spacer

EBI Dbfetch

ID   FR692181; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FR692181;
XX
DT   21-SEP-2010 (Rel. 106, Created)
DT   21-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*03new
DE   allele, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Casanova A.A.;
RT   ;
RL   Submitted (20-SEP-2010) to the INSDC.
RL   Casanova A.A., Anthony Nolan Trust, Dept HLA Sequencing, Royal Free
RL   Hospital, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Casanova A.A., Smillie D., Wallis-jones S.;
RT   "A new HLA-A allele A*03XX which differs from HLA-A*03:01:01:01 with a G to
RT   A at position 766, resulting in a coding change from glutamic acid to
RT   lysine at codon 232";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1Y422"
FT                   /db_xref="IMGT/HLA:A*03:118"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E1Y422"
FT                   /protein_id="CBX23386.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVKTRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=2
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=3
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03new"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 169 A; 248 C; 284 G; 121 T; 200 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgaggcgga gcagttgaga gcctacctgg atggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tgaagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggagagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer