spacer

EBI Dbfetch

ID   FR690499; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR690499;
XX
DT   09-SEP-2010 (Rel. 106, Created)
DT   09-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*140503, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Qu J.;
RT   ;
RL   Submitted (08-SEP-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li L., Chen H., Shen M., Liao K., Wang L., Hu Z., Huang C., Zhou M.,
RA   Deng X., Zhen H., Chen Y., Zheng Z., Hua S., Zhang H., Cheng Z., Qian P.,
RA   Liang J., Tang J., Zhang W., Ceng Y., Yang X., Liu B., Tang L., Zhang L.,
RA   Liu X., Xue Y., Yin J., Zhang K., Huang H., Wang Z., Li Y., Chen C.,
RA   Tao D., Pan J., Wu S., Long K., Zheng K., Wang N., Lu X., Song X.,
RA   Huang J., Wen J., Tian Z., Zhou C.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
DR   MD5; 4b90952650d8f5cb3eee174bbaca691b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10011384"
FT                   /db_xref="taxon:9606"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140503"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*140503"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WN74"
FT                   /db_xref="IMGT/HLA:DRB1*14:103"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E0WN74"
FT                   /protein_id="CBX19717.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 56 A; 63 C; 99 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagatac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer