequence 207 BP; 69 A; 31 C; 52 G; 55 T; 0 other;
     acacattaat gatgtgggaa gctgtgtcat gtaaaactga gatagtaggt attgggtctc        60
     taattagtgt tcacttacta gaagcaaaaa tggctgctaa agaaggagga gatgggcctt       120
     cacaacccat tgagggtatg aactaccata tgtttgcagt aggaggtgaa cctctagatt       180
     tacaaggcat agaaagtaat gccttaa                                           207
//


spacer
spacer