Dbfetch

ID   FR690498; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR690498;
XX
DT   09-SEP-2010 (Rel. 106, Created)
DT   09-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*040301V, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Qu J.;
RT   ;
RL   Submitted (08-SEP-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li L., Chen H., Shen M., Liao K., Wang L., Hu Z., Huang C., Zhou M.,
RA   Deng X., Zhen H., Chen Y., Zheng Z., Hua S., Zhang H., Cheng Z., Qian P.,
RA   Liang J., Tang J., Zhang W., Ceng Y., Yang X., Liu B., Tang L., Zhang L.,
RA   Liu X., Xue Y., Yin J., Zhang K., Huang H., Wang Z., Li Y., Chen C.,
RA   Tao D., Pan J., Wu S., Long K., Zheng K., Wang N., Lu X., Song X.,
RA   Huang J., Wen J., Tian Z., Zhou C.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
DR   MD5; 1da3eba2a51dbd0ee0fd02e15f163dd1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10008512"
FT                   /db_xref="taxon:9606"
FT   exon            1..269
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040301V"
FT                   /number=2
FT   CDS             <1..>269
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*040301V"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WN73"
FT                   /db_xref="IMGT/HLA:DRB1*04:93"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E0WN73"
FT                   /protein_id="CBX19716.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDVLEQRRAEVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 63 C; 99 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacgtcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//