Dbfetch

ID   FR690493; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR690493;
XX
DT   09-SEP-2010 (Rel. 106, Created)
DT   09-SEP-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, allele
DE   HLA-DQB1*050301V_1, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Qu J.;
RT   ;
RL   Submitted (08-SEP-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li L., Chen H., Shen M., Liao K., Wang L., Hu Z., Huang C., Zhou M.,
RA   Deng X., Zhen H., Chen Y., Zheng Z., Hua S., Zhang H., Cheng Z., Qian P.,
RA   Liang J., Tang J., Zhang W., Ceng Y., Yang X., Liu B., Tang L., Zhang L.,
RA   Liu X., Xue Y., Yin J., Zhang K., Huang H., Wang Z., Li Y., Chen C.,
RA   Tao D., Pan J., Wu S., Long K., Zheng K., Wang N., Lu X., Song X.,
RA   Huang J., Wen J., Tian Z., Zhou C.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
DR   MD5; 7f31541180858826074db4ac2a5026b0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10013025"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*050301V_1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*050301V_1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WN68"
FT                   /db_xref="IMGT/HLA:DQB1*05:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E0WN68"
FT                   /protein_id="CBX19711.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEDVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRR"
XX
SQ   Sequence 270 BP; 58 A; 65 C; 106 G; 41 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag                                        270
//