spacer

EBI Dbfetch

ID   FR690487; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FR690487;
XX
DT   09-SEP-2010 (Rel. 106, Created)
DT   14-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*310102, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Qu J.;
RT   ;
RL   Submitted (08-SEP-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li L., Chen H., Shen M., Liao K., Wang L., Hu Z., Huang C., Zhou M.,
RA   Deng X., Zhen H., Chen Y., Zheng Z., Hua S., Zhang H., Cheng Z., Qian P.,
RA   Liang J., Tang J., Zhang W., Ceng Y., Yang X., Liu B., Tang L., Zhang L.,
RA   Liu X., Xue Y., Yin J., Zhang K., Huang H., Wang Z., Li Y., Chen C.,
RA   Tao D., Pan J., Wu S., Long K., Zheng K., Wang N., Lu X., Song X.,
RA   Huang J., Wen J., Tian Z., Zhou C.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Qu J.;
RT   ;
RL   Submitted (14-SEP-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
DR   MD5; 20a7d1d8179b1584a50f84b756958cb7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="D10008098"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WN62"
FT                   /db_xref="IMGT/HLA:A*31:01:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E0WN62"
FT                   /protein_id="CBX19705.2"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*310102"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 161 C; 196 G; 81 T; 100 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca gcaggacgcc tacgacggca aggattacat cgccttgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagttgaga gcctacttgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer