spacer

EBI Dbfetch

ID   FR687360; SV 1; circular; genomic DNA; STD; PRO; 822304 BP.
XX
AC   FR687360;
XX
PR   Project:PRJEA51915;
XX
DT   15-NOV-2010 (Rel. 106, Created)
DT   16-FEB-2011 (Rel. 107, Last updated, Version 3)
XX
DE   Burkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence
XX
KW   .
XX
OS   Burkholderia rhizoxinica HKI 454
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia.
OG   Plasmid pBRH01
XX
RN   [1]
RP   1-822304
RA   Lackner G.;
RT   ;
RL   Submitted (01-SEP-2010) to the INSDC.
RL   Lackner G., Leibniz Institute for Natural Product, Research, Biomolecular
RL   Chemistry, Beutenbergstr. 11a, 07743 Jena, GERMANY.
XX
RN   [2]
RX   DOI; 10.1128/JB.01318-10.
RX   PUBMED; 21131495.
RA   Lackner G., Moebius N., Partida-Martinez L., Hertweck C.;
RT   "Complete genome sequence of Burkholderia rhizoxinica, an Endosymbiont of
RT   Rhizopus microsporus";
RL   J. Bacteriol. 193(3):783-784(2011).
XX
DR   MD5; d447c1d46e8f16cb6c05f0660f2f31cc.
DR   BioSample; SAMEA2272497.
DR   EuropePMC; PMC3021220; 21131495.
DR   EuropePMC; PMC3102044; 21539752.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   StrainInfo; 756752; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822304
FT                   /organism="Burkholderia rhizoxinica HKI 454"
FT                   /plasmid="pBRH01"
FT                   /strain="HKI 454"
FT                   /isolate="B1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:882378"
FT   CDS             complement(148..450)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03471"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03471"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76421"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATJ7"
FT                   /protein_id="CBW76421.1"
FT                   /translation="MQARRQPVPVLVLVSVSVPMPSDGTPVFRYQYSESIKGTPLHQYT
FT                   YTRSRTTLAWHCPIKVRATLVPLLYLVCIAIAALACAEMAPDDGPAYGAELEGFG"
FT   CDS             complement(454..906)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03470"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76422"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATJ8"
FT                   /protein_id="CBW76422.1"
FT                   /translation="MPGIAAPPGKRHLRQYLYKYTVYERKEIKMDDAFFSERAFDRAAA
FT                   DLRRIVHAIAGRYRVRGEPLTWRRLHDIEAEALSDLGLSCRHDASLLALFSPSLEHDFP
FT                   HSDEVVCVSGAQRVPLITWFVFDVYDLIATPAPRPPQVQYKTAAMS"
FT   CDS             896..1171
FT                   /transl_table=11
FT                   /locus_tag="RBRH_04214"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_04214"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76423"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATJ9"
FT                   /protein_id="CBW76423.1"
FT                   /translation="MPGKPMRRSMPQVAVFVDALRAAFGDVEIDSMIARGLAGEPVFYA
FT                   QEGGESIGTPVPCSSEGWRGAGLAARHYCPDCSGDCVGTARRCTKP"
FT   CDS             complement(1317..1559)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03469"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03469"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76424"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK0"
FT                   /protein_id="CBW76424.1"
FT                   /translation="MNSGHACGTRPKRQPPVHGINTRRHCIERDRDALVSCRLDDRVGH
FT                   AQAQVAQRQKQHDEPQTREPRPASEDRSHDELSLN"
FT   CDS             complement(1576..1734)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_04215"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_04215"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76425"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK1"
FT                   /protein_id="CBW76425.1"
FT                   /translation="MLEPAAFVSHRAITGNEQLTLSSLCQPAPLSRHIGWLDVTDPSGT
FT                   CYFGVNG"
FT   CDS             complement(1727..1933)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03467"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03467"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76426"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK2"
FT                   /protein_id="CBW76426.1"
FT                   /translation="MKQETVWSWTWREGSMTQKNYFNMHFGADHTVTTTSRSDVMCEHE
FT                   CTQFSTDFVNVPVNILGTSGASA"
FT   CDS             1959..2063
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03465"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03465"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76427"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK3"
FT                   /protein_id="CBW76427.1"
FT                   /translation="MLSSIAAKIRSERRQAQSPSYLFISAFAFLQIRN"
FT   CDS             2347..4500
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03464"
FT                   /product="Hypothetical protein"
FT                   /function="Hypothetical protein"
FT                   /note="Hypothetical protein"
FT                   /note="Pfam: Autotransporter beta-domain::PF03797"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03464"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76428"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK4"
FT                   /protein_id="CBW76428.1"
FT                   /translation="MTFFEDMKLKFTPGQCAERIRLFSSNRVLRAIMSCAVVYFAVDST
FT                   DVNATEERKNKLHVSGSSNSEQPAGLSKKAQKKQKKEQGARQSVLDRQEARRRAQEEQE
FT                   AKRVVEKLLQDQKEQEEKRVVQEQPEAKRVAQEQPEAKRVAQEQPEEKRVVQEQPEEKR
FT                   VVQEQPEEKRVAQEQPEEKRVVQEQPEEKRVVQEQPEEKRVVQEQPEEKRVAQEQPEEK
FT                   RVAQEQPEEKRVVQEQPEEKRVAQEQPEEKRVAQEQPEEKRVVQEQPEEKRVAQEQPEE
FT                   KRVVQEQPEEKRVAQEQQEVGQQEEALAQVHEEEAHQQEEASNQVKEEPAQQESAAVDS
FT                   KPREAVALIDDKPSPDDRLREMIASYSLLEGNVLHSAERMSEDGTIVVGEGFINGRAQP
FT                   FIARDDEGKIGIVGLLDLNDSLNNATLYSSVLQSAVQTFVQDSMRCSNFDQYGVCISAG
FT                   ALYSHNAGKVNGANWQGEFSAAYRINDDWIAGLGYQAPSYRFDVSNDTMRNRASLFGLF
FT                   AEYGTRTRPGVFARVALGYQQGDLSIDRSYLTASGVDRSKGDTTVAQRAVSTQGGYVFA
FT                   VRNASIMPYLGIDYLRTKLGDYTETSGQFPVRFSARTDGNVYGTVGLSSHLRFTDQTVI
FT                   SAGVKHVQRLSRSNDPVSASVSAFDPFVVGAESTRQWSEISVGGRFATPVKASSLDIGY
FT                   RRRFASGAAVAQDMGSVFFTMGF"
FT   CDS             4537..4668
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03463"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03463"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76429"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK5"
FT                   /protein_id="CBW76429.1"
FT                   /translation="MGAHECTAYLEAHGIDYFAVRVHLLQQMTARPWWSVDAPYGTE"
FT   CDS             4976..5083
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03462"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03462"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76430"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK6"
FT                   /protein_id="CBW76430.1"
FT                   /translation="MILLHGRDAQRAWFHHLPGNEPLLAKVYLRFVTTV"
FT   CDS             complement(5251..5685)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03461"
FT                   /product="Type 1 capsular polysaccharide biosynthesis
FT                   protein J"
FT                   /function="Type 1 capsular polysaccharide biosynthesis
FT                   protein J"
FT                   /note="Type 1 capsular polysaccharide biosynthesis protein
FT                   J"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03461"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76431"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK7"
FT                   /protein_id="CBW76431.1"
FT                   /translation="MSMDGLMLENFSSSIYHREQICNPFSRPRLYDCLCHAHGRRLETR
FT                   RLVESNLSTRALPMKILFGAFTRHPASVGESYLQHMRASFSFGGPMLLAAFAALVHGLF
FT                   PFLFVKTGSTTVSRLYERMVLHRSGGALRHQPISGQPPHA"
FT   CDS             5642..6169
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03460"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /function="Transcriptional regulator, AsnC family"
FT                   /note="Transcriptional regulator, AsnC family"
FT                   /note="COG: Transcriptional regulators"
FT                   /note="Pfam: AsnC family::PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76432"
FT                   /db_xref="GOA:E5ATK8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK8"
FT                   /protein_id="CBW76432.1"
FT                   /translation="MELEKFSNINPSMDKIDAKILSLLQHDASLGLNDIAKAVNLSPTP
FT                   CWRRIQKLREDGVIQRQVVLCDPTKLNLGLTAFVTIRASQHNDGWTSRFLKGVTAIPEI
FT                   VEIYRMTGDVDYLLKVVVPDIAGYDNVYKRLIKAAELLDVSASFAMEVVKHTTAFPLDH
FT                   VTDRRARATSRR"
FT   CDS             complement(6132..6551)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03459"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03459"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76433"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATK9"
FT                   /protein_id="CBW76433.1"
FT                   /translation="MFCAYADVHVQPRSQAQINANAPTTHALRPTLSAGLVLRRRVPMG
FT                   RQIRAGELVLRVQAQANTQADQAIYDDTARDDCRDSRRKYQQKKELDQRIDLILLAYRA
FT                   QLKEGKARVHRKHHAGARPAQLLIIVETWPVRGGQ"
FT   CDS             6598..6885
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03458"
FT                   /product="Adenosine 5'-monophosphoramidase"
FT                   /function="Adenosine 5'-monophosphoramidase"
FT                   /note="Adenosine 5'-monophosphoramidase"
FT                   /note="COG: Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03458"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76434"
FT                   /db_xref="GOA:E5ATL0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL0"
FT                   /protein_id="CBW76434.1"
FT                   /translation="MPCGGLDDGTGGTRLRLRSTCLRPGVKAAMSYDPNNPFARILRGE
FT                   LPCVKVAETGDVLAFMDLMPQANGHVLVVPKEAAAKIFDLSDAAGAACDV"
FT   CDS             6857..7504
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03457"
FT                   /product="Lysine exporter protein"
FT                   /function="Lysine exporter protein"
FT                   /note="Lysine exporter protein"
FT                   /note="COG: Putative threonine efflux protein"
FT                   /note="Pfam: LysE type translocator::PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03457"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76435"
FT                   /db_xref="GOA:E5ATL1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL1"
FT                   /protein_id="CBW76435.1"
FT                   /translation="MRRGQRAMFELSTLGTFVVVVLGLFLIPGPAVLLVLTRTVQGGRK
FT                   TGVLTGLGLAAGDFIHTVFAAVGLSALLMTSALAFNIVKLVGAAYLLYLGVRALRKKTA
FT                   DGHAPAPAAGEISPLKAFLQAVPAEVLNPKTALFFLAFLPQFVQPERGATFVQFTVLGL
FT                   IFVAMSMVYTTLLVVAMRPLARLVAKLHWLRRWQQKIIGVIFISLGLKVAMQ"
FT   CDS             7572..8696
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03456"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase (EC
FT                   2.5.1.54)"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase (EC
FT                   2.5.1.54)"
FT                   /EC_number="2.5.1.54"
FT                   /note="3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54)"
FT                   /note="COG: 3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /note="Pfam: DAHP synthetase I family::PF00793"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03456"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76436"
FT                   /db_xref="GOA:E5ATL2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL2"
FT                   /protein_id="CBW76436.1"
FT                   /translation="MTRIDNPSHDQEMSVADTTQDTTRIDDVRIGAVRPLIPPALLLDE
FT                   LPAPASVQQLVEHSRLRIADVLNGRDDRLILVVGPCSIHDRDQALDYARRLKGAADRLH
FT                   KDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRRARELLLQINGLGLPTATE
FT                   FLDLLSPQYIADLVAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVAADAIVA
FT                   ARASHAFMGMTKMGMAAIFETRGNGDAHVILRGGKNGPNYDAAAIEESCAVLRAAGLRE
FT                   HVMVDCSHANSGKSHLRQADVARDLAAQLSRGERRLSGVMIESHLDEGRQDLKPGVPLR
FT                   WGVSITDACLGWAQTEPVLEMLAGAVRARRAAAA"
FT   CDS             8717..8944
FT                   /transl_table=11
FT                   /locus_tag="RBRH_04216"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_04216"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76437"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL3"
FT                   /protein_id="CBW76437.1"
FT                   /translation="MRSLLTMAGRLSRERGPGRDEVRGSIRRRIAPLGVVRVEQSHIAC
FT                   DPFRYVRDPFKYQCAQQWQPGRCARIDETA"
FT   CDS             9040..9213
FT                   /transl_table=11
FT                   /locus_tag="RBRH_04217"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_04217"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76438"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL4"
FT                   /protein_id="CBW76438.1"
FT                   /translation="MRRFCRTSHAARRMSHVACRMSPRAVAQTNRRLDRAWPQQIPVNQ
FT                   GLVRLLEQKRYV"
FT   CDS             9206..10702
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03454"
FT                   /product="Acetate CoA-transferase alpha subunit (EC
FT                   2.8.3.8)"
FT                   /function="Acetate CoA-transferase alpha subunit (EC
FT                   2.8.3.8)"
FT                   /EC_number="2.8.3.8"
FT                   /note="Acetate CoA-transferase alpha subunit (EC 2.8.3.8)"
FT                   /note="COG: Acetyl-CoA hydrolase"
FT                   /note="Pfam: Acetyl-CoA hydrolase/transferase N-terminal
FT                   domain::PF02550"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03454"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76439"
FT                   /db_xref="GOA:E5ATL5"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL5"
FT                   /protein_id="CBW76439.1"
FT                   /translation="MYEERIRCASLRNRLISARDAAALIHDGMRVGTSGFTRAGDPKAV
FT                   LLALAERARTEPTRPRITLMTGASLGHDNDKALSEAGMLARRLPFQADPTLRREINSGR
FT                   TLFVDQHLSETVEMLRADLLGQLDVAIIEATGITESGGIVPSTSVGNSASFAILAKRVI
FT                   IELNLAQPLELEGLHDIWIPARRPDRAPVPIAGPRDRIGTTTIDIPLDKIAGIVITNDE
FT                   DSSSAVLPADSDTTRIAQHLIEFLQHEVSLARLPVRLPPLQAGIGTIANAVLGGLCASP
FT                   FEAMTMYSEVLQDSTFDLIDAGKLAFASGSSITLSAARQRQVLRELARYRDRLVLRPQE
FT                   ISNHPEIVRRLGVIAVNTALEVDLYGNVNSTHIGGTHMMNGIGGSGDFARNAGCAIFAT
FT                   KSVAKDGRISSIVPMVPHCDHNEHDVDIVVTEQGLADLRGLAPRERAGLIIERCAHPQY
FT                   RDLLRDYYRDALKGQGHTPHDLAQAFSFHLRLARTGTMLP"
FT   CDS             10751..10975
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03453"
FT                   /product="putative ATPases involved in pili biogenesis"
FT                   /function="putative ATPases involved in pili biogenesis"
FT                   /note="putative ATPases involved in pili biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03453"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76440"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL6"
FT                   /protein_id="CBW76440.1"
FT                   /translation="MSRDEYEQYLARVYKAADFKKGRNFIGLAKSLPAEQMRELLGSTI
FT                   RGPRPVSISAFTEPTRVAGTRRTTLSEVR"
FT   CDS             10972..11220
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03452"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03452"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76441"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL7"
FT                   /protein_id="CBW76441.1"
FT                   /translation="MKAARWIGGLLLLSSCGSSQPLFTSDGRPTQLIQCSSAEGWSSCD
FT                   ARAQVQCGDAGYDTLQRNRSDGMLSTLIACKRPAAAY"
FT   CDS             11349..11531
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03451"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03451"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76442"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL8"
FT                   /protein_id="CBW76442.1"
FT                   /translation="MQFVIFNLPADLSEEALRDRLAPIGARLVEIIRDNVERARAIIEV
FT                   AHMAMASHALALNFD"
FT   CDS             complement(11610..11723)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03450"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76443"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATL9"
FT                   /protein_id="CBW76443.1"
FT                   /translation="MPFFQMERQNEMEQRVKFIFVAVLAMLSLIGMFGEMG"
FT   CDS             complement(11743..12669)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03449"
FT                   /product="Transporter, drug/metabolite exporter family"
FT                   /function="Transporter, drug/metabolite exporter family"
FT                   /note="Transporter, drug/metabolite exporter family"
FT                   /note="COG: Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /note="Pfam: Integral membrane protein DUF6::PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03449"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76444"
FT                   /db_xref="GOA:E5ATM0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM0"
FT                   /protein_id="CBW76444.1"
FT                   /translation="MQVSDTLPIMSRTTRLTPLLLLCLLITYVVWGTTYFAISVALRAM
FT                   PPFMLMASRFAVAGLCLGIFVLVRGRARASWRQVRNGSMLGALMLLGGMGGIAVAEQTI
FT                   SSGATTVMIAAMPIVAIVWQRLFGIRPRGHELAAIAIGVGGVLVLTSGAEFRASSMGAG
FT                   ALLLAISCWSLGTQLSRSLDLPPPALAVTIEMLAGSVMLAIASALSGESLAAVPGGAPL
FT                   AAWLYLVTMGSLLAFSAYMYLASRAAPVLATSYVYANPPIALLVGAALGSEQIAPQTLV
FT                   AIALILCALAVLGWGTWRQPAGTAKDT"
FT   CDS             12834..13073
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03448"
FT                   /product="Two-component response regulator"
FT                   /function="Two-component response regulator"
FT                   /note="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03448"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76445"
FT                   /db_xref="GOA:E5ATM1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM1"
FT                   /protein_id="CBW76445.1"
FT                   /translation="MEVASPSQGELVAEHLGFGLFVVDRQINARMWNRLVRDHSGKTMA
FT                   KMLGKALFESFPDLPRNWLMRSTHRTSRSALALA"
FT   CDS             13019..13165
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03447"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03447"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76446"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM2"
FT                   /protein_id="CBW76446.1"
FT                   /translation="MAHAQHAQDVAIRVSARVDVAAARLGMRSHKVSLNEADAALHAAK
FT                   RSG"
FT   CDS             complement(13218..13622)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03446"
FT                   /product="Acylphosphatase (EC 3.6.1.7)"
FT                   /function="Acylphosphatase (EC 3.6.1.7)"
FT                   /EC_number="3.6.1.7"
FT                   /note="Acylphosphatase (EC 3.6.1.7)"
FT                   /note="COG: Acylphosphatases"
FT                   /note="Pfam: Acylphosphatase::PF00708"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03446"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76447"
FT                   /db_xref="GOA:E5ATM3"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM3"
FT                   /protein_id="CBW76447.1"
FT                   /translation="MLGRIRVAESVHDARGATTIRGLNGSVTFTRQEGYTMHGVDLDTR
FT                   VETYTVKIRGTVQGVGFRHXAVRRAHALQVRGWIANHDDGSVEAIVQGPANQVDLMLEF
FT                   LRRGPPRAKVSEFIANEDYSERRYDRFEQH"
FT   CDS             13840..14208
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03445"
FT                   /product="Thiol-disulfide isomerase and thioredoxins"
FT                   /function="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="Thiol-disulfide isomerase and thioredoxins"
FT                   /note="COG: Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03445"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76448"
FT                   /db_xref="GOA:E5ATM4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM4"
FT                   /protein_id="CBW76448.1"
FT                   /translation="MRLCCSECNVWRERGMEEQCPYTPDAPAREQLDVLAGVTVIEFGT
FT                   NWCGYCQRAQPVIAEALGRHQAMRHLKIEDGPGRLLGRSFRVKLWPTLIFLRDGQERAR
FT                   VVRPTCAEELDNALATLR"
FT   CDS             complement(14395..14898)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03444"
FT                   /product="Thiol:disulfide interchange protein DsbC"
FT                   /function="Thiol:disulfide interchange protein DsbC"
FT                   /note="Thiol:disulfide interchange protein DsbC"
FT                   /note="COG: Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03444"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76449"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM5"
FT                   /protein_id="CBW76449.1"
FT                   /translation="MHFDKRGVDFSTLPLDDTLRSVNGDGDGDGDGSRRIVVFSDPYCS
FT                   YCKTLEHRLAGQPDATVYTFLYPILTPGSKTMAARIWCASNRTGPWSTWMLENRAQPPV
FT                   AASCDATAAVLARNLIVGHKLRVMGTPTLILSNGQRINRMPSAAELEQALAVAGEPSHT
FT                   ASTR"
FT   CDS             15535..16503
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03999"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03999"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76450"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM6"
FT                   /protein_id="CBW76450.1"
FT                   /translation="MRERLMLNVFSSICCWPLRTGKKSSGASAARKESQAADKAAPRVR
FT                   SAHPALETLSNVSRITPGRRRHSPSAYAKEMTENQDAILLTLMFMCSVQQCAAPANGGR
FT                   ADSASSPPKALTTLYDLCDDIERYVRRQGINHDVTPALRQFMTRTAAMQNVLAQRGEPA
FT                   WGRLQQMLDRLQQMIDLSDSNADPAHALGNQDGYARHDACTVFESFLDMFDDKWIPSLS
FT                   KLKISDAEAQQEGRTRLESACGRLSMGEKWQVSQMIEARKRQEKLGAWGTMLQQALGPV
FT                   TLQLPPVATPGFSLDVDAVFKRAREGAAVDAFRRDLSGHNR"
FT   CDS             16536..16640
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03998"
FT                   /product="Aspartate aminotransferase (EC 2.6.1.1)"
FT                   /function="Aspartate aminotransferase (EC 2.6.1.1)"
FT                   /EC_number="2.6.1.1"
FT                   /note="Aspartate aminotransferase (EC 2.6.1.1)"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03998"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76451"
FT                   /db_xref="GOA:E5ATM7"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM7"
FT                   /protein_id="CBW76451.1"
FT                   /translation="MFDGWKAPSIMQVPDAKDIAVEFFTLPKRYHMAS"
FT   CDS             complement(16700..17611)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03997"
FT                   /product="3-hydroxyisobutyrate dehydrogenase and related
FT                   proteins"
FT                   /function="3-hydroxyisobutyrate dehydrogenase and related
FT                   proteins"
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   proteins"
FT                   /note="COG: 3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /note="Pfam: NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase::PF03446"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03997"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76452"
FT                   /db_xref="GOA:E5ATM8"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM8"
FT                   /protein_id="CBW76452.1"
FT                   /translation="MTDQSSPSSSGTPRRVAFLGLGVMGYPMAGHLAKAGLDVTVYNRT
FT                   TAKAQQWVAEYGGRSATTPREAAQGADIVLACVGNDDDLRSVTLGGQGAFAGMPHGAVF
FT                   VDHTTASANVARALFSIAREQGLHFIDAPVSGGQAGAQNGKLTIMCGGDATVFERVAPT
FT                   LRHYSVAVTLLGESGAGQLTKMVNQIAVAGVVQGLSEAIHFGQRAGLDMPRVLEVIGKG
FT                   AAASWQMDNRGSTMIEGRFDFGFAVEWMRKDLAICLDEAKRNGASLPVTALVDQFYGDV
FT                   QALGGRRYDTSSLIVRLRKLSA"
FT   CDS             complement(17651..17833)
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03996"
FT                   /db_xref="EnsemblGenomes-Gn:RBRH_03996"
FT                   /db_xref="EnsemblGenomes-Tr:CBW76453"
FT                   /db_xref="UniProtKB/TrEMBL:E5ATM9"
FT                   /protein_id="CBW76453.1"
FT                   /translation="MRIRAGKKAFHQRNRHAGNERIRGLERVTDRNQHGDNGMPDRYCV
FT                   TSIMADRRHLAQHLR"
FT   CDS             17984..19774
FT                   /transl_table=11
FT                   /locus_tag="RBRH_03995"
FT                   /product="Acyl-CoA dehydrogenase (EC 1.3.99.3)"
FT                   /function="Acyl-CoA dehydrogenase (EC 1.3.99.3)"
FT                   /EC_number="1.3.99.3"
FT                   /note="Acyl-CoA dehydrogenase (EC 1.3.99.3)"
FT                   /note="COG: Acyl-CoA dehydrogenases"
FT                   /note="Pfam: Acyl-CoA dehydrogenase, C-terminal
FT                   domain::PF00441
Acyl-CoA dehydrogenase, middle FT domain::PF02770" FT /db_xref="EnsemblGenomes-Gn:RBRH_03995" FT /db_xref="EnsemblGenomes-Tr:CBW76454" FT /db_xref="GOA:E5ATN0" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR013786" FT /db_xref="InterPro:IPR020953" FT /db_xref="InterPro:IPR025878" FT /db_xref="UniProtKB/TrEMBL:E5ATN0" FT /protein_id="CBW76454.1" FT /translation="MSYRAPVKDMLFTMNVLADIDAVSRLPGYEDATLETAQAVLEEAA FT KFAERVLAPLNRTGDTQPSTWADGAVTTTPGFKQAYRQYTQGGWQAVVHPPEFGGQGLP FT KLIATACNEMFNAANLSWALCPLLTDGAIETLLTAGSDGQKACYLPKLIAGEWTGTMNL FT TEPQAGSDLSLVRTRAERQADGTYKLFGTKTFITYGEHDMADNIVHLVLARTSDAPPGV FT KGISLFIVPKFLLGGDGLPGTRNDVDCVSIEHKLGIKASPTAVLQFGDHGGAIGELVGE FT ENRGLEYMFIMMNSARFSVGVQGVAIAERAYQQAAAYAAERVQSRPVDGSAKQAVTIDQ FT HPDVKRMLMTMRALIEGARSLNYFAASACDIAHRHPDASVRQQYARRYEFLVPIVKGWS FT IELSVEVASMGVQVHGGMGFVEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTVHDG FT GAVARGLCEHIALTERELANYKEPVFAAMRERLAAARAALAESIEFVLRHAKTDPNAVY FT AGSVPYLRLCGIVLCGWQLARAMLAAHATRAQDPAFCDAKIATAHCFAHHVLPQADALR FT VAIVSTANGEGVLAPVRHSA" FT CDS complement(20074..21330) FT /transl_table=11 FT /locus_tag="RBRH_03994" FT /db_xref="EnsemblGenomes-Gn:RBRH_03994" FT /db_xref="EnsemblGenomes-Tr:CBW76455" FT /db_xref="UniProtKB/TrEMBL:E5ATN1" FT /protein_id="CBW76455.1" FT /translation="MSARLKTPHGVAPGFIRRESARSGKHVRNTRRIEPRLGPAKTRAA FT DPRSRADSPASDEGSYHARQHAAEPVSATARSFDTAPASFVTPPWTGLQRAPLARRHMA FT ALAALLALGAGALGVMLSQLYQDRTPSEPRRYAEAMNREAPTQSDASASTVPLLDVAAL FT ANTTGRLSAQAPQQAIMPPLNIPPSPQARAPASDTAALASMQPARGANPASMDSGTVQR FT GLPRTFHARTRKAIPPATQDTDGHTTPVAAHAGFPETEPLSMPRQVAHPAQHAAAAAAP FT AEPIQPIADTPSVSRTEARAATDALTQDAVKPLPPETARVDPTQPPVVYGGHTTPSAAA FT AVPRPPATTMPYATEATGPHAPPSAAEATAALTAKAVALPQPVQPAATATRPALAQPPA FT DTGAPASIDDEPAAPIDDQ" FT CDS 21257..21412 FT /transl_table=11 FT /locus_tag="RBRH_03993" FT /db_xref="EnsemblGenomes-Gn:RBRH_03993" FT /db_xref="EnsemblGenomes-Tr:CBW76456" FT /db_xref="UniProtKB/TrEMBL:E5ATN2" FT /protein_id="CBW76456.1" FT /translation="MPLRADSRLMKPGATPWGVFSLALMVSMVTVRELADFRGAIQRFM FT CGRAHC" FT CDS complement(21481..22038) FT /transl_table=11 FT /locus_tag="RBRH_03992" FT /product="CBS domain containing protein" FT /function="CBS domain containing protein" FT /note="CBS domain containing protein" FT /note="COG: FOG: CBS domain" FT /note="Pfam: CBS domain pair::PF00571" FT /db_xref="EnsemblGenomes-Gn:RBRH_03992" FT /db_xref="EnsemblGenomes-Tr:CBW76457" FT /db_xref="GOA:E5ATN3" FT /db_xref="InterPro:IPR000644" FT /db_xref="UniProtKB/TrEMBL:E5ATN3" FT /protein_id="CBW76457.1" FT /translation="MGNTSLVGNTHLVGAPRSTRAAHSIPPRARTAPAQGGHPMATVAQ FT ILKSKPDTTVYTIDASALVYDAMKRMAEKQIGALVVTENGKIVGIVTERDYARKIVLMD FT RSSKATAVRDIMTRDVRYVRPEDSAQGCMALVTEHRMRHLPVIDGGRLVGMISIGDLVK FT HIISDQAFTIQQLEFYIRGERA" FT CDS complement(22114..22719) FT /transl_table=11 FT /locus_tag="RBRH_03991" FT /db_xref="EnsemblGenomes-Gn:RBRH_03991" FT /db_xref="EnsemblGenomes-Tr:CBW76458" FT /db_xref="UniProtKB/TrEMBL:E5ATN4" FT /protein_id="CBW76458.1" FT /translation="MKPPVTRGSPIGQHDEGIHEKTIIAALSVTVAGCASQNQVSSQTM FT AQAVALLSCMRKVQCDAWWQRAQVWISEHSAYRIATITDSVIQTEGPSATRRDLAYVIT FT KTPNNDGSAAIGFSAQCSNILGCLPNPWEAGANFKQFIRYERAMQPAAHSDTPSANAAA FT PIRTAPGTSVAPPPPVPAAAPPAASGALHAGTPPRAVQ" FT CDS complement(22753..22983) FT /transl_table=11 FT /locus_tag="RBRH_03990" FT /db_xref="EnsemblGenomes-Gn:RBRH_03990" FT /db_xref="EnsemblGenomes-Tr:CBW76459" FT /db_xref="UniProtKB/TrEMBL:E5ATN5" FT /protein_id="CBW76459.1" FT /translation="MRVSPWHYLANHYTCGYRYHLSDSAPPAARAEHHRANLHMLLVTY FT ALAQLLCLPILMLWVFVQCGKPLSSLTREDP" FT CDS complement(22952..23152) FT /transl_table=11 FT /locus_tag="RBRH_03989" FT /db_xref="EnsemblGenomes-Gn:RBRH_03989" FT /db_xref="EnsemblGenomes-Tr:CBW76460" FT /db_xref="UniProtKB/TrEMBL:E5ATN6" FT /protein_id="CBW76460.1" FT /translation="MPQALYEWQHDLSPLLTNVRLQTITIASSYFAPYIILTPIDHRGR FT YYFIRQRTAILYARESLALSC" FT CDS complement(23564..23671) FT /transl_table=11 FT /locus_tag="RBRH_03988" FT /db_xref="EnsemblGenomes-Gn:RBRH_03988" FT /db_xref="EnsemblGenomes-Tr:CBW76461" FT /db_xref="UniProtKB/TrEMBL:E5ATN7" FT /protein_id="CBW76461.1" FT /translation="MRLRANWHYNRSSKTVKKNRASQYVAQARRHWVQY" FT CDS complement(23695..23829) FT /transl_table=11 FT /locus_tag="RBRH_03987" FT /db_xref="EnsemblGenomes-Gn:RBRH_03987" FT /db_xref="EnsemblGenomes-Tr:CBW76462" FT /db_xref="UniProtKB/TrEMBL:E5ATN8" FT /protein_id="CBW76462.1" FT /translation="MMTRRLQFLVIHCGDRGHLSARVSVSFVSLDRPLITPTPIYVKL" FT CDS 23940..46916 FT /transl_table=11 FT /locus_tag="RBRH_01504" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_01504" FT /db_xref="EnsemblGenomes-Tr:CBW76463" FT /db_xref="GOA:E5ATN9" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5ATN9" FT /protein_id="CBW76463.1" FT /translation="MDASVMSTTYALSAAQTEIWLAQQLYPDSPVYNIAQYTVIEGVIE FT PAVFEAALRQVIDEADTLRLQFIDSDDGLRQRIGTPAWSMPVLDLTAQADPQAAAQAWM FT RADYQQPVNLTQGPLFCYALLKVAPAQWMWYQRYHHIMMDGYGRYLIAQRVAYVYSALC FT EGTTPAECDFGSILQLLESDAQYQISAQRAQDEAYWLKHCANWSEPATLASRSAPVLQQ FT RLRQTTYLAIQALGDTAPDARRLAQFMTAAMAAYLYRFTGEQDVVLGLPVKVRFGADRH FT IPGMKSNTLPLRLTMRPGMNLSSLMQQAAQEMQSGLRHQRYPSEALRRQLGMPSGQRLF FT GTTVNVMPFDLDLSFGGYSATNHNLLNGPAEDLMLGVYWTPGSHQLRIDFDANPACYTP FT EGLGAHQRRFIRFMQVLAADATQPIDSIDLLDANERHRLLVEWNATQRDYPAHLCVHQL FT FEAQVERTPKATALVYEDQTLSYTQLNAQANRLAHQLIELGVKPDVRVAICVERSPALV FT VGLLAILKAGGAYVPLDPSYPGERLAHILGNAEPNMVLADAAGRTALGEAALAECTVLD FT PATLPALPDTNPSVAELTARHLAYVIYTSGSTGTPKGVMVEHRNVANLCAWHNRKFGVQ FT SGCRSAFMAGMAFDASAWELWPSLIGGGMLSIPSQAVCEQVLALLQWWQQQLLDVAFLV FT TPLAEMALADQRTPAGLRYLLTGGERFPGVTRALPAGLTLVNQYGPTEATVVATSGQLS FT AEDTLPHIGRPIDNTRIYILDAYRQPVPLGAVGELYIGGTGVARGYLNRPELTAERFVP FT DPFSEDADARLYKTGDLARYLPDGNLEFVGRNDDQVKIRGFRIEPGEIEACLMAHSQVR FT DAVVLATGESQDKRLVAYVVAKPDEVLVSTLWAHVSARLPEYMVPSAFVRLDALPLTPN FT GKLDRRALPAPDDAALAHQAYEAPQGELETTLATIWAELLGVERVGRHDSFFALGGHSL FT LAVRLMNRVRGLGADVPLATLFVAPTLAAFAAALEAHLQQGTDTLPEITPVSREGHLPL FT SFAQQRLWFLAQLDGASESYHMPLVLRVRGPLDRAAWQQALDTLFARHEALRSTFVSVE FT GQPRVQLLPADMGVPLRWHDLRGVPHAQAQLARLSHEAAHAPFDLAQGPLMRACGIQVA FT DEEHVVLLIQHHIVSDGWSIGVLVRELSALYAASVGAQAEPLPPLAVQYPDYAAWQRQW FT LTDERLNAQSDYWRATLADAPVQLALPTDRPRPAQQSFAGAQVPVRIDAATTQALKRLS FT AEHGTTLFMTVLAAWSAVLARLSGQYDVVIGTPSAHRNHRQIELLIGFFVNTLALRVDL FT SGEPDIAELLARVRRTTLDAQAHQDLPFEQVVEIVQPPRRLNHTPLFQVMLAWQNNAPG FT EWRLPGLTATPAELEYEVVKFDLELNLSEAGDEIIGSLGYATALFDRSTIERHVGYLQT FT MLRAMVACPQQPVATLQMLGSDERQLLLDTWNATQRDYPSHLCVHQLFEAQVERTPEAP FT ALVYEAQTLSYAQLNAQANRLAHQLIELGGVKPDIRVAICVERSPALVVGVLAILKAGG FT AYVPLDPAYPSERLAYILADAAPNIVLADAAGRAALGDAVIAECTVLDPATLPALPDTN FT PSVAELTARHLAYVIYTSGSSGTPKGVMVEHAQVVRLFEATQPWYGFNEHDTWCLFHSF FT AFDFSVWELWGALRYGGKLVIVPHPIARSADAFYPLICEQGVTVLNQTPSAFKALMASQ FT AHSALSDQLRYVILGGEALEPTLLQAWYATHDERHPQLFNMYGITEATVHVTYRPLRQQ FT DSEQAGSPVGTRIPDLTIYLLDAHGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFV FT HDPFSEDADARLYKTGDLARYLPDGNLEFVGRNDEQVKIRGFRIEPGEIEACLTAHPQV FT RDAVVIATGEGPDKRLVAYVQAEADEQLVSTLRAQVAARLPEYMVPSAFVRLNAWPLTP FT NGKLDRRALPAPDDDALAHQAYEAPQGELETTLATIWAELLGVERVGRHDSFFALGGHS FT LLAVRLMNRVRRLGADVPLATLFATPTLAAFAAALEAHLQQGTDALPELTPVSRKGSLP FT LSFAQQRLWFLAQLDGASESYHMPLVLRVRGSLDRTAWQQALDALFARHEALRSTFVSV FT EGQPQVQLLPADMGVPLHWHDLRGMPDADAHLSRLVADEARAPFDLMRGPLMRACVVQL FT ADDNYQCVLTQHHIVSDGWSIGVLVRELSTLYAASVGAQADPLPLLAVQYPDYAAWQRQ FT WLTGERLQAQSDYWRATLADAPVLLELPTDRPRPAQQSFAGAQVPVQIDASTTQALKRL FT SAEHGTTLFMTVLAAWSAVLTRLSGQHDVVIGTPSAHRNHRQIESLIGFFVNTLALRVD FT LSGEPDIAQLLARVRRTTLDAQAHQDLPFEQVVEIVQPPRRLNHTPLFQVMLAWQSNEP FT GEWRLPGLTATPAELEYEVVKFDLELNLSEVGDEIVGSLGYATALFDRSTIERHVGYLQ FT TMLRAMVACPQQPVATLELLSPAERQLLLHTWNATQRDYPKHRCGHQLFEAQVERTPEA FT PALVYEAQTLSYAQLNAQANRLAHQLIELGVKPDARVAICVQRSPVLVVGLLAILKAGG FT AYVPLDPSYPGERLAYILADAAPNIVLADTAGRAALGEAALAERTVLDPATLSALPDTN FT PSVAGLTARHLAYVIYTSGSTGMPKGVMVEHRGVVNLALAQIACFGVQPASRMLQFASF FT SFDASASEIWMAFGSGAALYLPPEAARQDRHALWDYLASHAITHATLPPALLQHGADLP FT SFGLSLTLILAGEAPSATLVRDLADQGTVFNAYGPTETTVCATAWRGARDFSGEVPIGR FT PIANTRIYLLDAYGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVRDPFVDEPDAR FT MYKTGDLARYLPDGNLEFLGRNDEQVKIRGFRIEPEEIEACLTAHPQVRDAVVVATGEG FT SDKRLVAYVQAEADEPLASTLRAQVAASLPEYMVPSAFVRLDAFPLTPNGKLDRRALPA FT PDDEALAHQMYVAPQGELETTLAAIWAELLGVERVGRHDSFFALGGHSLLAVQLIERLR FT RRGIGLSVRALFDTPTLSALAQTLGQHRDVVVPPNAITPDTTAITPSMLPLIELTQADI FT DKIVEQVPGGVANIQDIYALSPLQDGLLFHHLLASTGDPYLLMVQLAFDSRERLDQYLH FT ALQQVIDRHDILRTAFVWEGVSMPAQVVWRHARLPVIELTLDAADGPIAEQLARRFDPR FT HTRLDLTQAPLLHCAIAQDSEGRWLLTQRLHHLIGDHSTLEVMHAEVRAFIEGRGDALP FT PAQPFRHLVAQARLGGSQAEHERFFTEQLADIEEPTLPFGLAQVQRDGREVSESHRMLP FT SALSDRLRAHARRWGVSLASLCHLAWAQVLARASGQQRVVFGTVLFGRMQAGSGADRAM FT GLFINTLPLRVDLVGSVQAAVHATHARLAALLEHEHASLALAQRCSGVPAGTPLFSAML FT NYRHNAMGSDERSGLPGVELLSAQECTNYPLTLSVEDFGQSLGLTAQSVPPLEPERVCA FT YMQQALHSLADALEATPDNAVQQLQVLPEAERELLLNTWNATQQVYPKHRCVHQLFEAQ FT VERTPEAPALVYEAQTLSYAQLNAQANRLAHQLIELGVKPDTCVAICVQRSAALVVGLL FT AILKAGGAYVPLDPSYPGERLAHILADAAPNIVLADAAGCAALGEMALAECTVLDPTTL FT PALPDTNPSIAELTARHLAYVIYTSGSTGTPKGVMVEHAQAVNFLCWAVQTFTPLETQH FT TLFATSISFDLSVYECFVPLAQGSTVHLVKDALALMHQTQPVSLINTVPSALQSLLAHR FT ANLSSATTINLAGEPLTARFIQQIFEQTPIQRLCNLYGPSESTTYSTWLSIQRGEALIE FT SIGRPIANTRVYLLDAHGQPVPLGAVGELYIGGAGVARGYLNRPKLTAERFVRDPFVGE FT PDARMYKTGDLARYLPDGNLEFLGRNDEQVKIRGFRIEPGEIEACLTAHPQVRDAVVLA FT CGEGSDKRLVAYVQAEADEPLVSTLRAQVAASLPEYMVPSAFVRLDAFPLTPNGKLDRR FT ALPAPDDEALAHQMYVAPQGELETTLAAIWAELLGVERVGRHDSFFALGGHSLLAVQLI FT ERLRRRGIGLSVRALFDTPTLSALAQTLGQHRDVAVPPNAITPDTTAITPSMLPLIELT FT QADIDKIVEQVPGGVANIQDIYALSPLQDGLLFHHLLASTGDPYLLMVQLAFDSRERLD FT QYLHALQQVIDRHDILRTAFVWEGVSMPAQVVWRHARLPVIELTLDAADGPIAEQLARR FT FDPRHTRLDLTQAPLLHCAIAQDSEGRWLLTQRLHHLISDHSTLDVMHAEVRAFIEGRG FT DTLPPAQPFRYLVAQARLGVSQAEHERFFTEQLADIEEPTLPFGLAQVQRDGREVSESH FT WMLPSALTDRLRAHARRWGVSLASLCHLAWAQVLARASGQQRVVFGTVLFGRMQAGEGA FT DRAMGLFINTLPLRVDLDGSVQAAVHATHARLAALLEHEHASLALAQRCSGVPADMPLF FT SAMLNYRHNAMDSNERIGLPGVELLSAQERTHYPIGLSVEDFGQALGLTAQSVPPLEPE FT RVCAYMQQALHSLVDALEATPDTAVQQLQVLPEAERELLLNTWNATQQVYPKHRCVHQL FT FEAQVERTPEAPALVYEAQTLSYAQLNAQANRLAHQLIELGVKPDTCVAICVQRSAVLV FT VGVLAVLKAGGAYVPLDPSYPGERLAHILADAAPNIVLADAAGRAALGEVALAECTVLD FT PTTLPALPDTNPSIAELTARHLAYVIYTSGSTGTPKGVMVEHAQAVNFLCWAVQTFTPL FT ETQHTLFATSISFDLSVYECFVPLAQGSTVHLVKDALALMHHTQPVSLINTVPSALQSL FT LAHQADLSSVVTINVAGEPLRSSLIKQAFEKTPVQRLCNLYGPSESTIYSTWLSIQRGE FT PFVESIGRPIANTRIYLLNGYGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVHDP FT FVNETHARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIEARLTQHAQVRDA FT VVLVVGEGQDKRLVAYAVAEPDDALAGTLRTHMAAALPEYMVPSAFVRLDALPLTPNGK FT LDRRALPAPDADAFAHQAYEAPQGELEITLAEIWSELLGVERISRHDSFFALGGHSLLA FT VRLMNRVAALGIALPLATLFAAPTLAGLAAALDAQRTDSAVLPVITPVSRDSALPLSFA FT QQRLWFLAQFDSASDSYHILLALRLRGTLNRIAWQQALDALFVRHEALRSVFVSVDGQP FT QVQLLPAEVRVPMAWHDLRGVPDAQAQLVRLSAEAAQAPFDLARGPLMRACGMQLADDE FT YVMLLVQHHIVSDGWSISVMVRELNTLYRAACGEPADPLPALTVQYPDYAAWQRQWLSG FT ERLQAQSEYWHTALADAPVLLALPTDRPRPAQQSFAGARVPIRIDAPTTRALKRLSQAQ FT GATLFMTVLAAWSAVLARLSGQDDLVIGTPSANRHHPQIEPLIGFFVNTLALRVDVSGA FT PSPAQLLERVRRTTLEAQAHQDLPFEQVVEIVQPPRRLEHTPLFQVMFAWQNNERAVWD FT LPELEVTPADLADGVAKFDLDLHLYEADGEVVGWLNYATALFDRATIERHVGYLQTMLQ FT SMAADDQHPVTRVQLLTSAERTLLLETWNATQQDYPSHQCIHQLFEAQVERTPQATALV FT YEEQTLSYAQLNAQANRLAHQLIELGVVPDARVAICVERSPAMVVGLLAILKAGGAYVP FT LDPAYPGARLAHILTDAAPDIVLADAAGRAALGEAALAHRTVLDPTTLPALPDTNPSIA FT ELTARHLAYVIYTSGSTGTPKGVMVEHAQAVNFLCWAVQTFTPLETQHTLFATSISFDL FT SVYECFVPLAQGSTVHLVKDALALMHQTQPVSLINTVPSALQSLLTHGANLSSATTINL FT AGEPLTARFIQQIFEQTPIQRLCNLYGPSESTTYSTWLSIQRGEAWIESIGRPIANTRV FT YLLDAHGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVRDPFVGEPDARMYKTGDL FT ARYLPDGNLEFLGRNDEQVKIRGFRIEPGEIEACLTAHPQVRDAVVVATGESSDKRLVA FT YVQAGEDEQLVSTLRAQVAARLPEYMVPSAFVRLDAFPLTPNGKLDRRALPAPDDEALA FT HQAYEAPQGELETTLAAIWAELLGVERVGRHDSFFALGGHSLLAVQLIECLRRRGLSVS FT VRALFEAPTLSALAQTLGQRRDVVVPPNAITPDTTAITPSMLPLIELTQADIDKIVEQV FT PGGVANIQDIYALSPLQDGLLFHHLLASTGDPYLLMVQLAFDSRERLDQYLHALQQVID FT RHDILRTALVWEGVSMPAQVVWRHARLPVTELTLDAADGPIAEQLARRFDPRHTRLDLM FT QAPLLHCAIAQDSEGRWLLTQRLHHLISDHSTLDVMHAEVRAFIEGRGDALPPAQPFRY FT LVAQARLGVSQAEHEHFFTELLADVEPTLPFGLAQVQRDGSEVSESHRMLPSALTDRLR FT AHARRLGVSLASLCHLAWAQVLARASGQQRVVFGTVLFGRMQAGEGADRAMGLFINMLP FT LRVDLDGSVQAAVHATHARLAALLEHEHASLALAQRCSGVPADMPLFSAMLNYRHNAMG FT SDERSGLPGVELLSAQERTHYPIGLSVDDDGQSLGLTAQSVPLLEPERVCAYMQQALQS FT LADALEATPDTAVQQLQVLPEAERQLLLNIWNETQRDYPSHLCVHQLFEAQVERTPEAP FT ALVYEDQTFSYAQLNAQANRLAHQLIELGVKPDTCVAICVQRSAALVVGLLAILKAGGA FT YVPLDPSYPGERLAHILTDAAPSIVLADAAGRAALGEAALAECTVLDPATLPALPDTNP FT SVAGLTARHLAYVIYTSGSTGTPKGVMVPHHAIARLVINNDYVDICTGDRVAFAANPAF FT DASTFEVWAPLLNGATVVVIDHDTVLMPAAFAHTLREQHISILWLTVGLFNQMAAQVDT FT AFSQLKVLIVGGDVLDARLVARVMRESPPEQLINGYGPTESTTFATTYKITSVPETNAS FT LPIGRPIANTRVYLLDAHGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVRDPFSD FT EADARLYKTGDLVRYLPDGNLEFLGRNDDQIKIRGFRIEPGEIEACLTAHPQVRDAVVL FT ATGEGSAKRLVAYVQAEADEPLASTLRAQLAARLPEYMVPSAFVRLDAFPLTPNGKLDR FT RALPAPDDAALAHQAYEAPQGELEMTLAAIWAELLGVERVGRHDSFFALGGHSLLAMRL FT INRVRTALEVDLAIRTLFETPTLAGLARHLVKRDGIQENSFSVLLPLKPTGSRPALFCI FT HPGFGLSWSYMGLSSYLHPDQPLYGLQARGLDGTSPLASTLDEMVSDYLEHMRRVQPKG FT PYCLLGWSFGGNVAHSMAVRLEHQGEKVALLALLDSTPLVGSNAFAEKENQLDQAMVRD FT VFAYHYSNELVSAMDEQLLENTEEIAKNNLCIVRDYSPSQYGGNALLFRATVAEAGCET FT LVSPDAWNPYVFGGIEVHDVHCSHGEMLKPEPTAIIGSTLACKLDKWESQQAQKVNTEE FT LK" FT CDS 47025..47327 FT /transl_table=11 FT /locus_tag="RBRH_00385" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00385" FT /db_xref="EnsemblGenomes-Tr:CBW76464" FT /db_xref="GOA:E5ATP0" FT /db_xref="InterPro:IPR002525" FT /db_xref="UniProtKB/TrEMBL:E5ATP0" FT /protein_id="CBW76464.1" FT /translation="MVRDEAYISWNRHCRERISDPLRDLASGATHGKVLKRAKRVPFFA FT NWPASRVVMEACGSTHDWARLLTRLGHHVRLIAAQFVRPFVKSNKTLWSSPFLQH" FT CDS 47455..47772 FT /transl_table=11 FT /locus_tag="RBRH_00386" FT /db_xref="EnsemblGenomes-Gn:RBRH_00386" FT /db_xref="EnsemblGenomes-Tr:CBW76465" FT /db_xref="UniProtKB/TrEMBL:E5ATP1" FT /protein_id="CBW76465.1" FT /translation="MQSKCEQERLPGWSTLFRLLPAGWEEQARTLGALKSGRRFTTQSL FT LRTLLIYLSEDCLMREAAQRVSHEELAQMSAAALGKGRSSARARASMIGCTMRIGRQDQ FT R" FT CDS 47878..47973 FT /transl_table=11 FT /locus_tag="RBRH_00387" FT /db_xref="EnsemblGenomes-Gn:RBRH_00387" FT /db_xref="EnsemblGenomes-Tr:CBW76466" FT /db_xref="UniProtKB/TrEMBL:E5ATP2" FT /protein_id="CBW76466.1" FT /translation="MAVGKRVKQRVVACAGAWVPYTTTYVYDVPP" FT CDS 48066..48563 FT /transl_table=11 FT /locus_tag="RBRH_00388" FT /db_xref="EnsemblGenomes-Gn:RBRH_00388" FT /db_xref="EnsemblGenomes-Tr:CBW76467" FT /db_xref="UniProtKB/TrEMBL:E5ATP3" FT /protein_id="CBW76467.1" FT /translation="MRTTLLIRIMRLLGYRTLFAGVAFVTLCGQACADVADGTHMASRS FT LDDALACQLRAHDFIAPLVDEGLIGPKASRVEDNSVNAFFPVRGADLRAFGFSVIAVVG FT YQKDDPLFRQGRGKPIGDSAYGVVVMGTTQRVKARAEHAGSPAIVHHVGPLVTAIFCDA FT QR" FT CDS 48612..48896 FT /transl_table=11 FT /locus_tag="RBRH_00389" FT /db_xref="EnsemblGenomes-Gn:RBRH_00389" FT /db_xref="EnsemblGenomes-Tr:CBW76468" FT /db_xref="UniProtKB/TrEMBL:E5ATP4" FT /protein_id="CBW76468.1" FT /translation="MPARRDIAAASASGMASAVNLIIRAAGARAPCCTHTALQLMDMGG FT ASLHIARAPHPCVGVAGARCCGRQHGPGFRQRVAVRNPRGTCRVLRATY" FT CDS complement(49036..50235) FT /transl_table=11 FT /locus_tag="RBRH_00390" FT /product="FldA protein" FT /function="FldA protein" FT /note="FldA protein" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: Protein of unknown function (DUF453)::PF04303" FT /db_xref="EnsemblGenomes-Gn:RBRH_00390" FT /db_xref="EnsemblGenomes-Tr:CBW76469" FT /db_xref="InterPro:IPR007400" FT /db_xref="InterPro:IPR012709" FT /db_xref="UniProtKB/TrEMBL:E5ATP5" FT /protein_id="CBW76469.1" FT /translation="MMAHSSQIKIPATYMRGGTSKGVFFRLQDLPGPAQQPGAVRDALL FT LRVVGSPDPYGKQIDGMGGATSSTSKTVILSRSERPDHDVDYLFGQVAIDRPFVDWSGN FT CGNLSAAVGPFAISHGLVDASRIPRDGIATVRIWQANIGKTIIAHVPIVNGAVQETGDF FT ELDGVTFPAAEVPLEFMDPSSDDEGGGSMFPTGNLVDELDIPGIGVLQATMINAGIPTI FT FIEAEALGYNGTELQDAINGDAGALAKLEIVRAHGALRMGLISCIDEIATRQHTPKLAF FT VARPADYVASNGKQVAASDIDLLVRAMSMGKLHHAMMGTAAVAIGAAAAVPGTLVNRAA FT GGGERHAVRFGHPSGTLRVGAEASRVNGEWIVTKALMSRSARVLMEGSVRVPADTLLLR FT " FT CDS complement(50248..51966) FT /transl_table=11 FT /locus_tag="RBRH_00391" FT /product="Aconitate hydratase (EC 4.2.1.3)" FT /function="Aconitate hydratase (EC 4.2.1.3)" FT /EC_number="4.2.1.3" FT /note="Aconitate hydratase (EC 4.2.1.3)" FT /note="COG: Aconitase A" FT /note="Pfam: Aconitase family (aconitate FT hydratase)::PF00330
Aconitase C-terminal FT domain::PF00694" FT /db_xref="EnsemblGenomes-Gn:RBRH_00391" FT /db_xref="EnsemblGenomes-Tr:CBW76470" FT /db_xref="GOA:E5ATP6" FT /db_xref="InterPro:IPR000573" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR015928" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015932" FT /db_xref="InterPro:IPR015934" FT /db_xref="InterPro:IPR015937" FT /db_xref="UniProtKB/TrEMBL:E5ATP6" FT /protein_id="CBW76470.1" FT /translation="MAPEFGATAAMFYIDEQTIQYLRLTGRSDELVALVEQYAKNTGLW FT ADTLTHVQYERVLEFDLSTVVRNIAGPSNPHKRVPTSELAARGISGKVERTPGRMPDGA FT VIIAAITSCTNTNNPRNMIAAGLLARNANRRGLTRKPWVKSSLAPGSKAVTLYLQDAQL FT LPELEQLGFGVVAYACTSCNGMSGALDPVIQKEIVERNLYATAVLSGNRNFDGRIHPYA FT KQAFLASPPLVVAYAIAGTIRFNIERDVLGLDRDGHPVTLHDIWPSDDEIDALVAASVK FT PEHFRKVYEPMFALSVDVGQQASPLYDWRERSTYIRRPPYWEGALAGERTLRGMRPLAV FT LGDNITTDHLSPSNAILADSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTL FT KNEMVLKNGEVKMGSLARVEPEGKVMRMWEAIETYMARKQPLIVIAGADYGQGSSRDWA FT AKGVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKSGVNRITLGIDGTETFDVIGERK FT PGADLTLVIHRRDGGRIDVPVTCRLDTAEEVSIYEAGGVLQRFAKDFLESAKAAA" FT CDS complement(51894..52307) FT /transl_table=11 FT /locus_tag="RBRH_04218" FT /product="Aconitate hydratase (EC 4.2.1.3)" FT /function="Aconitate hydratase (EC 4.2.1.3)" FT /EC_number="4.2.1.3" FT /note="Aconitate hydratase (EC 4.2.1.3)" FT /note="COG: Aconitase A" FT /db_xref="EnsemblGenomes-Gn:RBRH_04218" FT /db_xref="EnsemblGenomes-Tr:CBW76471" FT /db_xref="GOA:E5ATP7" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015932" FT /db_xref="InterPro:IPR015934" FT /db_xref="InterPro:IPR015937" FT /db_xref="UniProtKB/TrEMBL:E5ATP7" FT /protein_id="CBW76471.1" FT /translation="MSPVVQVNDGVAFPDTLVGTDSHTPMVDALGVIAVGVGGLEAESV FT MLGRASWMRLPDIVGVKLSGKPRAGITATDIVLALTEFLRQEKVVSAYLEFYGEGAASL FT TLGDRATSRTWRPSSAPPRPCSTSTSRRSSTCG" FT CDS complement(52470..52853) FT /transl_table=11 FT /locus_tag="RBRH_04219" FT /product="Aconitate hydratase (EC 4.2.1.3)" FT /function="Aconitate hydratase (EC 4.2.1.3)" FT /EC_number="4.2.1.3" FT /note="Aconitate hydratase (EC 4.2.1.3)" FT /note="COG: Aconitase A" FT /db_xref="EnsemblGenomes-Gn:RBRH_04219" FT /db_xref="EnsemblGenomes-Tr:CBW76472" FT /db_xref="GOA:E5ATP8" FT /db_xref="InterPro:IPR001030" FT /db_xref="InterPro:IPR015931" FT /db_xref="InterPro:IPR015934" FT /db_xref="InterPro:IPR015937" FT /db_xref="UniProtKB/TrEMBL:E5ATP8" FT /protein_id="CBW76472.1" FT /translation="MPMNTAYRKPLPGTGLDFFDARAAVDALAPGAYDGLPYTSRVLAE FT NLVRRCDPATLDASLSQLIERKRELDFPWYPARVVCHDILGQTAFVDLAGLRDAIAARG FT GDPSRVNPVVPTQLVVDHSLAVE" FT CDS complement(52844..54022) FT /transl_table=11 FT /locus_tag="RBRH_00392" FT /product="2-methylcitrate synthase (EC 2.3.3.5)" FT /function="2-methylcitrate synthase (EC 2.3.3.5)" FT /EC_number="2.3.3.5" FT /note="2-methylcitrate synthase (EC 2.3.3.5)" FT /note="COG: Citrate synthase" FT /note="Pfam: Citrate synthase::PF00285" FT /db_xref="EnsemblGenomes-Gn:RBRH_00392" FT /db_xref="EnsemblGenomes-Tr:CBW76473" FT /db_xref="GOA:E5ATP9" FT /db_xref="InterPro:IPR002020" FT /db_xref="InterPro:IPR011278" FT /db_xref="InterPro:IPR016141" FT /db_xref="InterPro:IPR016142" FT /db_xref="InterPro:IPR016143" FT /db_xref="InterPro:IPR019810" FT /db_xref="InterPro:IPR024176" FT /db_xref="UniProtKB/TrEMBL:E5ATP9" FT /protein_id="CBW76473.1" FT /translation="MSEADNNKPATGAFKPKKSVALSGVAAGNTALCTVGRTGNDLHYR FT GYDILELAGACEFEEVAYLLVHGKLPTVSELTAYKVKLKALRGLPANVKAVLESIPASA FT HPMDVMRSGVSVLGTVLPEKDDHTLPGARDIADRLMASLGSILLYWYHYSHNGKRIDVE FT TDDDSIGGHFLHLLHGKAPTRSWVDAMHVSLNLYAEHEFNASTFTSRVIAGTGSDIYSA FT ITGAIGALRGPKHGGANEVAFEIQSRYATPDEAEADIRRRIENKEVIIGFGHPVYTISD FT PRNKVIKEVARKLSKEASNTKLFDIAERLETVMWDIKKMFPNLDWFSAVSYHLMSVPTA FT MFTPLFVIARTSGWAAHIIEQRVDNKIIRPSAHYTGPENLPFVPLEKRVSCR" FT CDS complement(54046..54951) FT /transl_table=11 FT /locus_tag="RBRH_00393" FT /product="Methylisocitrate lyase (EC 4.1.3.30)" FT /function="Methylisocitrate lyase (EC 4.1.3.30)" FT /EC_number="4.1.3.30" FT /note="Methylisocitrate lyase (EC 4.1.3.30)" FT /note="COG: PEP phosphonomutase and related enzymes" FT /db_xref="EnsemblGenomes-Gn:RBRH_00393" FT /db_xref="EnsemblGenomes-Tr:CBW76474" FT /db_xref="GOA:E5ATQ0" FT /db_xref="InterPro:IPR012695" FT /db_xref="InterPro:IPR015813" FT /db_xref="InterPro:IPR018523" FT /db_xref="UniProtKB/TrEMBL:E5ATQ0" FT /protein_id="CBW76474.1" FT /translation="MNPPPPQPASAGAKFRAAVAQAQPLQVVGAITAYAAKMAEAVGFK FT AVYLSGGGVAANSLGLPDLGISTMEDVLIDARRITDATSLPLLVDIDTGWGGAFNIART FT IRSFIKAGVAAVHLEDQVGQKRCGHRPGKECVPTNEMVDRVKAAVDARTDEQFVIMART FT DAAAAEGLDAAIERALAYVEAGADMIFPEAMRTLDDYRCFKAAVKVPILANLTEFGATP FT LFTVDELREVDVDIALYCCGAYRAMNAAALNFYQTVLRDGTQKAAVPTMQTRADLYHYL FT GYHAYEQKLDALFAANNANK" FT CDS complement(54948..55067) FT /transl_table=11 FT /locus_tag="RBRH_04220" FT /db_xref="EnsemblGenomes-Gn:RBRH_04220" FT /db_xref="EnsemblGenomes-Tr:CBW76475" FT /db_xref="UniProtKB/TrEMBL:E5ATQ1" FT /protein_id="CBW76475.1" FT /translation="MKLGPQLPSRRSPKNQGVDAFIGHWLGTCLNAVVFLERQ" FT CDS 55052..57109 FT /transl_table=11 FT /locus_tag="RBRH_00395" FT /product="Sigma-54-dependent transcriptional activator" FT /function="Sigma-54-dependent transcriptional activator" FT /note="Sigma-54-dependent transcriptional activator" FT /note="COG: Transcriptional regulator containing PAS, FT AAA-type ATPase, and DNA-binding domains" FT /note="Pfam: Bacterial regulatory protein, Fis FT family::PF02954
Propionate catabolism FT activator::PF06506
Sigma-54 interaction domain::PF00158" FT /db_xref="EnsemblGenomes-Gn:RBRH_00395" FT /db_xref="EnsemblGenomes-Tr:CBW76476" FT /db_xref="GOA:E5ATQ2" FT /db_xref="InterPro:IPR000014" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR002197" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR010524" FT /db_xref="InterPro:IPR012704" FT /db_xref="InterPro:IPR025662" FT /db_xref="InterPro:IPR025944" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5ATQ2" FT /protein_id="CBW76476.1" FT /translation="MARVSILKSGVSFMRCDAHNVVSPICGITNWGKWALSIVQPDAVA FT RPRLWAMGISRLRDLFLDIAREYDGRAQLRVVSRGFEDAVHEINVAGSMRPDVVVAGGS FT NGAYLKARVNVPVVLIHPTGFDVMHALAQARRDAALVALVTHGDIPDEVRQFTHAYGVD FT VVLGSYRSVQDAQACVQDLRERGVGAVVGPGLVADLAAHAGMHAVFLYSRACVRAAFDT FT ALEVVQATRAEALRRARLDNLLQHLRDGVVALDAEGRVEAMNQRLSDALGIGATQAAGR FT TLLDLAPCLADSLPDADGDTLSVIRGVSYVVHRGPLAGPCGEQGGTVLTFQESRAVERL FT DRTLRSRPRAQQLTARYDLDDLVGECAPIERVRVLVRRYARSDATVLVLGESGTGKEMV FT AQSIHRLSARRDFAFVAINCGAFPEALLESELFGYEEGAFTGARRGGKVGLIEAAHRGT FT LFLDEIGEMSLPLQSRLLRVLQEREVVRLGSTEPVRVDIRVIAATHRALIDGIESGTFR FT ADLYYRLNILSIALPPLRERPGDVMLLAVEWLLQAARREPRLAVRVPDTNEATRILAPV FT AAPLCAYRWPGNVRELQNVIERIAVELADTEAEDDVALTVAVLRTIAPELFDTPAGPVV FT PASTLRERSRHVEADEIRAALKAHDGDRDAACQALGISKTTLWRKLNAAR" FT CDS 57333..57848 FT /transl_table=11 FT /locus_tag="RBRH_00396" FT /product="Acetyltransferase (EC 2.3.1.-)" FT /function="Acetyltransferase (EC 2.3.1.-)" FT /EC_number="2.3.1.-" FT /note="Acetyltransferase (EC 2.3.1.-)" FT /note="COG: Histone acetyltransferase HPA2 and related FT acetyltransferases" FT /note="Pfam: Acetyltransferase (GNAT) family::PF00583" FT /db_xref="EnsemblGenomes-Gn:RBRH_00396" FT /db_xref="EnsemblGenomes-Tr:CBW76477" FT /db_xref="GOA:E5ATQ3" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5ATQ3" FT /protein_id="CBW76477.1" FT /translation="MLMIRLAVPADFSVLLSIERRAGERLRGHVAFPVFAAHGLTQDEL FT ADGVRQRRLWVVEYDDRIVIGYLLGGELDGGFHIRQMDVDPAYGRRGHGRALLRHACMV FT GRAEGYRQALLTTLRDVRWNAPFYRSEGFAELPIALQGEQMRAVLTHEQALGFPMHLRV FT AMAKPLGD" FT CDS 57872..58189 FT /transl_table=11 FT /locus_tag="RBRH_00397" FT /db_xref="EnsemblGenomes-Gn:RBRH_00397" FT /db_xref="EnsemblGenomes-Tr:CBW76478" FT /db_xref="UniProtKB/TrEMBL:E5ATQ4" FT /protein_id="CBW76478.1" FT /translation="MTVTWWRAARARVRATEIATDRATTLGDASHEAIKQPWMHFQQGQ FT RDRELGMVALLGHRQVPQARAARTVASTERVAASLGTSRAIWNAICRYAYTYLSRKNSR FT V" FT CDS complement(58403..59434) FT /transl_table=11 FT /locus_tag="RBRH_00398" FT /product="SIR2 family protein" FT /function="SIR2 family protein" FT /note="SIR2 family protein" FT /note="COG: NAD-dependent protein deacetylases, SIR2 FT family" FT /note="Pfam: Sir2 family::PF02146" FT /db_xref="EnsemblGenomes-Gn:RBRH_00398" FT /db_xref="EnsemblGenomes-Tr:CBW76479" FT /db_xref="GOA:E5ATQ5" FT /db_xref="InterPro:IPR003000" FT /db_xref="InterPro:IPR026590" FT /db_xref="InterPro:IPR026591" FT /db_xref="UniProtKB/TrEMBL:E5ATQ5" FT /protein_id="CBW76479.1" FT /translation="MPKPRRIGQGAYRPVADAAHGCRQTMLLCQETKTFISEDPAESCN FT GVDPARPGHTLAEPDDVQPGLRALAGFVLAHPRLFVLTGAGISTASGIPDYRDANGERK FT GRAPIMLQAFLRSPTARRRYWARSALGWKVLAQAKPSAAHHALARLEALGHVEQLVTQN FT VDGLHRRAGQAGTIELHGNIGRAICMSCGRMHARAAIQQRLEADNPALQTLSANAAPDG FT DADLESIDFDTIRVPVCDHCQGMLKPDVVFFGEGVPRERVDTAQAALTRADAVLVVGSS FT LMVYSGYRFCVQAARAGKPIAAINLGRTRADPLLALKVTLPCDQALLSLLAALPSANLR FT KPT" FT CDS 59700..59903 FT /transl_table=11 FT /locus_tag="RBRH_00400" FT /db_xref="EnsemblGenomes-Gn:RBRH_00400" FT /db_xref="EnsemblGenomes-Tr:CBW76480" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5ATQ6" FT /protein_id="CBW76480.1" FT /translation="MCSSSSSYPTQDHVMLLLDEPLSAPDFDLRASVRSALKALHERLL FT NLTILCATHVTMTRWCCPSARC" FT CDS 59849..59944 FT /transl_table=11 FT /locus_tag="RBRH_00401" FT /db_xref="EnsemblGenomes-Gn:RBRH_00401" FT /db_xref="EnsemblGenomes-Tr:CBW76481" FT /db_xref="UniProtKB/TrEMBL:E5ATQ7" FT /protein_id="CBW76481.1" FT /translation="MRDACHDDALVLSERTLLMRADVLCNGSPAA" FT CDS 60358..61827 FT /transl_table=11 FT /locus_tag="RBRH_00402" FT /db_xref="EnsemblGenomes-Gn:RBRH_00402" FT /db_xref="EnsemblGenomes-Tr:CBW76482" FT /db_xref="UniProtKB/TrEMBL:E5ATQ8" FT /protein_id="CBW76482.1" FT /translation="MTRQTSRLLSKLGAGMVLAVTAGCGGTTSSDVGASAEHRTEGAPF FT TVSRLDASLRDERGEHDKVEERHRPDGPELDGDAMPAHAAPTALGDGNSRELSHTETTN FT LQRQDDTEKLHGWTDAAHARTCLSAPAKRPSDEYKRRSHSSRTLSLPVFHGPHPDNTNG FT NAHPDGSTILRGVSSIDIPRPAHRRSRASLTLSPTTRSSSEQSNEGLNVLPHFFHDTNF FT NPLEAFRSTPGDTVATLEERPAAPLSTRLRSWMREAHADFADCRTMPCPHRGSPQPWTT FT LFDVDARMRQHEKQEIVRRKLEEWAYAQQVVPVAPEAFDQLDQRDKLWVALRISDAEAA FT DNGDLFAWSMAAELFPCEALRQRQHRKFVSWMLQMFDLRLDLVALGERGARQDELDAFV FT RAAARDVDQQDRLEQLERALHALAVYEIVPRMRNILEPTGAPLHEVAETTFRVVEALKQ FT LAAEVVPTAVQQGAVDTDYADRFNQLLSGTI" FT CDS 62206..62469 FT /transl_table=11 FT /locus_tag="RBRH_00403" FT /db_xref="EnsemblGenomes-Gn:RBRH_00403" FT /db_xref="EnsemblGenomes-Tr:CBW76483" FT /db_xref="UniProtKB/TrEMBL:E5ATQ9" FT /protein_id="CBW76483.1" FT /translation="MRNSARPFNDGWCPGARRRTAAVQERPLHAFQHRRAVTHQRGGWL FT SEALREPLRRLVPLHERAHVEFEAATTGVRRALWDRRCARHT" FT CDS 62758..63486 FT /transl_table=11 FT /locus_tag="RBRH_00404" FT /product="Transcriptional regulatory protein" FT /function="Transcriptional regulatory protein" FT /note="Transcriptional regulatory protein" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /note="Pfam: Response regulator receiver FT domain::PF00072
Transcriptional regulatory protein, C FT terminal::PF00486" FT /db_xref="EnsemblGenomes-Gn:RBRH_00404" FT /db_xref="EnsemblGenomes-Tr:CBW76484" FT /db_xref="GOA:E5ATR0" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:E5ATR0" FT /protein_id="CBW76484.1" FT /translation="MPLSGSIMVSRILLIEDDSRLAALVASYLRKHDYDVHIVLHGNDA FT LDAILARRPDLVILDVNLPGKDGFQICREARKQFDGLIIMVTARDEDLDEVLGLELGAD FT DYVHKPVEPRVLLARIKALLRRGLQLGGETSVEPECLILGKFEINRATRSIRLPDGSVP FT DLTSAEFDLLWALVRCAGEVVSRDDLMRQLRGIGFDGVDRTVDGCISKLRRKLHDDAAN FT PQRIKTVRGRGYQFSKVAWE" FT CDS complement(63691..66030) FT /transl_table=11 FT /locus_tag="RBRH_00405" FT /product="Serine protease (EC 3.4.21.-)" FT /function="Serine protease (EC 3.4.21.-)" FT /EC_number="3.4.21.-" FT /note="Serine protease (EC 3.4.21.-)" FT /note="COG: Predicted esterase of the alpha-beta hydrolase FT superfamily" FT /note="Pfam: Patatin-like phospholipase::PF01734" FT /db_xref="EnsemblGenomes-Gn:RBRH_00405" FT /db_xref="EnsemblGenomes-Tr:CBW76485" FT /db_xref="GOA:E5ATR1" FT /db_xref="InterPro:IPR002641" FT /db_xref="InterPro:IPR010827" FT /db_xref="InterPro:IPR016035" FT /db_xref="UniProtKB/TrEMBL:E5ATR1" FT /protein_id="CBW76485.1" FT /translation="MTLSLRARLRALVMRVTIGQKDVSRRGRTGHQALAVAFAAALALH FT ASASCAGTLACATPDRAHGRATIGLVLSGGGARGYAHLGVLKVLEENRIPVDCIAGTSM FT GAVVGGLYASGMSATDMQDRLAGVNLTDIAFDVHQRAELPQSQREDEQSYANSLTLGVS FT SDGLKLPRGLVQGNRLQALLSDWTSTLAGDLSFDKLPIPYRAIATELRSGQMIVLDHGS FT LPQAIRASMAMPGLFAPTDVDGRTLVDGGLVSNLPVDTVRTMGADVVIAVDVGSPLRPL FT DALATPADVMQQMIGILIRQNVAQQRSRLVAGDVLIQPDLGSLTFTDFANAAQAIEAGE FT AAARAALPQLRHLALAPADYAAYRRAHAAPPPRPIRLTQIDIESVGAVPAARIRNYLHV FT RPGDLYDPHQLNKDLLTLSNSGDFEDVTQKLVEHGDEHRLVITARQKSWGPNFLLFGLG FT LSSSSTDEGGFRLHLGYRRPWLSPAGLEGRVDTTLGSDLISVHGELRQPLSSAFGYYVA FT PYVEYMSRYANLYSDNVRITRFHLQTKRAGIDFGLPLARLGDLRIGLAYAHGFTSPLYN FT LPLDESGTQLAFPDAYGRQLSMRARLVIDQLDDSQFPRSGYYTEIKAERSLASSEDRIT FT ELYGKAMAAVSFERHSVNVSIEGGKDIGGTNVINPLGFTLGGFRHLSAYAADQLSGTSM FT AYAQLTYMNQLASFNTGPFRGLFAGVTAEMGNVWNGFNDALDSGPMKRSVSLFTGLTSS FT FGPVYFGVALAPGGRRNVYFQFGHVY" FT CDS complement(66047..66289) FT /transl_table=11 FT /locus_tag="RBRH_04221" FT /db_xref="EnsemblGenomes-Gn:RBRH_04221" FT /db_xref="EnsemblGenomes-Tr:CBW76486" FT /db_xref="UniProtKB/TrEMBL:E5ATR2" FT /protein_id="CBW76486.1" FT /translation="MQVGGRILSQDLDHRWARRTPIEYRRSSRCSITRYHGPFANSADD FT QHDVDTQSPAHVCAGERNRALSCTHSNRATIIASF" FT CDS 66248..66838 FT /transl_table=11 FT /locus_tag="RBRH_00406" FT /product="Histidine transport system permease protein hisM" FT /function="Histidine transport system permease protein FT hisM" FT /note="Histidine transport system permease protein hisM" FT /note="COG: ABC-type arginine/histidine transport system, FT permease component" FT /db_xref="EnsemblGenomes-Gn:RBRH_00406" FT /db_xref="EnsemblGenomes-Tr:CBW76487" FT /db_xref="GOA:E5ATR3" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:E5ATR3" FT /protein_id="CBW76487.1" FT /translation="MIEILAQYPPAYLHSDGRQLFVRAVIAWLIAASLAIDFTLFGPLL FT VVHVSANRWLSIPVGVSTYGIRGIPLYVKLSLICTGVYGLAFVRSHEWLDAFFCSGYHC FT TVLAFGLNTCAYTTKIFAGAIRMTPYGKVGAARAYGMPQLTLYLRVILPSALRRALPAY FT SNEVKRMLHASTVAFTATVGCPGARRPVVRLLG" FT CDS complement(67124..67456) FT /transl_table=11 FT /locus_tag="RBRH_00407" FT /db_xref="EnsemblGenomes-Gn:RBRH_00407" FT /db_xref="EnsemblGenomes-Tr:CBW76488" FT /db_xref="UniProtKB/TrEMBL:E5ATR4" FT /protein_id="CBW76488.1" FT /translation="MSDRFSVRHCGAKPPIVADSADAKPQTDQRKATHTAKRASGNGRL FT SGLSAKPAYRSDAARCPEATRRDRAAPRAAAPRVFVNGTRTPGEPRFSFDIQDNPFWQA FT SEKDLK" FT CDS 67633..67890 FT /transl_table=11 FT /locus_tag="RBRH_04222" FT /product="N-succinylarginine dihydrolase (EC 3.5.3.23)" FT /function="N-succinylarginine dihydrolase (EC 3.5.3.23)" FT /EC_number="3.5.3.23" FT /note="N-succinylarginine dihydrolase (EC 3.5.3.23)" FT /db_xref="EnsemblGenomes-Gn:RBRH_04222" FT /db_xref="EnsemblGenomes-Tr:CBW76489" FT /db_xref="GOA:E5ATR5" FT /db_xref="InterPro:IPR007079" FT /db_xref="UniProtKB/TrEMBL:E5ATR5" FT /protein_id="CBW76489.1" FT /translation="MFLLDCNRGVAMNSIQVTRDTFNQGRAPVFSPAPYLLVLTSRGGP FT IADTLLFDLRKSMKNVGEPACPRLRVALNEREIDEMNPSL" FT CDS complement(67951..68370) FT /transl_table=11 FT /locus_tag="RBRH_00409" FT /db_xref="EnsemblGenomes-Gn:RBRH_00409" FT /db_xref="EnsemblGenomes-Tr:CBW76490" FT /db_xref="UniProtKB/TrEMBL:E5ATR6" FT /protein_id="CBW76490.1" FT /translation="MAAFDTLSVTDCDGAVSFKPCALKNALSYRHKSEIDAYGTGRRVL FT DQPRLWINNTATRRSETDARLAVRRPKCQRIEIARLPSCSTGTSPCSVSASGSDSHTGS FT ALEVMDRPEIESLRKFIERGAALHQPLRVAEIVGD" FT CDS complement(68985..70679) FT /transl_table=11 FT /locus_tag="RBRH_00410" FT /product="Transporter, MFS superfamily" FT /function="Transporter, MFS superfamily" FT /note="Transporter, MFS superfamily" FT /note="COG: Permeases of the major facilitator superfamily" FT /note="Pfam: Major Facilitator Superfamily::PF07690" FT /db_xref="EnsemblGenomes-Gn:RBRH_00410" FT /db_xref="EnsemblGenomes-Tr:CBW76491" FT /db_xref="GOA:E5ATR7" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:E5ATR7" FT /protein_id="CBW76491.1" FT /translation="MIDGDNMTSSLSTGAAEQVAAVPFLSKERIVARPGFNRWLVPPAA FT LAIHLCIGMAYGFSVFWLPLSQAIGMTHPMACGPEIGFLQELFVTHCDWKISTLGWMYT FT LFFVLLGSSAAIWGGWLERAGPRKAGVVSALCWCGGMLLSALGVHLHQFWLMLLGSGVI FT GGIGLGLGYISPVSTLIKWFPDRRGMATGMAIMGFGGGAMIGSPLATELMAAFATYEGG FT GVTQTFVAMAAMYFVFMMSGALAYRVPPPGWAPAGWKSTNDRADGAMVTQHHVHVKRVW FT GIPQFWLVWMVLCMNVSAGIGVIGMASPMLQEVFGGHLIGQAMSFSDLNKKQLTSIASL FT AAGFTALLSLFNIGGRFVWASLSDKFGRKQTYTIFFVLGMLLYASIPSSITAGYLILFV FT VAVCVIVSLYGGGFSTVPAYLADLFGTQFVGAIHGRLLTAWATAGILGPVVVNYMRDYQ FT LALGLPREQVYNQSMYILVGMLLVGLVCNLLIKPVHPKYFMSEQELAEEKRVAHPAPPM FT CELSAETPTMRASGSSALVVLAWVAVGLPLVWGIYRTMLSVVALFHG" FT CDS complement(71449..71613) FT /transl_table=11 FT /locus_tag="RBRH_00411" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00411" FT /db_xref="EnsemblGenomes-Tr:CBW76492" FT /db_xref="UniProtKB/TrEMBL:E5ATR8" FT /protein_id="CBW76492.1" FT /translation="MVEADSLRRERHLADLEQCLRERDPAIDCQRRLKKPTLLTVQSPV FT RMPPPACIR" FT CDS 71652..71822 FT /transl_table=11 FT /locus_tag="RBRH_04223" FT /db_xref="EnsemblGenomes-Gn:RBRH_04223" FT /db_xref="EnsemblGenomes-Tr:CBW76493" FT /db_xref="UniProtKB/TrEMBL:E5ATR9" FT /protein_id="CBW76493.1" FT /translation="MRQHGVQLTQKQCLDLSEDHTTLALPCEQPILRRPVFAARFDLKQ FT PLDSRMNSLVG" FT CDS complement(72070..72219) FT /transl_table=11 FT /locus_tag="RBRH_00413" FT /db_xref="EnsemblGenomes-Gn:RBRH_00413" FT /db_xref="EnsemblGenomes-Tr:CBW76494" FT /db_xref="UniProtKB/TrEMBL:E5ATS0" FT /protein_id="CBW76494.1" FT /translation="MPSENEEEMMAFRERVNTSIKEANDTLDDTLSFVAESNKHITAMT FT EGKR" FT CDS 72298..72645 FT /transl_table=11 FT /locus_tag="RBRH_00414" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00414" FT /db_xref="EnsemblGenomes-Tr:CBW76495" FT /db_xref="UniProtKB/TrEMBL:E5ATS1" FT /protein_id="CBW76495.1" FT /translation="MGRRAKIACWAKRVVFCPPTMMAQEQALETRVLASRGVRTREIDK FT QLGCSCCTVRRYLCEAEAWRYGARSASGEARFVQRLSARAHRGCSPALDCGNGMTPRDA FT KVGLCRRRDAT" FT CDS 72605..72793 FT /transl_table=11 FT /locus_tag="RBRH_00415" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00415" FT /db_xref="EnsemblGenomes-Tr:CBW76496" FT /db_xref="UniProtKB/TrEMBL:E5ATS2" FT /protein_id="CBW76496.1" FT /translation="MQKLGYADGVTQLKPFINAYRAQEPEPVVRFETALGKQMQADFTH FT LRRGRHPLLAFASRSNP" FT CDS complement(72970..73269) FT /transl_table=11 FT /locus_tag="RBRH_04224" FT /product="H-NS-like proteins" FT /function="H-NS-like proteins" FT /note="H-NS-like proteins" FT /note="COG: DNA-binding protein H-NS" FT /note="Pfam: H-NS histone family::PF00816" FT /db_xref="EnsemblGenomes-Gn:RBRH_04224" FT /db_xref="EnsemblGenomes-Tr:CBW76497" FT /db_xref="GOA:E5ATS3" FT /db_xref="InterPro:IPR001801" FT /db_xref="InterPro:IPR027444" FT /db_xref="UniProtKB/TrEMBL:E5ATS3" FT /protein_id="CBW76497.1" FT /translation="MNMATYQELRAQIEKLEAEAEALRARELETVIAQMREKITELGIT FT AEDLFGRKRQARGTAHAKQPEPKYQNPKTGETWSGRGRAPSWIGKNRERFLIQK" FT CDS 74058..74252 FT /transl_table=11 FT /locus_tag="RBRH_00416" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00416" FT /db_xref="EnsemblGenomes-Tr:CBW76498" FT /db_xref="GOA:E5ATS4" FT /db_xref="InterPro:IPR002514" FT /db_xref="InterPro:IPR009057" FT /db_xref="UniProtKB/TrEMBL:E5ATS4" FT /protein_id="CBW76498.1" FT /translation="MMVLPWQAEGHVVKKSPYTEEQIAFALKQTGLGTPVAEVCRKMGI FT SDVTFYNWRQKYGAQARRR" FT CDS complement(74634..74807) FT /transl_table=11 FT /locus_tag="RBRH_00418" FT /db_xref="EnsemblGenomes-Gn:RBRH_00418" FT /db_xref="EnsemblGenomes-Tr:CBW76499" FT /db_xref="UniProtKB/TrEMBL:E5ATS5" FT /protein_id="CBW76499.1" FT /translation="MSVLANPMMLMVTLADLIRAIACVTTLDRRMMCHWIHASEFPERA FT QRPPATSKLDPY" FT CDS 74833..75039 FT /transl_table=11 FT /locus_tag="RBRH_00420" FT /product="Transcriptional regulator, Cro/CI family" FT /function="Transcriptional regulator, Cro/CI family" FT /note="Transcriptional regulator, Cro/CI family" FT /note="Pfam: Helix-turn-helix::PF01381" FT /db_xref="EnsemblGenomes-Gn:RBRH_00420" FT /db_xref="EnsemblGenomes-Tr:CBW76500" FT /db_xref="GOA:E5ATS6" FT /db_xref="InterPro:IPR001387" FT /db_xref="InterPro:IPR010982" FT /db_xref="UniProtKB/TrEMBL:E5ATS6" FT /protein_id="CBW76500.1" FT /translation="MTQENGPRSKLARTVGQAVARQRRLRGLTQEQRSEAAGLAQASLS FT QIERGKILPGLDQLAQLAQLLNC" FT CDS 75033..75359 FT /transl_table=11 FT /locus_tag="RBRH_00421" FT /db_xref="EnsemblGenomes-Gn:RBRH_00421" FT /db_xref="EnsemblGenomes-Tr:CBW76501" FT /db_xref="UniProtKB/TrEMBL:E5ATS7" FT /protein_id="CBW76501.1" FT /translation="MLTRGLGGRRRHRRAGSRYAHAQEAIGIIAHAARGTVALMERGHC FT DGDRRPRGRSQTGSESRELTRREGAAWRRIGRAAPAWSFVEKVGRVGHAHAHADNGPVE FT PPSR" FT CDS complement(75383..76762) FT /transl_table=11 FT /locus_tag="RBRH_00422" FT /product="LYSINE 2,3-AMINOMUTASE (EC 5.4.3.2)" FT /function="LYSINE 2,3-AMINOMUTASE (EC 5.4.3.2)" FT /EC_number="5.4.3.2" FT /note="LYSINE 2,3-AMINOMUTASE (EC 5.4.3.2)" FT /note="COG: Lysine 2,3-aminomutase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00422" FT /db_xref="EnsemblGenomes-Tr:CBW76502" FT /db_xref="GOA:E5ATS8" FT /db_xref="UniProtKB/TrEMBL:E5ATS8" FT /protein_id="CBW76502.1" FT /translation="MSQKASQTKFKPYTRQSIQQAHQWATLPENLREAVKVISRVLPFR FT TNQYVLDTLINWERVPDDPIYRLTFPHSDMLPADEYATLRDLVLIKQDEAAIENEVRKI FT RMRMNPHPAGQMTHNVPILDGKRMHGLQHKYKETVLFFPSAGQTCHAYCTFCFRWPQFV FT GMEGLKFDAKASNELVAYLRRHTEVTDVLITGGDPLIMNTRSLADYIEPLLSPELAHIQ FT NIRIGTKSVAYWPQRFVTDKDADDLLWLFEKVVNAGKNLAVMGHYNHPVELRPDIAQKA FT VKRIVSSGATLRMQSPLIRHINDDAKAWAELWTTGVRLGAIPYYMFIERDTGPRQYFQL FT PLIKSYEIFQAAYQSVSGLSRTVRGPSMSAFPGKVVVDGIATIQGEKVFALQFLQARNP FT DWVRRPFYAKFDPNAMWLNDLTPAFGEKRFFFEEGISPEIIEKSSADTKPIVMLASHPL FT K" FT CDS 76976..77128 FT /transl_table=11 FT /locus_tag="RBRH_00423" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00423" FT /db_xref="EnsemblGenomes-Tr:CBW76503" FT /db_xref="GOA:E5ATS9" FT /db_xref="UniProtKB/TrEMBL:E5ATS9" FT /protein_id="CBW76503.1" FT /translation="MLADAVGRSALGEASLASRTVLDFNTLPDWADTNPLVPARVASGD FT DVTLG" FT CDS complement(77173..77598) FT /transl_table=11 FT /locus_tag="RBRH_00424" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00424" FT /db_xref="EnsemblGenomes-Tr:CBW76504" FT /db_xref="GOA:E5ATT0" FT /db_xref="InterPro:IPR001207" FT /db_xref="UniProtKB/TrEMBL:E5ATT0" FT /protein_id="CBW76504.1" FT /translation="MERAPASGCRDQDNLSGRHGRGSGSGSGARRFCAQPVGPQIPLPS FT RPCGSANGNRSYPFFAYPPQVRRIVYTTNAIESMHMQLRKIVKNRGHFSSDKAANKLLY FT LALRNIEKDWKMPPIIWRQAVNQFAILFGDRFICAIS" FT CDS complement(77643..78053) FT /transl_table=11 FT /locus_tag="RBRH_00425" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase, Mutator family::PF00872" FT /db_xref="EnsemblGenomes-Gn:RBRH_00425" FT /db_xref="EnsemblGenomes-Tr:CBW76505" FT /db_xref="GOA:E5ATT1" FT /db_xref="InterPro:IPR001207" FT /db_xref="UniProtKB/TrEMBL:E5ATT1" FT /protein_id="CBW76505.1" FT /translation="MSVREIQGHLRELYGLQVSPDLISSVTDEVLAELEQWQQRPLEAM FT YPIVYFDALRLKIRDEGTVKNKAVYLALGIGVDGRKQVLGLWIEQTEGAKFWLKVFNEL FT KNRGLHDILIAVVDGLRGFAEAIEAVYPAAHI" FT CDS complement(78195..78446) FT /transl_table=11 FT /locus_tag="RBRH_00426" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00426" FT /db_xref="EnsemblGenomes-Tr:CBW76506" FT /db_xref="UniProtKB/TrEMBL:E5ATT2" FT /protein_id="CBW76506.1" FT /translation="MTNATVTKSKNAKAPKLFPDELIDQLLAQVQSKDAESILGESGLA FT GRLKKQLAERMLAAELTHHLESEVEQGKDGNHRNGSSP" FT CDS 78557..79147 FT /transl_table=11 FT /locus_tag="RBRH_00427" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase IS116/IS110/IS902 family::PF02371" FT /db_xref="EnsemblGenomes-Gn:RBRH_00427" FT /db_xref="EnsemblGenomes-Tr:CBW76507" FT /db_xref="GOA:E5ATT3" FT /db_xref="InterPro:IPR003346" FT /db_xref="UniProtKB/TrEMBL:E5ATT3" FT /protein_id="CBW76507.1" FT /translation="MTFERLVEQNMPPSSLVQGVLDILIDSLRHIGTQINAFDQAIRRV FT AQASPVCRRLMTVPGVGSLTAVAFASAVDNPDRFSSVRDIGPYLGLTPTKYQSGNVDRN FT AGISKAGCRLTRHLLFEAASSLISRYRQDCDLRRWALTLIPRIGARKAMVATARKLATV FT LLSMWKGQTDFKVMTEWIRFDYLHCQTRTPHSG" FT CDS 79365..79505 FT /transl_table=11 FT /locus_tag="RBRH_00428" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00428" FT /db_xref="EnsemblGenomes-Tr:CBW76508" FT /db_xref="UniProtKB/TrEMBL:E5ATT4" FT /protein_id="CBW76508.1" FT /translation="MRHKRPRRNKAARLRQPKQLVTSINEIGSMDFLWSTRKPQAQTGG FT G" FT CDS 80463..99017 FT /transl_table=11 FT /locus_tag="RBRH_00429" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00429" FT /db_xref="EnsemblGenomes-Tr:CBW76509" FT /db_xref="GOA:E5ATT5" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5ATT5" FT /protein_id="CBW76509.1" FT /translation="MSVYSMPVPLSTSQTDCNATQQDCPSHLCVHQLFEAQVERTPQAV FT AVVLGEQSITYADLERRANQLAWHLRTLGVGPDVVVGLGVTRSIEMVVGVLGILKAGGA FT YLPLDPSYPHERLTYMMQQARVPVLVTQSPLQQALPRTPASCVCLDIDWAQIAVEPDTR FT PPSGVLPEHLAYVTYTSGSTGQPKGVMTRHGGAANYLNFLVRHYRVIDKEVVLNVASLA FT FDASVRDLIGPLIAGARVVLIPTAHAKEPHRYVGVLHEQRVTALLSITPSLLRSVCQAA FT EHRGVCDALRLILVSGEALDAQLVARVHQTLGAQVQVFNQYGPTECTMTSTWFAAVPDA FT QGSVPIGEPLSNVRVYVLDRQLKPLPPGVTGELYIAGAGLARGYFNQPALSAERFVANP FT FGHSERLYRTGDLGKWRVDGRLDYMGRIDDQIKLRGQRIEPGEIEACLAQHPQVRDAVV FT LARGDGEDTRLVAYVIAEADAPLASTPESGVPLASTLHAHVAARLPDYMVPAAFVRLNA FT FPLTPNGKLDRRALPAPDADALVRQVYEAPQGELEADLAAIWAELLGVERVGRHDSFFA FT LGGHSLLAVQLLNRIAGLGADVPLATLFASPTLAAFAAAVEAQGHHGTDMLLPIPPVPR FT EGALPLSFAQQRLWFLAQLDGVSRTYHMSRALRVRGPLNRAAWQQALDALFARHDALRS FT LFVSVEGQPQVQLLPAGTGVPMTWHDLRGVPDADAQLARLSDEAVYAPFDLAHGPLLRA FT CGIQLADDEHVLVLTQHHIVSDGWSMEVSVRELNALYTAACQGQPDPLQPLAVQYPDYA FT AWQRQWLSGERLQAQSEYWRTTLADAPVLLALPTDRPRPAQQSFAGAQVPVCIDASTTQ FT ALKRLSQERGTTLFMTVLAAWSAVLARLSGQDDLVIGVPSANRGHPAIESLIGFFVNTL FT ALRVDLSGEPTTTQLLERVRHTTLEAQAHQDLPFEQVVEIVQPPRRLNHTPLFQVMFAW FT QNTQPERWHLPDLAVTPTELEGNTVKFDLELELQESGDAIVGALGYASALFDRATIERH FT VGYLQTMLQAMAADAAHPVTRVELLAPAERTLLLKTWNATAQDYPAHQCIHQLFEAQVE FT RTPDATALVYEDQTLGYAQLNAQANRLAHQLIELGVKPDARVAICVERSPAMVVGLLAI FT LKAGGAYVPLDPAYPGERLAHILADATPQIVLADAAGRAALGEAALADRTVLDPNTLPD FT RADTNPFVPDLTSHHLAYVIYTSGSTGMPKGVLIRHSGVINQITALPQQLELGVQDRRL FT QFASPAFDTSVEEIFSTLTVGAALVLRTDAWLVEARKFWALCQAHRISVVGLPAQFWAQ FT LVQEEVPIADSVRAVMISGDAVSVSAWNAWFTGRGYRPRLLNSYGPTETTVSATIHEIT FT HVEGDWRTIGRPIANTRLYLLDAHKQPVPLGAVGELYIGGAGVACGYLNRPELTAERFV FT RDPFTDEPDARMYKTGDVARYLPNGNLEFLGRNDHQVKIRGFRIEPGEIEACLTQHPQV FT HDAVVLVMGEGQTKRLVAYVVAGPDEALAGTLRAHVAAALPEYMVPSAFVRLEAFPLTP FT NGKLDRRALPAPSVEAFAHQAYEAPQGELETDLAAIWAELLGVERISRHDSFFALGGHS FT LLAVRLLNRIAGLGADVPLATLFASPTLAAFAAAIDARRHHGTGTLPEIAPVSREGHLP FT LSFAQQRLWFLAQFDGVSRTYHMPIAWRVHGPLNRAAWQHALDALFARHEALRSVFVSV FT GGQPQVQLLPAETGVPMTWHDLRSVPDRQAQLAKLSEEAARAPFDLAHGPLLRACGIQL FT SDDEHMLVLTQHHIVSDGWSIEVLVRELSALYTAACRGRPDPLSPLAVQYLDYAAWQRQ FT WLSGERLQAQSEYWRMTLADAPVLLELPTDRPRPAQPSFAGARVPVCIDADTTSAIKRL FT SGEHGTTLFMTVLAAWSAVLARLSGQDDLVIGTPSANRGHPAIEPLIGFFVNTLALRVD FT LSGEPTTTQLLERVRRTTLEAQAHQELPFEQVVEIVQPPRRLNHTPLFQVIFAWQGAQT FT EHWCLPDLTVTPTELEGNTVKFDLELELHESGNEIVGALGYASALFDQTTIERHVGYLQ FT TVLQAMAADATYPVTRVDLLAPAERTLLLKTWNATQQPYPSHLCVHQLFETQAERTPEE FT TALVSEDQAVSYAELNTRANRLAHQLIELGVKPDARVAICVERSPAMVVGLLAILKAGG FT AYVPLDPAYPGERLAHILTDAAPAIVLADAAGRTALGDTALASRTVLDPNELPELADTN FT PAVPGLTARDLAYVIYTSGSTGTPKGVMVPHRGVVNLAQAQIACFGVHACSRILQFASF FT SFDASSSEMVMAFGSGASLYLPPKTIRHDRRGLWDYLARHAITHATLPPALFQHSEDLL FT SLSLPLTVILAGEAPSSTLIQALAKQGTVFNAYGPTEATVCATIWRGPRDFDGKVVPIG FT RPIANTRLYLLDAHKQPVPLGAVGELYIGGAGVARGYLNRPELTAERFMRDPFTDEPDA FT RMYRTGDVARYLPDGNLEFLGRNDHQVKIRGFRIEPGEIEACLNSHPQVHDALVLTRGD FT GDEKRLVAYVRAEPDDALANTLRAYVAARLPDYMVPGAFVRLDAWPLTPNGKLDRRALP FT APDSHALVHQVYEAPRGELETALAAIWAELLGVERVGRHDSFFALGGHSLLSVRLMNRV FT SALGVDVPLATLFASPTLAGFAAAVEAQGHHGTETLSPITPVSREGHLPLSFAQQRLWF FT LAQFDGVSRTYHMPIAWRVHGPLNRAAWQHALDALFARHEALRSVFVSVGGQPQVQLLP FT AETGVPMTWHDLRGVPDRQAQLAQLSEEAAQAPFDLAHGPLLRACGMQLADDEHMLVLT FT QHHIVSDGWSIEVLVRELSALYTAACAEQADPLPPLAVQYPDYAAWQRQWLSGERLQAQ FT SEYWRTTLADAPVLLELPTDRPRPAQQSFAGAQVPVCIDADTTSALKRLSREHGTTLFM FT TVLAAWSAVLARLSGQDDLVIGTPSANRGHPAIEPLIGFFVNTLALRVDLSGEPTTTQL FT LERVRRTTLEAQMHQDLPFEQVVEIVQPPRRLNHTPLFQVMFAWQGEQTEHWCLPELTL FT TPTELGDNPIKFDLELGLHESGNEIVGALGYASALFDQTTIERHVGYLQTVLQAMAADA FT TYPVTRVDLLAPAERTLLLKTWNATECDYPSQLCIHQLFEAQAERTPEATALVAQEQTL FT SYAELNARANRLAHQLIEWGVQPDARVAICVERSPAMVVGLLAVLKAGGTYVPLDPAYP FT PERLAHMMADSAPVVLLSVGTPPAAVTPCLGAGVPVLDLQADAAQWAHQSARNPALALT FT AQSLAYVIYTSGSTGQPKGVMIPHRSAVNLVTSMAQKLGLTAHDRVLQCSSLSFDASVG FT EIFVTLTQGAALVLRTDAWLAGAAQFWALCQANRVSVTDLPTQFWAQLAQEKVPVPDSV FT RVVMISGEALSASAQSAWFAGAGHRPRLLNVYGPTETTVTATVHEVTDAANNWRTIGRP FT IDNTRLYILDAHKQPVPLGAMGELYIGGVGVARGYLNRPELTAERFVRDPFSDEPKARM FT YRTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIEACLAQHAQVHDAVVLAMGEGS FT AKRLVAYVVAEPDDALVSTLRAHVTANLPDYMVPAALVRLDAWPLTPNGKLDRRALPAP FT SAEAFAHQAYEAPQGEWETTLAEMWAELLGVERVGRHDSFFTLGGHSLLAVRLMNRVAV FT LGIALPLATLFAAPTLAGFAAALDAQRTDSAVLPEITPVPREGHLPLSFAQQRLWFLAQ FT LDGVSDTYHIPLALRLRGTLNRVAWQRALDGLWIRHEALRSVFLSVDGQPQVQLLPAET FT GMPMTWHDLRGERDAQAQLVRLSAEAAQAPFDLARGPLIRACGVQLADDEHVMLLVQHH FT IVSDGWSIGVLVRELNALYRAACGESAEPLPALTIQYPDYAAWQRQWLSGERLQAQSEY FT WRTRLADAPVLLTLPTDRPRPAQQSFAGAYVPIRIDAQTTRALKRVSQAHGATLFMTVL FT AAWSAVLARLSGQDDLVIGTPSANRHHRQIEPLIGFFVNTLALRVDLSGEPTTTQLIER FT VRRTALEAQAHQDLPFEQVVEIVQPPRRLEHTPLFQVMFAWQNNETEAWQLPELDVTSA FT PLAYDVVKFDLELHLQEAEEEIAGSLGYATALFDRATIERHVGYVQTMLQAMAADEPHL FT VTRVELLTPAERTLLLETWNATQQEYPAHRCIHQLFEAQVERTPEATALVYEDQALSYA FT ELNARANRLAHQLTELGVQPDARVAICVQRSPAMVVGLLAILKAGGGYVPLDPTYAGER FT LAHIVQDAAPEIVLADAAGRAALGDAALADRTVLDPNRLPEQPETNPSVPVLTPRHLAY FT VIYTSGSTGMPKGVMVEHAQVVRLFEATQPWYHFDENDIWCLFHSFAFDFSVWELWGAL FT RHGGKLIIVPHQMARSPQDFHRLVCEQGVTVLNQTPSAFKAWIASQAQSPLRDQLRYVI FT FGGEALEPSILQAWYATRTEQGPQLVNMYGITETTVHVTYRPLRPEDSTQGGSPIGVRI FT PDLKLYLLDAYQQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVRDPFSAEPDARMY FT KTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIEACLAQHAQVHDSVVLAMGKGQA FT KRLVAYVVAEPDDALAGNLRTHVSAALPEYMVPSAFVRLDALPLTPNGKLDRRALPAPD FT GQAFAHQAYEAPQGEVEAALAEIWAELLGVERISRHDSFFALGGHSLLAVQLIERLRRR FT GLRLSVRALFDTPVLSALAQSLSQHREVAVPPNRITPETSALTPDLLPLIELTQAEIDR FT IVEQVPGGVANIQDIYALSPLQDGILFHHLLATEGDPYLAIAQLAFDTRARLEQYLDAV FT QQVVNRHDILRTAFVWEGLSKPAQVVWRHAPLSVTEITLEAKDGPIAEQLVQRFDPRHT FT RLDLRQAPLLRCAIAQDTDGRWLMVQLQHHLIDDVSSLKIMHAEVRAFIEGKGETLPAP FT QPFRNLIAQARLGVSQAAHERFFTEQLADIEEPTLPFGLSQVHCDGAQVREVHRMLPQA FT LNDRLRAHAKRLSVSLASLCHLTWAQVLARASGQRRVVFGTVLFGRMQAGSSADSAMGL FT FINTLPLRVDLAGSVESAVRATHARLAALLEHEHASLALAQRCSRVPAGTPLFSALLNY FT RHNALSTDEHSMLPGVEWLSAEERTNYPLMLSVEDFGHALGLTAQVVASLDPDRVCGYM FT QQALHSLAEALETMPEWPIGQLEILPNEERERLLQTWNATQQPYPSHLCVHQLFEAQVE FT RTPEATALVSEDQAVSYAELNTRANRLAHQLIELGVKPDARVAICIERSPAMVVGLLAI FT LKAGGAYVPLDPAYPGERLAHILTDAAPAIVLADAAGRTALGDAVLASRTVFDPHSVPQ FT RADTNPVVDGLMSHHLAYVIYTSGSTGKPKGVMVEHRNVVNFLTAMSSSPGITSDDRLL FT AVTSIAFDIAGLELYLPMSQGVTVVMASRDEVTDPVKLHNRIIEQRITVMQAVPSVWRA FT LLELPEPMLNLKVLCGGEALPSSLSIRLGRATGGLWNLYGPTETTIWSSALQWVGPRDT FT DGPTVPIGRPIANTQLYVLDAYGQPVPLGAVGELYIGGAGVTRGYLNRPELTTERFVRN FT PFSQEADARMYKTGDWARYLPNGNLEFLGRNDHQVKIRGFRIELGEIEACLAAHPQVRD FT AVVLARGEGVNQRLIAYVVAEKDETLTSVLHAHLAANLPDYMVPAALVRLDAFPLTPNG FT KLDRRALPASDEDALVRQVYEAPQGQFETALAAIWTELLGVECVGRHDSFFALGGHSLL FT AMHLMSRVRDVLGVELAIRNLFEAPTLRGLAQRLVEQQGSQESSFGVLLALKPQGSRPP FT LFCIHPAMGLSWSYMGLLPHLDSDQPLYGLQARGFDGTRPLASKIETMASDYLEQIRRI FT QPQGPYYLLGWSLGGMVAHSMAVQLEQQGESVALLALLDSHPSPGVLDDVPEFDEAAHY FT AALVTQYGEGLISAMDEPLRWNAWEIAKNHHRILKDFSPPIYGGNALFFHTTLVDDASP FT TLVPRDAWQPYVRGNIEIYDIHCVHRALLEPEPAAAIGRVIARKLNELADQRRESAYPV FT AQA" FT CDS complement(99766..100059) FT /transl_table=11 FT /locus_tag="RBRH_00431" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00431" FT /db_xref="EnsemblGenomes-Tr:CBW76510" FT /db_xref="GOA:E5ATT6" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/TrEMBL:E5ATT6" FT /protein_id="CBW76510.1" FT /translation="MCSDRSGTTGGQNIDAASKSALLLRVRSRRGNCLDNAAIESFSDT FT LKSAFYYLNALRDVQELQTGIDSYIRHYNYDRIKVPLRGLSPLEYRPRFAKA" FT CDS complement(100550..100957) FT /transl_table=11 FT /locus_tag="RBRH_00432" FT /db_xref="EnsemblGenomes-Gn:RBRH_00432" FT /db_xref="EnsemblGenomes-Tr:CBW76511" FT /db_xref="UniProtKB/TrEMBL:E5ATT7" FT /protein_id="CBW76511.1" FT /translation="MPPITWQAGYLEEQIMRLTTHPLRHENHFELRHATIPTYIASYLF FT PAVLLLYEVWRVGSWIYVHGMNFANFNSMGYEYTVMLAWFGLQVATEIVFLIGAALSRH FT RDFGHRIANLLCGVFCSAVVLLFDFGLQHWI" FT CDS complement(101228..101602) FT /transl_table=11 FT /locus_tag="RBRH_00433" FT /product="Glycosyltransferase (EC 2.4.1.-)" FT /function="Glycosyltransferase (EC 2.4.1.-)" FT /EC_number="2.4.1.-" FT /note="Glycosyltransferase (EC 2.4.1.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00433" FT /db_xref="EnsemblGenomes-Tr:CBW76512" FT /db_xref="GOA:E5ATT8" FT /db_xref="InterPro:IPR001296" FT /db_xref="UniProtKB/TrEMBL:E5ATT8" FT /protein_id="CBW76512.1" FT /translation="MRETAHAVVLPSICAENAPLSIVEAAMLGLPALVHDIGSLSTFGD FT EIRNKFKYHCDMVSYRATLDALIRHLGQPNRRYDVAEYHPQRYAQRLATVLRLKRSNEQ FT PETTHTGSLVAADGDAFPVV" FT CDS 101566..101766 FT /transl_table=11 FT /locus_tag="RBRH_00434" FT /db_xref="EnsemblGenomes-Gn:RBRH_00434" FT /db_xref="EnsemblGenomes-Tr:CBW76513" FT /db_xref="UniProtKB/TrEMBL:E5ATT9" FT /protein_id="CBW76513.1" FT /translation="MTATPRHARSRAIRPGAREGHACRGIRAFRHQLNRHCGARARHAL FT ARRRKSSAYSDRRIAWRVPAR" FT CDS complement(101773..102222) FT /transl_table=11 FT /locus_tag="RBRH_00435" FT /product="Glycosyltransferase (EC 2.4.1.-)" FT /function="Glycosyltransferase (EC 2.4.1.-)" FT /EC_number="2.4.1.-" FT /note="Glycosyltransferase (EC 2.4.1.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00435" FT /db_xref="EnsemblGenomes-Tr:CBW76514" FT /db_xref="GOA:E5ATU1" FT /db_xref="UniProtKB/TrEMBL:E5ATU1" FT /protein_id="CBW76514.1" FT /translation="MHAGPAGQPFDVPPRAGDLLLAFDVVAAGRDRMKTRMGLKVNPRA FT VGRGPAGLTRPALTTCASPKGAVHDALKKLYWHSTRLLCHPARAFNLLLCPSQYMEQAL FT HRVGITNTSLLPNPIDADMPVCAPKPIHASRINLAFAGRIAAEKG" FT CDS 102199..102471 FT /transl_table=11 FT /locus_tag="RBRH_00436" FT /db_xref="EnsemblGenomes-Gn:RBRH_00436" FT /db_xref="EnsemblGenomes-Tr:CBW76515" FT /db_xref="GOA:E5ATU0" FT /db_xref="InterPro:IPR011330" FT /db_xref="UniProtKB/TrEMBL:E5ATU0" FT /protein_id="CBW76515.1" FT /translation="MTGRPCVHFAYPNGNYGEREIRLLRAAGYRTARTCDVGWNDDATD FT PFRLRAIDIHDDSSLAWFIAKLRGIPLLLRYAWHGGGWRGRKLQF" FT CDS 102613..102855 FT /transl_table=11 FT /locus_tag="RBRH_00437" FT /product="H-NS-like proteins" FT /function="H-NS-like proteins" FT /note="H-NS-like proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_00437" FT /db_xref="EnsemblGenomes-Tr:CBW76516" FT /db_xref="GOA:E5ATU2" FT /db_xref="InterPro:IPR001801" FT /db_xref="InterPro:IPR027444" FT /db_xref="UniProtKB/TrEMBL:E5ATU2" FT /protein_id="CBW76516.1" FT /translation="MDEQKRQRIIAYIHHRMDEYGISIEHLAKVLAEEEKKIKPILFRD FT AYGNVWDGEGDMPDWLKRAVHAGQSTEHFMVEPEQ" FT CDS 102852..103733 FT /transl_table=11 FT /locus_tag="RBRH_00438" FT /product="Hydrolase (EC 3.-.-.-)" FT /function="Hydrolase (EC 3.-.-.-)" FT /EC_number="3.-.-.-" FT /note="Hydrolase (EC 3.-.-.-)" FT /note="COG: Predicted hydrolases or acyltransferases FT (alpha/beta hydrolase superfamily)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00438" FT /db_xref="EnsemblGenomes-Tr:CBW76517" FT /db_xref="GOA:E5ATU3" FT /db_xref="UniProtKB/TrEMBL:E5ATU3" FT /protein_id="CBW76517.1" FT /translation="MTGTSLMPRAMPHAQTITLADGASVAFAQAGSGEPIVLVHGSLCD FT YRYWEPQFAPLASTHRVLSLSLGHYFPTRELNCALPFSWSAHVQQIAAFIDEVVREPAH FT VVAHSRGAYLAFHLARRFPDRLRSVTLADPGGAVQGSDAPGVQAAGKDNPLRARAVALI FT EQGEVDAGLALFVDSVSRPGSWMQSPYGFKTMARDNAHTLRPQMAERMPAFAAHEAGAI FT TVPVLLVGGEKSPSIFHRNIEWLHQRIDGARQMTITGASHGMNLAHPRAFNRAVLDFVN FT AQGRTRSSGNGM" FT CDS 103772..104575 FT /transl_table=11 FT /locus_tag="RBRH_00439" FT /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase FT (EC 4.1.2.-)" FT /function="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase FT (EC 4.1.2.-)" FT /EC_number="4.1.2.-" FT /note="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC FT 4.1.2.-)" FT /note="COG: 2,4-dihydroxyhept-2-ene-1,7-dioic acid FT aldolase" FT /note="Pfam: HpcH/HpaI aldolase/citrate lyase FT family::PF03328" FT /db_xref="EnsemblGenomes-Gn:RBRH_00439" FT /db_xref="EnsemblGenomes-Tr:CBW76518" FT /db_xref="GOA:E5ATU4" FT /db_xref="InterPro:IPR005000" FT /db_xref="InterPro:IPR012689" FT /db_xref="InterPro:IPR015813" FT /db_xref="UniProtKB/TrEMBL:E5ATU4" FT /protein_id="CBW76518.1" FT /translation="MKLPVNPFKRALAEGRVQIGLWVGLAHAYAAEVVAGAGFDWLLLD FT GEHAPNTVPSILGQLQAVAPYASHPIVRAACNDTVLIKQILDIGAQTVLLPMVQNAQQA FT RRAVAATRYPPRGVRGVGSALARASRWNRVTDYLKHADDELCVLVQVETAQGLRHLNDI FT AAVEGVDGVFIGPADLCADLGHLGEPGHPQVRAAIEAAIQQIRAAGKAPGILMSDEALA FT RRYIELGAQFVAVGVDTTLLARSADALAARFKHALPEPGAHGGVY" FT CDS complement(104619..104825) FT /transl_table=11 FT /locus_tag="RBRH_00440" FT /db_xref="EnsemblGenomes-Gn:RBRH_00440" FT /db_xref="EnsemblGenomes-Tr:CBW76519" FT /db_xref="UniProtKB/TrEMBL:E5ATU6" FT /protein_id="CBW76519.1" FT /translation="MTGKSGYKLTVAGQAQARGFVPKIDIDELDIARHAGKHTFALSMT FT MTPGVFERVGDSLAVALVGSPIR" FT CDS 104712..104984 FT /transl_table=11 FT /locus_tag="RBRH_00441" FT /db_xref="EnsemblGenomes-Gn:RBRH_00441" FT /db_xref="EnsemblGenomes-Tr:CBW76520" FT /db_xref="UniProtKB/TrEMBL:E5ATU5" FT /protein_id="CBW76520.1" FT /translation="MLAGVSRDVEFVNVDFRHEAASLRLACDSELVAALAGHARVVVRS FT AIDVRVAPILAAVRFAGRLLPVPAVRNGGPVARGNSFAPTQQSAA" FT CDS 105044..105385 FT /transl_table=11 FT /locus_tag="RBRH_00442" FT /db_xref="EnsemblGenomes-Gn:RBRH_00442" FT /db_xref="EnsemblGenomes-Tr:CBW76521" FT /db_xref="UniProtKB/TrEMBL:E5ATU7" FT /protein_id="CBW76521.1" FT /translation="MTKPFVLMFFAVALSGCMLMQYNPDAGEPEKVASTGRSTQDVIAC FT MTDVARRHHASFRTSPIPQGQMLDFGDSNIVKIRTDDDGSTSFRFYPGKRHPGNLWIEG FT AARQCADIP" FT CDS 105467..106294 FT /transl_table=11 FT /locus_tag="RBRH_00443" FT /product="N-hydroxyarylamine O-acetyltransferase (EC FT 2.3.1.118)" FT /function="N-hydroxyarylamine O-acetyltransferase (EC FT 2.3.1.118)" FT /EC_number="2.3.1.118" FT /note="N-hydroxyarylamine O-acetyltransferase (EC FT 2.3.1.118)" FT /note="COG: Arylamine N-acetyltransferase" FT /note="Pfam: N-acetyltransferase::PF00797" FT /db_xref="EnsemblGenomes-Gn:RBRH_00443" FT /db_xref="EnsemblGenomes-Tr:CBW76522" FT /db_xref="GOA:E5ATU8" FT /db_xref="InterPro:IPR001447" FT /db_xref="UniProtKB/TrEMBL:E5ATU8" FT /protein_id="CBW76522.1" FT /translation="MMAERVDLAAYFERIGYAGAAQPTLQVLSVLHALHPRAIPFENLD FT PLRGERVWLDLDRIQQKLVTGGRGGYCFEHNTLFAAVLTELGFDVTPMLARVLWMRDGV FT DVTAKSHMLLHIALPEGPFIADVGFGAITLTAPLRLDAGVVQPTPFEPARLIGQPALQQ FT GYDLEVALGSRWQKVYWFEPRPTYRIDHEMANWYTCAHPDSHFVRELNVCRIVGDVRAV FT LRNDRLTLRLRDGSDQRRRLASAAELAECLAGTFGINIDGMDIDALFEKVREP" FT CDS complement(106526..106960) FT /transl_table=11 FT /locus_tag="RBRH_00444" FT /product="Tnp" FT /function="Tnp" FT /note="Tnp" FT /db_xref="EnsemblGenomes-Gn:RBRH_00444" FT /db_xref="EnsemblGenomes-Tr:CBW76523" FT /db_xref="GOA:E5ATU9" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR014737" FT /db_xref="UniProtKB/TrEMBL:E5ATU9" FT /protein_id="CBW76523.1" FT /translation="MLKSGCRVEARQFGNLDRFVRATALFAVISWRILYATLLARLDGH FT LSCEVLLQPIEWRALYCRVHSTTKLPNEPPSLAQVMRWIAKLGGYLARKHDRPPPGQLL FT YGVAFSSCTKSPRCIASSGKTSDPYLWVNLRSFMEGIKLD" FT CDS complement(106997..107302) FT /transl_table=11 FT /locus_tag="RBRH_00445" FT /product="Tnp" FT /function="Tnp" FT /note="Tnp" FT /db_xref="EnsemblGenomes-Gn:RBRH_00445" FT /db_xref="EnsemblGenomes-Tr:CBW76524" FT /db_xref="GOA:E5ATV0" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR014736" FT /db_xref="UniProtKB/TrEMBL:E5ATV0" FT /protein_id="CBW76524.1" FT /translation="MDHPQKYLREAMATAPLVGQTELQIPGSGRTMARTARLTLRCAQV FT RLRPPRYRRCKSVSNVEVFVIHALEAAVPEGREPLEWMLLTSVPTHTHEQALERLA" FT CDS complement(107492..108421) FT /transl_table=11 FT /locus_tag="RBRH_00446" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Integrase core domain::PF00665" FT /db_xref="EnsemblGenomes-Gn:RBRH_00446" FT /db_xref="EnsemblGenomes-Tr:CBW76525" FT /db_xref="GOA:E5ATV1" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR025948" FT /db_xref="UniProtKB/TrEMBL:E5ATV1" FT /protein_id="CBW76525.1" FT /translation="MLSPYGERLSKKAEGLGSSERAVSTRERTQIVLELRQQYPLAGLL FT KVAGLARSTFYYQQKALQMADKYADLKVKVRTLFDQHTGQYGYRRITAVIRRDGQLINH FT KIVRRLMAQLQLRSCVRVKMYRVYRGQLGHVAPNVLERRFEASRPNEKWVTDVTEFNVG FT GQKLYLSPIMDLYNGEILSYKMAKRPLFNMVSAMLEKAFNRLRPGDKPVLHSDQGWQYR FT MPEYRRRLEERAITQSMSRRGNCLDNAAIESFFGTLKSEFYYLNEFRNVEELQTGIDNY FT IRYYNHDRIKVKLRGLSPVEYRTRFAQA" FT CDS complement(108316..108939) FT /transl_table=11 FT /locus_tag="RBRH_00447" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00447" FT /db_xref="EnsemblGenomes-Tr:CBW76526" FT /db_xref="GOA:E5ATV2" FT /db_xref="InterPro:IPR009057" FT /db_xref="UniProtKB/TrEMBL:E5ATV2" FT /protein_id="CBW76526.1" FT /translation="MHRQQQAQRVHSHMNRTPKVGHQLEGFVGKYTEQAKLVAVRDYCS FT GEAGLKTIAQRHNVDVPSLRQWIAGYRAHGEAGVAEKKREFYSVELKLSVLKRMREEGL FT SHRQAAALFNIRRFNIIGRWEQQYNQGGLEALSWGSRGRRRKMTKNAPLQNKAQQADDA FT RSHQELLDELCYLRMENAYLKKLKALAQASELSARERERKSCLS" FT CDS 108871..109155 FT /transl_table=11 FT /locus_tag="RBRH_04225" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_04225" FT /db_xref="EnsemblGenomes-Tr:CBW76527" FT /db_xref="GOA:E5ATV4" FT /db_xref="InterPro:IPR002559" FT /db_xref="UniProtKB/TrEMBL:E5ATV4" FT /protein_id="CBW76527.1" FT /translation="MMSNLRRSVHMAVDTLGLLLAVHITPANAQERTQLAELACQVQHV FT TAQTVKLALADQGHTGDRLRRPLAMKVCNCRSSNCLRQRKVSRCCPAAG" FT CDS 109086..109301 FT /transl_table=11 FT /locus_tag="RBRH_04226" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_04226" FT /db_xref="EnsemblGenomes-Tr:CBW76528" FT /db_xref="UniProtKB/TrEMBL:E5ATV3" FT /protein_id="CBW76528.1" FT /translation="MQLQVIKLPEAKEGFALLPRRRVVEHSFAWLNRFRRLARDYERSP FT ETLAGLHFVVFVMLMLVHAVPIMKSA" FT CDS 110009..111040 FT /transl_table=11 FT /locus_tag="RBRH_00449" FT /product="CARBAMOYL TRANSFERASE" FT /function="CARBAMOYL TRANSFERASE" FT /note="CARBAMOYL TRANSFERASE" FT /note="COG: Predicted carbamoyl transferase, NodU family" FT /note="Pfam: Carbamoyltransferase::PF02543" FT /db_xref="EnsemblGenomes-Gn:RBRH_00449" FT /db_xref="EnsemblGenomes-Tr:CBW76529" FT /db_xref="GOA:E5ATV5" FT /db_xref="InterPro:IPR003696" FT /db_xref="UniProtKB/TrEMBL:E5ATV5" FT /protein_id="CBW76529.1" FT /translation="MKILGINSEVGRYTIDPDVAHFRLPDFEQIEALFGPARVDKEPIL FT DHHRHVAAALQEATDHALMGLVRELRERTAADKLCYAGGVALNCVSNSVIKESGLFSQM FT YVPTAPHDAGTAVGAALHLYYSLSGQRPSQADNNPYLGPAFSDAAIDAAFRDAGLSPQH FT STDPARDAATLIAEGKIVAWFQGRMEFGPRALGNRSLLADPRSASMREVLNVKVKHREE FT FRPLAPSVLAEEAANWFELGQASMSHQTMLFACPAKQDRQASIPAVLHKDHSARVQMVS FT RESNPKFHALIQHFSEITGVPVVLNTSFNDREPIVCTPSDAIKTFQGTAIDALFIGDRF FT VVR" FT CDS 111092..112054 FT /transl_table=11 FT /locus_tag="RBRH_00450" FT /note="COG: Methylase of polypeptide chain release factors" FT /db_xref="EnsemblGenomes-Gn:RBRH_00450" FT /db_xref="EnsemblGenomes-Tr:CBW76530" FT /db_xref="UniProtKB/TrEMBL:E5ATV6" FT /protein_id="CBW76530.1" FT /translation="MRHTNEEKCIFFITKNQDQATNHHQITDCLPITQWRAMHHHGLNG FT QNETNHALSSPYPIKIVTDAFHYPHADQVLPIQPEQLFFMDYTCAEDIEQASVLDIGVG FT SGVLSIFCLLNGAKSCVGLDVNPRAKILAGHNAILNHIDKNFDIREGNTSDIFASVKDK FT QFDFICSNPPFEPTPPGIEYYVNSAADIYGMDFVEKILSNIDQHLTDDGTLQLVTMAPG FT DAKKPFKLYEVLENYLPGLAVEVILDRQPISYADFVNRFNTIFGYGEDVIAQMKKTARD FT DGVTHLHMLILKYKKGQRGSITEKVAGKTYEDWTTPLGV" FT CDS 112274..112819 FT /transl_table=11 FT /locus_tag="RBRH_00451" FT /product="Bacillibactin non-ribosomal peptide synthetase FT module 1 and 2 (EC 6.3.2.-)" FT /function="Bacillibactin non-ribosomal peptide synthetase FT module 1 and 2 (EC 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Bacillibactin non-ribosomal peptide synthetase FT module 1 and 2 (EC 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_00451" FT /db_xref="EnsemblGenomes-Tr:CBW76531" FT /db_xref="GOA:E5ATV7" FT /db_xref="InterPro:IPR001242" FT /db_xref="UniProtKB/TrEMBL:E5ATV7" FT /protein_id="CBW76531.1" FT /translation="MMPAYAAPLTHPLSTAQTEIWLAQQLHEDSPVYNIAQYTVIHGGF FT DLALFKVALRQVVAEVDSLHLHFVESEEGLRQYIGSPAWSLSVVDFRAEAEPQAAAEAW FT MRADYEQPVNILQGPTFSLRITKNHLGEGAMVPTISPYHNGWVWLFLDRTTRRTRVIAR FT YVKVLSQSRALLGLYSNC" FT CDS 112813..114246 FT /transl_table=11 FT /locus_tag="RBRH_04227" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_04227" FT /db_xref="EnsemblGenomes-Tr:CBW76532" FT /db_xref="GOA:E5ATV8" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR020459" FT /db_xref="InterPro:IPR020845" FT /db_xref="UniProtKB/TrEMBL:E5ATV8" FT /protein_id="CBW76532.1" FT /translation="MLKSDAQYRACEQWTRDEAYWSERYTDWTEPATLASRSTPAVQHR FT LRQTAYLPCKSIGSGATNPRCLSHFILAALAAYLCRLTGEQNVVLGFVVKARFGVDQHV FT PGMASNILPIQLTVKPDMDLSSVIQQAARGIQCGLQYQRYRSETLRRKLKLAPGQPLFS FT TIVNVMPFDYDLSFGGHASESHNLLLGPADDLMVAVHTLENNHMLRIDFDANPACYTTD FT EVIAHQRCFVNLLKTLATSPAQLINSIDLLDAVERQRLLVEWNATECDYPAHLCIHQLF FT EAQVTRTPGAIALVFEEQTLSYAELNTRANRLAHQLIELGVKPDARVAICAERSPAMVV FT GLLAILKAGGAYVPLDPAYPSERLTHILADTAPAIALADTAGQSALGDTVLASLTVLDP FT NILPERAATNPQVPELTAHHLAYVIYTSGSTGTPKGVMVEHAQIVHLFDVAKLDDAQKK FT NQASTNHPVWMQQALWTNT" FT CDS 114311..122632 FT /transl_table=11 FT /locus_tag="RBRH_00452" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00452" FT /db_xref="EnsemblGenomes-Tr:CBW76533" FT /db_xref="GOA:E5ATV9" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5ATV9" FT /protein_id="CBW76533.1" FT /translation="MLNGATLVVAAPGVHRDPSALIELMIRQRITTVHFVPSMLSLFLS FT TDGVQRCTAVRRLLCTGEALTSTHVRRCQSLLPHAQLHNLYGPTEATIGVAAWTCPAEY FT SEENIPIGRPIANNRLYLLDKHGQPVPLGATGELYISGASVVRGYMNCPGLTAERFLLD FT PFSDREGARMYKTGDLARYRADGNLEFLGRNDHQIKIRGLRIELGEIKTCLVRHPLVRE FT AAVLALGEGMDKRLVAYVVAKPDHRLAHVLRAYLTARLPEYMVPAAFVRLDALPLTPNG FT KLDRRALPEPDADALALHAYEVPQGELETMLATIWAELLGVERVGRHDSFFALGGHSLL FT AVRLMNRVRTLGADVPLASLFASPTLAAFAAVMSAQLHQSSHVLPEITPLSREGRLPLS FT FAQQRLWFLAQLDGVSYTYHIPIALRLRGPLDQTAWQQALNALFARHEALRSTFVSVDG FT QPQVQLLAPDVGLPLLWHDWRGVPDAETRLARLSADEAQTRFDLAHGPLIRAQMVQLAD FT DEHRFLLTQHHIVSDGWSFGVLVRELSALYAAYCAGEADPLPPLSIQYPDYAAWQRQWL FT SDERLQHQSDYWRRVLAEAPVLLELPTDRHRPAQQSFAGAHVPVCIDAETTHALKCMSH FT RHGTTLFMTVLAAWGAVLSRLSGQNDVVIGTPSANRNHPQIEPLIGFFVNTLALRMDLS FT GEPDITELLTRARQCTLQAQVHQDLPFEQVVEIVQPPRRLNHTPLFQVMFAWQQNAIAA FT WKLPGLQVLPVEPSCDVVKFDLELSLQETSDAIIGQLEYSTALFDRSTIERHVGYLQTM FT LYAMVADARQSVARIELLAPEENKLVLQSWNATQRDYPAHLCIHQLFEAQAAHAPDATA FT LIYDKKTVNYAELNAQANRLARQLIERGVQSDARVAICVERSIAMVVGLLAILKAGGAY FT VPLDPTYPAERLAYILADSAPTIVLADAVGYAALGDTALASCTVLDPNVLPALPDTNPQ FT VPGLTARHLAYVIYTSGSTGTPKGVMVEHRSVVNLVTAAAQTLELTVQDRMLQFSSLSF FT DTSVGEIFTFLTHGATVVLSTKAWLTEGQQFWKLCKANRLSVVDLPVQFWAQLVQEKAS FT VADSVRAILIGGDALSASAHNAWFSCSGYRPRLLNAYGPTETTIAATIHEVTDEDGSWR FT AIGRPLANTRLYILNAHSQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVPDPFSAA FT PDARMYKTGDLARYLPNGNLEYLGRNDQQVKIRGFRIEPSEIEARLTEHPQVRDAVVLA FT RGEGNEKRLIAYVVAKPDENLVSALRAHVAACLPEYMVPTAFVRLDAFPLTPNGKLDRR FT ALPMPNEDAFAHQAYEAPQGKVETALAAIWAELLGVERVSRHDSFFALGGHSLLAVQLI FT ERLRRRGLGLSVRALFDTPTLSALAQSVGQQRDVMVPPNVITPDTIALTPEMLPLIKLT FT QSDIDRIVEQVPKGVANIQDIYALSPLQDGILFHHLLASDGDPYLLIVQLAFDSRALLD FT RYLHAVQQVIHRHDILRTAFVWQGLTIPAQVVWRYAPLSVTELTLDPVNGPIAEQLARR FT FDPRQHRLDLTQAPLLHCAVAQNTDGRWLLVQQQHHLVGDHSTLEVMHTEIQAFIEGQG FT RALPEAQPFRNLVAQAKLGVSEDEHAKFFTEMLADVEEPTLPFGLANVHRDGAPPSEAY FT RMLPQTLNDRLRALAKRLKVSLASLCHLAWAQVLARASGQPRVVFGTVLFGRMQGGSGA FT DSAMGLFINTLPLRVELPRSVQDSVRETHTRLAALLEHEHASLALAQRYSGVPAGTPLF FT SALLNYRHHATPSDAPNLPSGIELLGAQERTNYPLSLSIEDDGQTLGLTAQVAQPLDPE FT RVCGYMQQTLASLAKALEQEPDTPVQQLEVLPEIERQLLLETWNATQQTYPAHLCVHQL FT FEAQAERTPEATALVYEDQTLSYAELNARANRWAHELIELGVKPDARVAICLERSPAMV FT VGLLAILKAGGAYVPLDPTYAGERLVHIVQDAAPDIVLADAAGRAALGDAALADRTVLD FT PNRLPDRAETNPSVPSLTPRHLAYVIYTSGSTGMPKGVMVEHAQVVRLFEATQPWYHFD FT ENDTWCLFHSFAFDFSVWEIWGALRHGGKLIIVPYQMARSPQDFHRLVCEQGVTVLNQT FT PSAFKAWIASQAQSPLRDQLRYVIFGGEALEPSILQAWYATRAEQSPQLVNMYGITEAT FT VHVTYRPLRPEDSTQGGSPIGVRIPDLKLYLLDAYQQPVPLGAVGELYIGGAGVARGYL FT NRPELTAERFVSDPFSAEPDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGE FT IEACLARHVQVHDAVVLARGEGQAKRLVAYVVAEPDDALAGNLRTHVSAALPEYMVPSA FT FIRLDALPLTPNGKLDRRALPAPDAEAFAHQAYEAPQGELEATLAKIWAELLGVEKISR FT HDSFFALGGHSLLAVQMISRSCTTLGISIPMPVLFEAPTLAALVQRVSAQDNVQDKSFA FT VVLPIQPRGVRPPLFCVHPVTGLSWHYRGLANHLEADQPLYGLQARGLDGVSSPAFTIE FT AMAMDYIQQIRRIQPHGPYCLLGWSFGGKVVHSMATQLEQQGERVALLAVLDATPDHVQ FT QDNEPEITEDDFYHLFVRHAVGSLSEAGHYLWEKTRAVLQNNVQLVQCFSPRIYSGDML FT FFRATMAQDALTQPISPKVWQPYVMGNIEVHDIACQHYDMALPVPTAQIGRILRQKLNA FT LHGDQEIDNKKTLI" FT CDS complement(122875..122976) FT /transl_table=11 FT /locus_tag="RBRH_00453" FT /db_xref="EnsemblGenomes-Gn:RBRH_00453" FT /db_xref="EnsemblGenomes-Tr:CBW76534" FT /db_xref="UniProtKB/TrEMBL:E5ATW0" FT /protein_id="CBW76534.1" FT /translation="MRPDIIMYTLPMRTTMQKSSHIALSHIQYEING" FT CDS complement(123331..124524) FT /transl_table=11 FT /locus_tag="RBRH_00454" FT /note="COG: Lipopolysaccharide biosynthesis proteins, FT LPS:glycosyltransferases" FT /db_xref="EnsemblGenomes-Gn:RBRH_00454" FT /db_xref="EnsemblGenomes-Tr:CBW76535" FT /db_xref="GOA:E5ATW1" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR017853" FT /db_xref="InterPro:IPR024655" FT /db_xref="UniProtKB/TrEMBL:E5ATW1" FT /protein_id="CBW76535.1" FT /translation="MSDARTEGHRMTRYSYLFAGIAIVTLTGAALQTAFSDQTDGDVAS FT HLPVLKAGDVIVAAIPSAVASAAVKSGRSTDTPAPTVPPTIPCGNGTKGVFYGISGHVG FT QGGVYDKMSYEQQLRHIKELGMTMYGHDVFDYASTQKVLRIAKQAKKQCIGVFAALTAD FT LNSYANEDAAYRDGLKLGMMVATTLKGVVQYYQVGNEYENVSIRRGQGSHPDDYDNASF FT QKARGSILGMIDGIKRANPSATIVMCPLGWLHFGFLDMLYTGTQPDGSRGHRIPKWDIT FT AWHWYSDMGDITAARGVNVLRRLHETYREPIWITELGVRPGASEQASAAYLVGPNALGG FT LIQYAKQYNIQNVTLYELLDDEAYGGDGNYGLLGGDGIVRKHRYDVIKRFIATHAMP" FT CDS complement(124577..125350) FT /transl_table=11 FT /locus_tag="RBRH_00455" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: DNA replication protein" FT /note="Pfam: IstB-like ATP binding protein::PF01695" FT /db_xref="EnsemblGenomes-Gn:RBRH_00455" FT /db_xref="EnsemblGenomes-Tr:CBW76536" FT /db_xref="GOA:E5ATW2" FT /db_xref="InterPro:IPR002611" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR028350" FT /db_xref="UniProtKB/TrEMBL:E5ATW2" FT /protein_id="CBW76536.1" FT /translation="MHNAREELLVSLRALNLGAMAAAVQDTALRAAKEGLTHEAFLLEL FT ARIERAAKASRRIERLLRQSELLPGKNLRTLKLERFDPATRLQIERLRSGSFLKDATNV FT IALGRPGAGKSHLACALGHALVEQGYPVLFTSTGALVQRLLAAKRDLRLPQQLAKLDRF FT ECLILDDIGYVQHNRDEMEVLFTLLAERYERKSIVITTNLVFSEWERIFKDPMTTLAAI FT DRVVHHSVILDLMSVESYRAEAAGAKPTAPAPVAS" FT CDS complement(125343..126827) FT /transl_table=11 FT /locus_tag="RBRH_00456" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: DNA replication protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00456" FT /db_xref="EnsemblGenomes-Tr:CBW76537" FT /db_xref="GOA:E5ATW3" FT /db_xref="InterPro:IPR001387" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR010982" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/TrEMBL:E5ATW3" FT /protein_id="CBW76537.1" FT /translation="MKKDGEIKLLREERRKGVSQKLAAARTGMSERTVRKYERAGTLPS FT QMKKPRMHRTRENPFSVDWPWVEDHLKRDPALQAKTLFVLLCQAFPGRYQEGQLRTLQR FT HIQAWRVRHGPEQEVMFAQEHVPGRMAQSDFTSMNRLSVTISGTAFPHLLYHLVLTYSN FT VEAVRICFSESFEALAEGLEACLWQIGGVPQWHRTDNLTAAVRELDREGMHEFTQNYRA FT LLAHDSMQPSANTAGCANQNGDVEQSHFRFKQAVDQALRVRGTRDFATRSDYEHFLGEL FT VGQRNLTRSQRFEADRAALRALPAAPLDFTRAVTVRVSRFSLVRVLNNYYSVPSRLIGA FT MLKARIRSENLDLYHGTAHVLTLPRLSGRNQRRIDYRHLIWSLVRKPGAFAAYCYRDEL FT FPTTTFRRAYDALLATTPTKADQEYLRLLHLAASTSEAQIDEAIGRLLHDGRIPTLDVV FT RKLVASPTPTPVPKIGKAAINLHDYDALIPSRSKHA" FT CDS 127293..128087 FT /transl_table=11 FT /locus_tag="RBRH_00457" FT /db_xref="EnsemblGenomes-Gn:RBRH_00457" FT /db_xref="EnsemblGenomes-Tr:CBW76538" FT /db_xref="UniProtKB/TrEMBL:E5ATW4" FT /protein_id="CBW76538.1" FT /translation="MKSLTLTYCGEHIEFESGLFMRIPTRSVGPSNAQRDAEPGTTEEK FT AAPSTRSRPRVLNPLLAVLKHRDSKAIQSLAGTGHSAPALRRSRPPSPVEIDHARKLIH FT RQNNNWTLAQVSVYGQMHNLQPLEKYLDSNGNPTTAGKSVLDAQKKRSEYIAKLKKFRK FT PAVSLKKLTRGLSTQIYSELAKSVTTARDYESSVNPFALIEHDSPQFVMPSAILRPMAR FT PTYKESEGSHPEKLPTYEEAVSPKPAEPTIGTNRLPRSSSLR" FT CDS complement(128367..128579) FT /transl_table=11 FT /locus_tag="RBRH_00458" FT /db_xref="EnsemblGenomes-Gn:RBRH_00458" FT /db_xref="EnsemblGenomes-Tr:CBW76539" FT /db_xref="UniProtKB/TrEMBL:E5ATW5" FT /protein_id="CBW76539.1" FT /translation="MVSTIGSGFMDQIDKLQSLDPKTMSADQEKDLEKLSQFFDRCIDH FT GGPVGAXVKEMIDTYHAAHPDTQQA" FT CDS 128603..128752 FT /transl_table=11 FT /locus_tag="RBRH_00459" FT /db_xref="EnsemblGenomes-Gn:RBRH_00459" FT /db_xref="EnsemblGenomes-Tr:CBW76540" FT /db_xref="UniProtKB/TrEMBL:E5ATW6" FT /protein_id="CBW76540.1" FT /translation="MLGWLWVTEQHNDAMLNCVEPGDHEVARCDTNSGSRRCVGIGIKL FT ELTQ" FT CDS 129184..129300 FT /transl_table=11 FT /locus_tag="RBRH_04228" FT /db_xref="EnsemblGenomes-Gn:RBRH_04228" FT /db_xref="EnsemblGenomes-Tr:CBW76541" FT /db_xref="UniProtKB/TrEMBL:E5ATW7" FT /protein_id="CBW76541.1" FT /translation="MTTDIVKRNKAVIQAFVEHIDSGPALTRRCASAACPTR" FT CDS 129394..129684 FT /transl_table=11 FT /locus_tag="RBRH_00460" FT /product="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /function="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /EC_number="4.2.1.18" FT /note="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /note="COG: Enoyl-CoA hydratase/carnithine racemase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00460" FT /db_xref="EnsemblGenomes-Tr:CBW76542" FT /db_xref="GOA:E5ATW8" FT /db_xref="UniProtKB/TrEMBL:E5ATW8" FT /protein_id="CBW76542.1" FT /translation="MRRRLFGLFYSTPAVPLSSNVLGKAAFERLVTGDFIDAVTVHPRG FT LVNRAAGPVQLDNTLRELAQRICAKPAHVVALGKDLFYRQAEMGVDASLTG" FT CDS 129852..130850 FT /transl_table=11 FT /locus_tag="RBRH_00461" FT /product="Magnesium and cobalt transport protein corA" FT /function="Magnesium and cobalt transport protein corA" FT /note="Magnesium and cobalt transport protein corA" FT /note="COG: Mg2+ and Co2+ transporters" FT /note="Pfam: CorA-like Mg2+ transporter protein::PF01544" FT /db_xref="EnsemblGenomes-Gn:RBRH_00461" FT /db_xref="EnsemblGenomes-Tr:CBW76543" FT /db_xref="GOA:E5ATW9" FT /db_xref="InterPro:IPR002523" FT /db_xref="InterPro:IPR004488" FT /db_xref="UniProtKB/TrEMBL:E5ATW9" FT /protein_id="CBW76543.1" FT /translation="MQKVEVPMLINCAAYHDGRKMGDIPVSDISEYVAKPDCFVWVALK FT DPNPEELAQMAHEFGLHELAVEDASHGHQRPKIEEYGASLFAVLHTVEQTSDKELEVGE FT VAVFAGANYVLTVRAGSKQGFQDVRARCERDAHLLRHGSAFVLYALIDSVVDRYFPVVE FT ALIDESEIVEDRIFENKGTAASRDVVEDLYSLKRRFVRLHHHVAPLLEAVGKLQGGRVP FT TLCAGMEAYFRDVYDHLVRIDKLIEGRREMISTAIQVNLGMISLAESETTKRLGAFGAL FT FASPTMIAGIYGMNFQSIPELHWQYGYPACLAVMLAIDAVLWWRFRKAGWL" FT CDS complement(130938..131651) FT /transl_table=11 FT /locus_tag="RBRH_00462" FT /product="Membrane protein, MgtC/SapB family" FT /function="Membrane protein, MgtC/SapB family" FT /note="Membrane protein, MgtC/SapB family" FT /note="COG: Uncharacterized membrane protein" FT /note="Pfam: MgtC family::PF02308" FT /db_xref="EnsemblGenomes-Gn:RBRH_00462" FT /db_xref="EnsemblGenomes-Tr:CBW76544" FT /db_xref="GOA:E5ATX0" FT /db_xref="InterPro:IPR003416" FT /db_xref="UniProtKB/TrEMBL:E5ATX0" FT /protein_id="CBW76544.1" FT /translation="MNWTLIGMADLVINLELVGRLLMAAALGSVIGIERERLQWAAGLR FT THMLVCVGSALIMIVSTYGFTQVQGKEGMVLDPSRVAAQVVSGIGFLGAGSILLRGEVI FT RGLTTAASLWTVAGVGLAVGGGLYVAASAATAIILVILVGVKPLERRFIAAKLRREVRL FT VASRGALSIDTLSEVLGPSSARIKRFIVQQQEDGSGIDDVTIAFSRVTDPEFATIVRRL FT EQMQGVRHVREVAPS" FT CDS complement(131648..131851) FT /transl_table=11 FT /locus_tag="RBRH_00463" FT /db_xref="EnsemblGenomes-Gn:RBRH_00463" FT /db_xref="EnsemblGenomes-Tr:CBW76545" FT /db_xref="UniProtKB/TrEMBL:E5ATX1" FT /protein_id="CBW76545.1" FT /translation="MRPHVTDANEHGVRLPRQRLDDPIQPVLRHCARSASLSANVKISS FT NLAFWLLRRRLAPARSNTGNVQ" FT CDS 131762..131902 FT /transl_table=11 FT /locus_tag="RBRH_00464" FT /product="Arabinitol operon repressor" FT /function="Arabinitol operon repressor" FT /note="Arabinitol operon repressor" FT /db_xref="EnsemblGenomes-Gn:RBRH_00464" FT /db_xref="EnsemblGenomes-Tr:CBW76546" FT /db_xref="UniProtKB/TrEMBL:E5ATX2" FT /protein_id="CBW76546.1" FT /translation="MAQHRLYRIVKALSRQADAVFIGIGHVGPHARCTEAVSCRTPNST FT K" FT CDS complement(131938..132402) FT /transl_table=11 FT /locus_tag="RBRH_00465" FT /product="Sorbitol/mannitol transport ATP-binding protein" FT /function="Sorbitol/mannitol transport ATP-binding protein" FT /note="Sorbitol/mannitol transport ATP-binding protein" FT /note="COG: ABC-type sugar transport systems, ATPase FT components" FT /db_xref="EnsemblGenomes-Gn:RBRH_00465" FT /db_xref="EnsemblGenomes-Tr:CBW76547" FT /db_xref="GOA:E5ATX3" FT /db_xref="InterPro:IPR008995" FT /db_xref="UniProtKB/TrEMBL:E5ATX3" FT /protein_id="CBW76547.1" FT /translation="MSVASGVHEPATRRRSAEVTIGNCPEPLSLITRAYGMSARTMTVE FT PLANAAYLYAKSPLANDELIARILPLERHAKGAVVMLGADLDHCPLFDAQGRAFEQKWR FT RRWPPRNARAIRRRRQSSGVAAASRAVSWWRGAQLTCRYAGRMHPASRID" FT CDS 132589..132711 FT /transl_table=11 FT /locus_tag="RBRH_00466" FT /db_xref="EnsemblGenomes-Gn:RBRH_00466" FT /db_xref="EnsemblGenomes-Tr:CBW76548" FT /db_xref="UniProtKB/TrEMBL:E5ATX4" FT /protein_id="CBW76548.1" FT /translation="MQREAGARPCGVHAALPHGMAGNPRGHYSEAFYAVQHLLV" FT CDS 132757..133608 FT /transl_table=11 FT /locus_tag="RBRH_00467" FT /note="COG: ABC-type amino acid transport/signal FT transduction systems, periplasmic component/domain" FT /note="Pfam: Bacterial extracellular solute-binding FT proteins, family 3::PF00497" FT /db_xref="EnsemblGenomes-Gn:RBRH_00467" FT /db_xref="EnsemblGenomes-Tr:CBW76549" FT /db_xref="GOA:E5ATX5" FT /db_xref="InterPro:IPR001638" FT /db_xref="UniProtKB/TrEMBL:E5ATX5" FT /protein_id="CBW76549.1" FT /translation="MVHAPLNHEGPQDMKSTVLSTLLAGLLIVAAGVAHADRLDDIKKA FT GVLRVATFDSNPPFGFVDAKTHHIVGLDVDYAKALADKLGVKLELQPTNPANRIPFLTS FT RKVDLVLANFTITEERAKQVDFSIPYFASGQQFLAKKGVLKSAEQLNGLRIGADKGTIN FT EITLREKFPQATIVAYDDTPFAFAALRAGNVQAITQDGPKLVGLLANVPDKQNYEIPAF FT TISNDYMGVGIPKGETRLVAFVNDTLRGLEKGGMAEQIYNRWFGPRTSTPLPRLFKIGD FT KV" FT CDS 133612..134340 FT /transl_table=11 FT /locus_tag="RBRH_00469" FT /product="Amino acid ABC transporter permease protein" FT /function="Amino acid ABC transporter permease protein" FT /note="Amino acid ABC transporter permease protein" FT /note="COG: ABC-type amino acid transport system, permease FT component" FT /note="Pfam: Binding-protein-dependent transport system FT inner membrane component::PF00528" FT /db_xref="EnsemblGenomes-Gn:RBRH_00469" FT /db_xref="EnsemblGenomes-Tr:CBW76550" FT /db_xref="GOA:E5ATX6" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:E5ATX6" FT /protein_id="CBW76550.1" FT /translation="MPQEWILEPKYVGWLLQGFGVTLALAATVIVTATVSGFALAMAHS FT ADARLVRRVAAAYVLVFRNSPLLVQLMFWYFGAATLLPDGLMQWLNAPHAFQVGALSLR FT WPPFEFVAGWIGLTFYSCAFVGEEFRAGLRGVSGGQRQAAAALGLTRWQAFRHVVLPQA FT ARNAMPPLFGQYMNIVKNSSLTMAIGLAELSYASRQVETETFKTFAAFGVATALYIGTI FT AVIEALAHVVQRRHPAARAG" FT CDS 134337..135032 FT /transl_table=11 FT /locus_tag="RBRH_00470" FT /product="Amino acid ABC transporter permease protein" FT /function="Amino acid ABC transporter permease protein" FT /note="Amino acid ABC transporter permease protein" FT /note="COG: ABC-type amino acid transport system, permease FT component" FT /note="Pfam: Binding-protein-dependent transport system FT inner membrane component::PF00528" FT /db_xref="EnsemblGenomes-Gn:RBRH_00470" FT /db_xref="EnsemblGenomes-Tr:CBW76551" FT /db_xref="GOA:E5ATX7" FT /db_xref="InterPro:IPR000515" FT /db_xref="InterPro:IPR010065" FT /db_xref="UniProtKB/TrEMBL:E5ATX7" FT /protein_id="CBW76551.1" FT /translation="MTMDVSILLDNLPYLLVGTFPNGPLGGVALTLVLALTSAFVSGVL FT GLAAGIALALTRGAVHTVLLAVIGFFRAIPVLMLMFWTYFLLPVVLHIDAPGQLTVVCA FT LSLIGGAYLSHAVYAGIRAVGAAQLQAGLSLGFTRMQALRFVVLPQALRIMAPSFINQW FT VSLIKDTSLAYIVGVPELSLLATQVNNRLMVYPAQIFALVAFIYVLICTAFDAIASRLV FT AVTTPRPLH" FT CDS complement(135315..135833) FT /transl_table=11 FT /locus_tag="RBRH_00471" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00471" FT /db_xref="EnsemblGenomes-Tr:CBW76552" FT /db_xref="UniProtKB/TrEMBL:E5ATX8" FT /protein_id="CBW76552.1" FT /translation="MAAAFVELIGYDSRTAAGRNVAGTAAGEPSPTPEVLSIANLHARR FT CRPRGTGYSQKPLCQRRRAGRKPRYRDGRSPSSAHRPPECDARLLGTTRRRPVRHVRRR FT RAVRHRRPPDAGGAAPSRPGRRARDGGALLRRHQAWCRWTHARVHGRGCNSATARTAHR FT THRPENFDH" FT CDS 135854..136144 FT /transl_table=11 FT /locus_tag="RBRH_00472" FT /db_xref="EnsemblGenomes-Gn:RBRH_00472" FT /db_xref="EnsemblGenomes-Tr:CBW76553" FT /db_xref="UniProtKB/TrEMBL:E5ATX9" FT /protein_id="CBW76553.1" FT /translation="MAAEEFMIRKTLTATRLQQEFERRLHRLDHIADDGVKIRVPRPRM FT QPPDASGCNWTLGHFSNAAGYKKDIAAVLAAMRAEYNLAGEVVRPDDPFGT" FT CDS complement(136218..136499) FT /transl_table=11 FT /locus_tag="RBRH_00473" FT /product="Thiosulfate sulfurtransferase (EC 2.8.1.1)" FT /function="Thiosulfate sulfurtransferase (EC 2.8.1.1)" FT /EC_number="2.8.1.1" FT /note="Thiosulfate sulfurtransferase (EC 2.8.1.1)" FT /note="COG: Rhodanese-related sulfurtransferase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00473" FT /db_xref="EnsemblGenomes-Tr:CBW76554" FT /db_xref="GOA:E5ATY0" FT /db_xref="InterPro:IPR001763" FT /db_xref="UniProtKB/TrEMBL:E5ATY0" FT /protein_id="CBW76554.1" FT /translation="MQINALAPYAAPEVAALTGKPASVLTGGTAAWNDAGLAIETGKVR FT TASPRIDRYRCSDQGTNNLHSTTHAHLDWEYALVAQLERDGTHSFFVI" FT CDS 136818..139298 FT /transl_table=11 FT /locus_tag="RBRH_00474" FT /product="Sensory transduction protein kinase (EC 2.7.3.-)" FT /function="Sensory transduction protein kinase (EC FT 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Sensory transduction protein kinase (EC 2.7.3.-)" FT /note="COG: Signal transduction histidine kinase" FT /note="Pfam: Histidine kinase-, DNA gyrase B-, and FT HSP90-like ATPase::PF02518
PAS fold::PF00989
PAS FT fold::PF08447
PAS fold::PF08448
Response regulator FT receiver domain::PF00072" FT /db_xref="EnsemblGenomes-Gn:RBRH_00474" FT /db_xref="EnsemblGenomes-Tr:CBW76555" FT /db_xref="GOA:E5ATY1" FT /db_xref="InterPro:IPR000014" FT /db_xref="InterPro:IPR000700" FT /db_xref="InterPro:IPR001610" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="InterPro:IPR011006" FT /db_xref="UniProtKB/TrEMBL:E5ATY1" FT /protein_id="CBW76555.1" FT /translation="MRRAPVPMTNRGPALNSLTSVWPMLWVETIADYAIFALSPDGRIL FT SWNAGGERIYGYTREQALERMLDDLYPDQECRAGAPAAALRTAARDGRYESEGWRVRCD FT GTTFWGSVVMTPLHGAHGQLLGFGKIVRDMSDKKKVHDVAMESERRFRLLVQGVTDYAI FT FMLSPQGIVTNWNQGARRIKGYQAEEIIGSHFSRFYTPQEAAAGVPQRGLEVAAREGRW FT ESEGWRVRRDGSRFWAHVVLDAIRDDDGELIGFAKITRDITERREAAQALEETRTALFQ FT SQKMEAIGKLTGGVAHDFNNVLQVLRGNLELLENRHGDDAWSRERLGKAIDAVNRGAKL FT AAQLLALGRQQPLKPQVVNLSGVLHRMDDLLRRVLGETIHIETTVADGLWNTLVDSHQL FT ENVLLNLAINARDAMPDGGRLVLTLANAVLGPQPVAGIPDLRPGEYVTLAVTDTGTGMP FT PSVIERAFDPFFTTKPEGQGTGLGLSMAYGFVKQSGGHILIRSEPGRGTTVRIYLPRST FT APADTVRVLPSAAPQGGHETILVVEDDQAVQATVAETLMGLGYRVLRADNADQALALIR FT SGVHVDVLLSDVVMPGSIRSLELARVALRLRPRLKIVFTSGYTKDAIEDNARLNNSVEL FT LRKPYSREQLAARLRAVLGDHDVSVATGRARSPVPASSNAAVAPRRAPQPAKRIDQPLQ FT GVASAHQSPALDDPAARANRLRILLVDDNAAATEAVREILSMQGHVTIAAGTAEEALDA FT IRRDRFDVLLTDIMLPGMSGIELAQRSVDVQRSLRVIFTSGNDVPCDCDLGFAWEALRK FT PYTAEQLCAVLGRP" FT CDS 139467..139790 FT /transl_table=11 FT /locus_tag="RBRH_00475" FT /db_xref="EnsemblGenomes-Gn:RBRH_00475" FT /db_xref="EnsemblGenomes-Tr:CBW76556" FT /db_xref="InterPro:IPR025421" FT /db_xref="UniProtKB/TrEMBL:E5ATY2" FT /protein_id="CBW76556.1" FT /translation="MKSIVYAAIAASIVATPLASFAQQKGPLTREQVRAELVQLEKAGY FT SPESADPYYPDNIHAAQARVDAQQSIAYTSAGSSMSGSVQSGAGRDNAARPANSVNSVY FT FGH" FT CDS complement(139784..139996) FT /transl_table=11 FT /locus_tag="RBRH_04229" FT /product="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /function="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /EC_number="6.5.1.1" FT /note="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /db_xref="EnsemblGenomes-Gn:RBRH_04229" FT /db_xref="EnsemblGenomes-Tr:CBW76557" FT /db_xref="GOA:E5ATY3" FT /db_xref="UniProtKB/TrEMBL:E5ATY3" FT /protein_id="CBW76557.1" FT /translation="MPVSVPIRRDELTSLKSANQWTIANLHHRLAEQDTDPWHGYARVR FT QTITAQMRERIGMKEAIRLIRGAAQ" FT CDS complement(139968..143339) FT /transl_table=11 FT /locus_tag="RBRH_00476" FT /product="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /function="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /EC_number="6.5.1.1" FT /note="ATP-dependent DNA ligase (EC 6.5.1.1)" FT /note="COG: ATP-dependent DNA ligase" FT /note="Pfam: Eukaryotic and archaeal DNA primase small FT subunit::PF01896
Endonuclease/Exonuclease/phosphatase FT family::PF03372
ATP dependent DNA ligase C terminal FT region::PF04679
ATP dependent DNA ligase FT domain::PF01068" FT /db_xref="EnsemblGenomes-Gn:RBRH_00476" FT /db_xref="EnsemblGenomes-Tr:CBW76558" FT /db_xref="GOA:E5ATY4" FT /db_xref="InterPro:IPR002755" FT /db_xref="InterPro:IPR004808" FT /db_xref="InterPro:IPR005135" FT /db_xref="InterPro:IPR012309" FT /db_xref="InterPro:IPR012310" FT /db_xref="InterPro:IPR012340" FT /db_xref="InterPro:IPR014143" FT /db_xref="InterPro:IPR014144" FT /db_xref="InterPro:IPR014145" FT /db_xref="InterPro:IPR014146" FT /db_xref="InterPro:IPR020847" FT /db_xref="UniProtKB/TrEMBL:E5ATY4" FT /protein_id="CBW76558.1" FT /translation="MHHRSIRPLEIAIFNINGLRARLGQLLEWLEHEGPDVVCLQELKT FT PDERFPASDLERAGYGALWRGQAAWSGVTILARGEQPRAVRRALPGFETDTHNRYLEVS FT VAGLLIASLYLPNDNPQPGPKFDYKLAWFDKLIEHAATMVNDSRPVVLAGNYNVVLTDE FT DIYNPRSWLKDALLQPQSRQRYAQLLAQGWTDARRVLHPDKRNYTFWDDFRQHWQTHSG FT LRIEHLLLNRALAPALTAAEVDIWGAASHKRATMHRPGLNCDGIGTRTAGRHTPSATHR FT PNARTETRMRKALDEYTRKRDFDTTPEPPMQTGKSPARRGRANHALQFCVQKHDATQLH FT YDFRLELDGTLKSWAVPKGPSLDPHVKRIAIHVEDHPLDYAAFEGHIPEGHYGAGDVIV FT WDRGVWVPDGDPAEAYRKGRLTFRLDGEKLAGRWHLVRTRLKGKQEQWLLIKSDDNDAR FT SESEYDIVQALPDSVLSDRTLRPTTSARQLATRQAARKRQPETANDASAQAPLRKPVTT FT QNRRRSHWPALDGARAAPLPESLKPALATLVDAAPAGHWRYEIKFDGYRILARIDGDEV FT KLFTRNGNDWTSKMPRQAEALSRLGLDSAWLDGEVVVLDKAGLPNFQSLQNAFDARRSN FT GIVYYLFDVPYLNGMDLRNVPLEPRRATLTALLEHHEGDVLRLSRDFDESPESMLDSAC FT EIQLEGVIGKQAGSLYASRRTTDWIKLKCKHRQEFVVVGYTEPRGSRQAFGALLLGLHD FT PDTGALRYAGKVGAGFSEATLQSVLGRLDPLRTRHAALDNPPSRREATGVHWTRPELLA FT EVAYAEMTREGIIRHAVFRGLRTDKPASNIGPEHAVPADAIAAAPARRGRARAGPPADA FT PPDARAETETVRGVRITHPQRIIDSASATTKRELAEYYTSIASRILPHLKSRPVALVRA FT PDGITGELFFQKDAGKLPIPHIHMLDKACAGQPVMTIDSAQALVGAAQMGAIELHTWNA FT TTERLDQPDRFVLDLDPDPALPWKRMIEATQLTLAVLDELGLKSFLKTSGGKGIHLVVP FT LTPSQGWADVKGFTQALVQHMARQLPDRFSAVSGPRNRVGRIFIDYLTQRPRRDDDRAV FT RGPRPSAVARFGSNPA" FT CDS complement(143475..143975) FT /transl_table=11 FT /locus_tag="RBRH_00477" FT /db_xref="EnsemblGenomes-Gn:RBRH_00477" FT /db_xref="EnsemblGenomes-Tr:CBW76559" FT /db_xref="UniProtKB/TrEMBL:E5ATY5" FT /protein_id="CBW76559.1" FT /translation="MAGGYAIDNEYRLTAIQCPIQRYYVGQPSLLQPHQLLHGFVAAAL FT CIEPFEVSCHSTAIAPLDQAPAIRIGIGIGIGIGIGIGIGIGIGIGIGIGIGIGIGIGI FT GIGIGIGIGIGIGIGIGIEIVDRLLCNKRHAKRMARGQPAVAVGRMPASPPLEQMTVNE FT GPD" FT CDS 144087..144482 FT /transl_table=11 FT /locus_tag="RBRH_00478" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Predicted membrane protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00478" FT /db_xref="EnsemblGenomes-Tr:CBW76560" FT /db_xref="InterPro:IPR022016" FT /db_xref="UniProtKB/TrEMBL:E5ATY6" FT /protein_id="CBW76560.1" FT /translation="MTIFGDIVSKLLRSARPDACIVSPEPAPDPAAATVSTDAPFPAPT FT PLSGVDVAAVLDARVRKSGRALDWRRSLTDLLAALDVDDGLAQRSRLAGELGCNGPIDD FT PATIERLHDKLMHALAANGGKVPPPFH" FT CDS 144617..145078 FT /transl_table=11 FT /locus_tag="RBRH_00479" FT /product="Rubredoxin" FT /function="Rubredoxin" FT /note="Rubredoxin" FT /note="COG: Rubredoxin" FT /note="Pfam: Rubredoxin::PF00301" FT /db_xref="EnsemblGenomes-Gn:RBRH_00479" FT /db_xref="EnsemblGenomes-Tr:CBW76561" FT /db_xref="GOA:E5ATY7" FT /db_xref="InterPro:IPR004039" FT /db_xref="InterPro:IPR018527" FT /db_xref="InterPro:IPR024934" FT /db_xref="InterPro:IPR024935" FT /db_xref="UniProtKB/TrEMBL:E5ATY7" FT /protein_id="CBW76561.1" FT /translation="MYKKGAVVEIQFTAHRLNDHAGEPYWIDLGPDEAVTLYRQLHARF FT ANATPQAQPLIVSLDAPAAGHDPARDTPRQADLAAGLDTAAAVQPASVEPDVVAFRQWV FT CVICGWVYDEAYGAPDDGIPPGTRWEDVPADWRCPLCDVGKADFAMIEF" FT CDS 145097..145645 FT /transl_table=11 FT /locus_tag="RBRH_00480" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: ABC-type amino acid transport/signal FT transduction systems, periplasmic component/domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_00480" FT /db_xref="EnsemblGenomes-Tr:CBW76562" FT /db_xref="InterPro:IPR025512" FT /db_xref="UniProtKB/TrEMBL:E5ATY8" FT /protein_id="CBW76562.1" FT /translation="MIHRHASGRSGRLAWHTLHSAAEADRGRSARSHPLLVSCHEEQFV FT MICAFAKSLCRTTTLLSALFAGCVTAHAADVSFVEPKDGAQVSNPIHLKFAVDGMKVAP FT AGDMTPGTGHHHLLVDGQALPSGEVVPVNDHSIHYGKGQTETDVTLTPGDHTLTMQFAD FT GAHRSYGPEMSQTIKVHVK" FT CDS 145720..145959 FT /transl_table=11 FT /locus_tag="RBRH_04230" FT /db_xref="EnsemblGenomes-Gn:RBRH_04230" FT /db_xref="EnsemblGenomes-Tr:CBW76563" FT /db_xref="UniProtKB/TrEMBL:E5ATY9" FT /protein_id="CBW76563.1" FT /translation="MRDSNTVASCRIFLPLNGPVFWVSLTTTAGRHIEMQVLEASTVSF FT GTGISKSKEAERIILLLHVACVLFSAILAVLKKK" FT CDS 146006..147712 FT /transl_table=11 FT /locus_tag="RBRH_00481" FT /product="CARBAMOYL TRANSFERASE" FT /function="CARBAMOYL TRANSFERASE" FT /note="CARBAMOYL TRANSFERASE" FT /note="COG: Predicted carbamoyl transferase, NodU family" FT /note="Pfam: Carbamoyltransferase::PF02543" FT /db_xref="EnsemblGenomes-Gn:RBRH_00481" FT /db_xref="EnsemblGenomes-Tr:CBW76564" FT /db_xref="GOA:E5ATZ0" FT /db_xref="InterPro:IPR003696" FT /db_xref="UniProtKB/TrEMBL:E5ATZ0" FT /protein_id="CBW76564.1" FT /translation="MSHANMKILGINSAYHESSASIVIDGKIVAAVEEERFTRIKHAKE FT ACVSGPAELPKNSIQFCLSHAGLKATDLDGIAYSFDPALRKREFKLDSLSLPGDWGSAQ FT GEGIFLAKLQQVPGAIDALLDHQFGSKLAFVPHHIAHAASTFYPSGFDQAAILVVDGIG FT ESGCTLLARGDGNKITTLDQVPYPHSLGFLWEKLSKYLGFSEYDACKLMGLAAYGDPAV FT FRETFKQLLNSEAGRYTIDPDVAHFRLPDFERIEALFGPARADKEPILDHHRHVAAALQ FT EATDHALMGLVRELRERAASDKLCYAGGVALNCVSNSVIKESGLFSQMYVPTAPHDAGT FT AVGAALHLYYSLSGQRPSQADDNPYLGPAFSDAAIDAAFRDAGLSPRHSADPARDAATL FT IADGKIVAWFQDRMEFGPRALGNRSLLADPRSASMREVLNVKVKHREEFRPLAPSVLAE FT EAANWFELGQASMSHQSMLFACPAKQDRQASIPAVLHKDHSARVQMVSQERNPKFHALI FT QHFFEMTGVPVVLNTSFNDSEPIVCTPSDAIKTFQGTAIDALFIGNRFVVR" FT CDS 147642..148739 FT /transl_table=11 FT /locus_tag="RBRH_00482" FT /product="Methyltransferase" FT /function="Methyltransferase" FT /note="Methyltransferase" FT /note="COG: Methylase of polypeptide chain release factors" FT /note="Pfam: Methyltransferase small domain::PF05175" FT /db_xref="EnsemblGenomes-Gn:RBRH_00482" FT /db_xref="EnsemblGenomes-Tr:CBW76565" FT /db_xref="GOA:E5ATZ1" FT /db_xref="UniProtKB/TrEMBL:E5ATZ1" FT /protein_id="CBW76565.1" FT /translation="MRSRRSRERPLMLCLLAIGLSSDKLGFDRQTNNSQTNNRMVRDIA FT MHHTNEEKCIFFITKNHGQTASHHQIADCLPIAQWNSMHHGLNGQHDEKNNLLSSPYPI FT KVVTDAFHYPHADQVLPIQPEQLFFMDYTSAEDLEQASVLDIGVGSGVLSIFCLLNGAT FT SCVGLDVNPRAKILAGHNAILNHIDKNFDIRDGSTSDIFASVKDKQFDFICSNPPFEPT FT PPGIDYYVNSAAGIYGMDFAEKILSNIDQHLTDDGMLQVVTMAPGDAKRPFKLYEILEN FT HLPGQAVEIILDRQPISYDDFVGRFNTIFGYGEGVVSQMKKTARDDGVTHLHMLIMKYK FT KGRHGSITEKVAGRIYENWTTPLGL" FT CDS 148954..162492 FT /transl_table=11 FT /locus_tag="RBRH_00484" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00484" FT /db_xref="EnsemblGenomes-Tr:CBW76566" FT /db_xref="GOA:E5ATZ2" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5ATZ2" FT /protein_id="CBW76566.1" FT /translation="MMPACVAPLTHPLSTAQTEIWLAQELHPNSPVYNIAQYTTIDGAV FT DPVLFEVALRQVINEADSLRLQFVETDQGLQQTVGSVDGFLPFIDVSREADPQAAAHAW FT MRTDYERPVNVLRDPLFCYALLKVGPEHFFWYQRYHHIMMDGFSLYLIAQRVAQLYSAL FT CKHAEPPPCPFGSVFQLLESDVQYRTSAQWVQDESYWLKRCMDWPEPATLASRSAPAVA FT VAHRFRQTIYLDSKSIGIETADSRNLAQFGVATLAAYLCRWTSVQDIVFGLPVKARFGA FT NRQIPGMQSNVLPLRLTVQPDMSLSLLMQQAAQAIQSALEHQRYPSERVRRQLGLVNHQ FT QLFNTAVNVMPFDYDLSFDGNASTNHNLLNGPVDDLMIVITQPDANTLQIDFDFNPARY FT TEDECIAHQRRFIQFLRTLAANSTQPLRSIDILTVDERQLMLETWNATQQDYPAHQCIH FT QVFEAQVERTPDARALVAEGQTLSYAQLNARANRLAHQLIELGVKPEARVAICVERSPA FT MIIGLLAILKAGGAYVPLDPAYPSERLVHILADAAPAIVIADATGRAVLGDATLASRTV FT LDPNTLSELADTNPWVPEITARHLAYVIYTSGSTGMPKGVMVEHAQAVNLLFWALQAFT FT PSETQHTLFSTSINFDLSVYECFVPLAQGSTVRLVDNALALTNHSEPISLINTVPSAMR FT SLLDHRADLSSATTINLAGEPLKAQLIQQIFEQTPVQRLCNLYGPSECTTYSTWLSIHR FT EEPWIESIGRPIANTRIYLLDAQGQPVPLGAVGELYIGGAGVARGYWNRPQLTAERFVP FT DPFSMVPDARMYKTGDLARYLPDGNLQYLGRNDEQIKLRGFRIEPGEIEACLTQHPQVH FT DAVVLAREGSDKRLVAYVEAAPDEQLASTLRSHVAAALPEYMVPSVFVRLDAWPLTPNG FT KLDRRALPAPDDEALVRQVYEAPQGELETTLAAFWAELLGVEQVGRHDNFFALGGHSLL FT AMQLIERLRRRGFGVSVRTLFDTPVLSALAQTLGQHCGVVVPPNMITSDTAALTPSMLP FT LIDLSQSDLDHIVEQVPGGVANLQDIYALSPLQDGILFHHLLASDGDPYLLITQLAFDS FT RERLDQYLDALQQVINRHDILRTAFVWEGLSTPAQVVWRHAPLSVTELALDAKEGPVAE FT QLARRFDPRHTRLDLTQAPLLRLAIAQDTDGRWLLVQLLHHLIGDHSTLEAMHTEIRAF FT IEGKGETLPAPQPFRNLIAQARLGVGQTEHERFFTEQLGDIEEPTLPFGLSQVHRDGAQ FT VAEAQRMLPQALNDRLRAHARRLGVSLASLCHLAWAQVLARASGQRRVVFGTVLFGRMQ FT AGEGADSAMGLFINTLPLRVDLEGTVESAVRATHARLASLLEHEHASLALAQRCSGVPA FT GTPLFSALLNYRHNAPSSSERSILPGVELLSVQERDNYPIGLSVEDYGQVLGLTAQIVE FT PMDPDRVCGYMQQALLSLAEALETAPEWPVEQSEILPANERTLLLKTWNATQRDYPAHQ FT CLHQLFEAQVVRTPEATALVYEGQTLSYAELNARANRLAHQLIVLGVQLDARVVLYAQR FT SPEMVVGMLATLKAGGAYVPLDPTYPRERLAYMVTDSAPIVLLSVGTPPTAVTQRLRAG FT VPVLDLQADAAQWAHQSTHNPGLALTAQSLAYVIYTSGSTDQPKGVMVPHQGGVNLVTA FT IARELGLTAQDRMLQFAPLSFDTSVEELFTPLTQGATVVLRTDAWLAEAEQFWALCDTH FT HVSVVDLPVQFWTQLVQEAAPVASSVRVILIGGDALSATARDAWFANNGHRPRLLNVYG FT PTETTVTSTVHEVTDDENSWRTIGRPLDNTRLYILDAYGQPVPMGAIGELYIGGAGVAR FT GYLNRPELTAERFVRDPFVAEPDARMYKTGDLARYLPNGNLEFLGRNDHQVKIRGFRIE FT PGEIEACLGQHPQVREAVVLAVGEGSAKRLVAYVVAEPDDALAGTLRTHVAEALPEYMV FT PSAFVRLDALPLTPNGKLDRRSLPAPDVQAFARQAYEAPQGELETTLAQIWSELLGVEQ FT VGRHDSFFALGGHSLLAVRLMNRVAALGIALPLATLFAAPTLAGLAAALDAQHTSNGAA FT LPAITPVSRDGTLPLSFAQQRLWFLAQLDGASDSYHIPLALRLRGTLNRVAWQHALDAL FT WTRHEALRSVFVSVEGQPQVQLLPAETGMPMSWHNLRGAPDADVQLAQLSAEAARTPFD FT LERGPLIRACGIQLAEDEYVVLLTHHHIVSDGWSIGVLVRELNTLYTAACAGQADPLPP FT PAIQYPDYAAWQRQWLTGEQLQRQSHYWRTTLADAPVLLELPTDRPRPPQQSFAGAQVP FT IHIDAKTTRALKRLSHAHGTTLFMTVLAAWGAVLSRLSGQEDLIIGVPSANRNHREIEP FT LVGFFVNTLALRLDLSGEPDTAQLLERVRRTTLEAHAHQDLPFEQVVEIVQPPRRLDYT FT PLFQVMFAWQNNEIANWRLPNLAVTPVELNYDTVKFDLELGLYESGEEIIGELGYASAL FT FDQSTISRHVGYFKAMLQAMVAHPRQPVATFELLADDERKLLLYTWNATQRDYPSQLCV FT HQLFEMQAKRTPEAIALMYEQQTLSYAELNAQANRLAHQLRELGVRANSRVALYAYRCP FT EMVVGILATLKAGGVYVPLDPTYPPERLASMMADSKPVVLLSVGTPQAAVTQCVENGVP FT ILDIQAGTAQWEHRSAYGFESHKLALKAQHLAYIVYTSGSTGQPKGVLIKHHSLVNLVT FT AMARRLDLAAQDRVLQCSSLSFDAAIGEIFVTLTQGATLVLRTDAWLAGAQQFWALCKA FT NRVSVTDLPTQFWTQLTQEKVAVPDCVRVVMISGDALSAAARDAWFAGGGHRPRLFNVY FT GPTETTITATVHEITRDDDNWRSIGRPIDNTQLYILDTYRHPVPMGVAGELYIGGVGVA FT CGYLNRPGLSAERFIPNPFSVMPSARMYKSGDLVRYLPNGNLEFLGRNDHQVKVRGFRV FT ELGEIEAHLTQHPQVREAAVLARGESNEKRLIAYVVAEPDEQLASTLRTHIAARLPDHM FT VPAAFVRLDALPLTPNGKLDRHALPAPDDAAWVRQVYEAPQGELETTLAAIWSELLGVK FT QVGRHDSFFALGGHSLLAVQLIERLRRRGLGMSVRALFDTPVLSMLAQLLGQHREVAVP FT PNRIMPETSALTPDLLPLIELTQAEIDRIVEQVPGGVANIQDIYALSPLQDGILFHHLL FT ASEGDPYLLTTQLVFDTRARLDQYLNAIQQVVNRHDILRTAFVWEGLSMPAQVVWRHAP FT LSVTELALDAKEGPVAEQLARRFDPRHTRLDLTQAPLLRLAIAQDTDGRWLLVQLLHHL FT IGDHSTAEVMQAEVRALIEGRGETLPAAQPFRNLIAQARLGVSPAAHARFFTEQLGDIE FT EPTLPFGLSQVHHDSAQVAEAQRMLPQALNDRLRAHARRLGVSLASLCHLAWAQVLARA FT SSQRRVVFGTVLFGRMQAGEGADSAMGLFINTLPLRVDLEGTVESAVRATHARLASLLE FT HEHASLALAQRCSGVPAGTPLFSALLNYRHNAPSSSERSILPGVELLTAEERTNYPLTL FT SVEDFGQALGLTAQAVASLDPDRICGYMQQALHSLAEALETAPEGPIEQLEVLPNEERE FT LLLQTWNATQQDYPAHQCIHQLFEAQVERTPEATALVYEDQALSYAELNARANRLAHQL FT IELGVQPDARVAICVQRSPAMVVGLLAILKAGGAYVPLDVAYPGKRLAHILQDAAPEIV FT LADAAGRVALGEAALTNRTVLLDPNTLPQRARTNPLIPALTCRHLAYVIYTSGSTGTPK FT GVMNEHQALVNRLLWMQQAYGLTVADRVLQKTPFGFDVSVWEFFWTLLNGATLVVAAPE FT VHKDPTALMELIIRQRITTVHFVPSMLGTFLHNEGVEQCTSVKRLICSGEALPGTSVRL FT CQRRLPGAQLYNLYGPTEAAIDVTAWNCPSDYAEDTVPIGRPIANTQIYLFDAYGQLVP FT LGAVGELYIGGAGVARGYLNRPELTAERFVRNPFSAETNAQMYKTGDLARYRSDGNLEF FT LGRNDDQVKIRGFRIELGEIEACLAKHSQVREAVVLTTGEGSVKRLVAYVVAQADEQLV FT NTLRVHVAEALPEYMVPSAFVRLDALPLTPNGKLDRRALPAPNADAFAHQAYEAPQGEL FT ETTLAAIWAELLGVEKISRHDNFFALGGHSLLAVRMASCSRTALNVSIPIRMLFETPTV FT AALAQRLLTHRSMQDDSFAVLLPIQTNGSRPPLFCVHPFSGLSWHYRGLASHLDAEQPV FT YGLQARGFDGETLAPTLDAMAADYIQQIRRIQPHGPYYLLGWSLGGNIAYNMATQLEEL FT GEQIALLALLDSAPKHVQRDDEPEMDLKEAYIKLLAHDDGQIKSNVGHDLWEKSRTVVQ FT NNYKLLKSFSPRMYAGNMLFFRATVVQDASTDLIPSDAWRPYVLGEIEIQNIPCKHHDM FT DKPLPTTIIGQILQRKLNILHKCDKKTCSCCAKIKNEPLRAK" FT CDS complement(162829..164115) FT /transl_table=11 FT /locus_tag="RBRH_00485" FT /product="Sensor protein rstB (EC 2.7.3.-)" FT /function="Sensor protein rstB (EC 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Sensor protein rstB (EC 2.7.3.-)" FT /note="COG: Signal transduction histidine kinase" FT /note="Pfam: HAMP domain::PF00672
Histidine kinase-, DNA FT gyrase B-, and HSP90-like ATPase::PF02518
His Kinase A FT (phosphoacceptor) domain::PF00512" FT /db_xref="EnsemblGenomes-Gn:RBRH_00485" FT /db_xref="EnsemblGenomes-Tr:CBW76567" FT /db_xref="GOA:E5ATZ3" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003660" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="UniProtKB/TrEMBL:E5ATZ3" FT /protein_id="CBW76567.1" FT /translation="MLRSLIRLYLAVIVVAGAAIVLVDVSSVRIFSERASEQARHSLST FT YAFVLTDYLERHAGNQRAAALRALSKHDAEGFSLMTWQDVEQLLDARQLSELRASKIVH FT ANPQEPTYLDIQIYAYGFIVLATLLAVGAWVHYHWRDLRALEAAARAFGAGKLSTRAPI FT SSKSSIYELSRQFNEMAEQIEASILQQRDMMYGISHELKTPLARLEFGLALLASPDSPE FT RQRERYDALHADVRELDDLVTELLTLCRFEQRASHKTPMRVAVGELLDSVADSVAHDVG FT NRGLTLSVSTQGAPQWHVCDPKLVARALLNLVRNSLRYAANTITLSATTDAHGALQLAV FT EDDGPGIPVEDRQRIFEPFYRPHSSRDRQTGGFGLGLAIVRRVALLHGGSVWLEHGELG FT GARFVMTLPALPGEEPQQSLTEEPVPAAA" FT CDS complement(164116..164553) FT /transl_table=11 FT /locus_tag="RBRH_00486" FT /product="Transcriptional regulatory protein" FT /function="Transcriptional regulatory protein" FT /note="Transcriptional regulatory protein" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_00486" FT /db_xref="EnsemblGenomes-Tr:CBW76568" FT /db_xref="GOA:E5ATZ4" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:E5ATZ4" FT /protein_id="CBW76568.1" FT /translation="MPPHPQAVQRAVLILTARVDAHDQIAGLETGANDYRIKLLGPRLL FT IARARTLLRRMQPAPTAVGAPPVGDALRSGEIVASPPNRKITWRGEMLKALRGIEFDGL FT DHSVNSSISRVRRRFETSSEPRKVKTIWRRGDLFSPSAWEE" FT CDS complement(164514..164831) FT /transl_table=11 FT /locus_tag="RBRH_00487" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_00487" FT /db_xref="EnsemblGenomes-Tr:CBW76569" FT /db_xref="GOA:E5ATZ5" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR011006" FT /db_xref="UniProtKB/TrEMBL:E5ATZ5" FT /protein_id="CBW76569.1" FT /translation="MGCLRTIHGTARPDRIGQCDARKTMEDVPLKHKVLLVEDDDRLAQ FT WVREYLDNYKLSVHGDRRGDVALDALRKHRLALMILEPMPPNLNDMAVCRRIRKLSNVP FT C" FT CDS 164808..164900 FT /transl_table=11 FT /locus_tag="RBRH_04231" FT /db_xref="EnsemblGenomes-Gn:RBRH_04231" FT /db_xref="EnsemblGenomes-Tr:CBW76570" FT /db_xref="UniProtKB/TrEMBL:E5ATZ6" FT /protein_id="CBW76570.1" FT /translation="MDSAQTAQDNLSNLDTNLHHFKTNVKSVRS" FT CDS 165033..165140 FT /transl_table=11 FT /locus_tag="RBRH_00488" FT /product="Outer membrane protein" FT /function="Outer membrane protein" FT /note="Outer membrane protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00488" FT /db_xref="EnsemblGenomes-Tr:CBW76571" FT /db_xref="UniProtKB/TrEMBL:E5ATZ7" FT /protein_id="CBW76571.1" FT /translation="MDGSGVAPRYLGSRRYRPEFDLGFCAQFGNGFLSA" FT CDS 165104..165259 FT /transl_table=11 FT /locus_tag="RBRH_00489" FT /db_xref="EnsemblGenomes-Gn:RBRH_00489" FT /db_xref="EnsemblGenomes-Tr:CBW76572" FT /db_xref="UniProtKB/TrEMBL:E5ATZ8" FT /protein_id="CBW76572.1" FT /translation="MRAVWQWLFISVIDGAGYHKPFDNDMFAQIALNYDDGRAERHRTD FT RVSSTH" FT CDS complement(165619..166815) FT /transl_table=11 FT /locus_tag="RBRH_00490" FT /product="Aromatic-amino-acid aminotransferase (EC FT 2.6.1.57)" FT /function="Aromatic-amino-acid aminotransferase (EC FT 2.6.1.57)" FT /EC_number="2.6.1.57" FT /note="Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" FT /note="COG: Aspartate/tyrosine/aromatic aminotransferase" FT /note="Pfam: Aminotransferase class I and II::PF00155" FT /db_xref="EnsemblGenomes-Gn:RBRH_00490" FT /db_xref="EnsemblGenomes-Tr:CBW76573" FT /db_xref="GOA:E5ATZ9" FT /db_xref="InterPro:IPR000796" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:E5ATZ9" FT /protein_id="CBW76573.1" FT /translation="MFEHVEAFPGDPILSLNEDFQVDPRSDKVNLSIGIYFDAHGKLPV FT MAAVRDAEQALAGAIGPRPYLPMSGLPAYRDAVQQLVFGDTCSARAGRRIATLQTLGGS FT GALKVGADFLRRTFPDVQVWISDPSWENHRVVFERAGFTVNTYPYYDGATGGLRFDAML FT DALRAIPKRHIVLLHACCHNPTGVDLDHDQWREVISLIEQNELLPFVDMAYQGFGTDLD FT DDAFAVRELAARGISCLVANSFSKNFSLYGERCGGLSVVCRSADEATRVLGQLTGAIRA FT NYSNPPTYGAKVVHKVLCTPALRASWQSELASMCKRIAAMRRAIHQRLQGHIADEALSR FT YIRQRGMFTYTGLSAAQVDRLRAEHGVYLVRSGRMCVAGLNEQNVGVVANALASVLRA" FT CDS complement(166840..168228) FT /transl_table=11 FT /locus_tag="RBRH_00491" FT /product="Aromatic amino acid transport protein aroP" FT /function="Aromatic amino acid transport protein aroP" FT /note="Aromatic amino acid transport protein aroP" FT /note="COG: Gamma-aminobutyrate permease and related FT permeases" FT /note="Pfam: Amino acid permease::PF00324" FT /db_xref="EnsemblGenomes-Gn:RBRH_00491" FT /db_xref="EnsemblGenomes-Tr:CBW76574" FT /db_xref="GOA:E5AU00" FT /db_xref="InterPro:IPR002293" FT /db_xref="InterPro:IPR004840" FT /db_xref="InterPro:IPR004841" FT /db_xref="UniProtKB/TrEMBL:E5AU00" FT /protein_id="CBW76574.1" FT /translation="MVVANNTETALKRGLKNRHIQLIALGGAIGTGLFLGIAQTIQMAG FT PSVLLGYALAGGIAFLIMRQLGEMVVDEPVAGSFSYFADKYCGRFAGFLSGWNYWVLYI FT LVGMAELSAVGIYIQYWWPGVPTWASALAFFVLINAINLGSVKSYGEMEFWFSIVKVAA FT IAGMIVFGAYLLLSGSAGPQASIANLWQHGGFFPNGATGLAMSMAVIMFSFGGLELVGI FT TAAEADDPHNSIPRATNQVVYRILIFYVGALAVLLSLYPWQNITSGSSPFVMIFHAMNS FT NVVATVLNVVVLTAALSVYNSGVYSNSRMLYALAQQRNAPRALGAVNRRGVPVAALAVS FT ATITGVCVVINYVIPAQALELLMGLVVSALLINWAMISIIHLRFRQHKRRTGQTSRFAS FT VGHPFTNYLCLVFLAAILIVMYRTPPLRLSVYLIPVWLAVLAVSYRFRQPSAPLTISGG FT TSKR" FT CDS 168386..168694 FT /transl_table=11 FT /locus_tag="RBRH_00492" FT /db_xref="EnsemblGenomes-Gn:RBRH_00492" FT /db_xref="EnsemblGenomes-Tr:CBW76575" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AU01" FT /protein_id="CBW76575.1" FT /translation="MRKPGIKVQILEFDCTVRQLLSVLQEQARASHLEWAKTIRLSLAQ FT TLCCRRRLEEHGVIKQYEARRAAPKIGIDVVASIHVTMERGPIRHRAPFRERIVELT" FT CDS complement(168730..169611) FT /transl_table=11 FT /locus_tag="RBRH_00493" FT /product="HYDROLASE-RELATED PROTEIN" FT /function="HYDROLASE-RELATED PROTEIN" FT /note="HYDROLASE-RELATED PROTEIN" FT /note="COG: Predicted hydrolases or acyltransferases FT (alpha/beta hydrolase superfamily)" FT /note="Pfam: alpha/beta hydrolase fold::PF00561" FT /db_xref="EnsemblGenomes-Gn:RBRH_00493" FT /db_xref="EnsemblGenomes-Tr:CBW76576" FT /db_xref="GOA:E5AU02" FT /db_xref="UniProtKB/TrEMBL:E5AU02" FT /protein_id="CBW76576.1" FT /translation="MHHCASSARAHTAKAGTPGPVTTDGGLTTLPAGATRGTLQIEYRW FT LNRTRHDAPIAVFLHEGLGSVAMWRDWPQTLCDALGWRALLYSRPGYGRSTPREPGVKW FT PVRFMHEQAHDVLPSLLDALGIDASERARMWLIGHSDGGSIALLYASAFPRALAGAVVI FT APHVRVEQLSVDSIAQMKIDYERASLRNKLARYHDDVDSAFYGWNDIWLDPAFRDWDIT FT GMLPRIQCHLLAIQGYDDKYGTMAQIDIIQHNVRHARVAKLPTCGHLPHRDAPVELNRV FT IADFIRATTFNM" FT CDS complement(169619..171283) FT /transl_table=11 FT /locus_tag="RBRH_00494" FT /product="Benzoate--CoA ligase (EC 6.2.1.25)" FT /function="Benzoate--CoA ligase (EC 6.2.1.25)" FT /EC_number="6.2.1.25" FT /note="Benzoate--CoA ligase (EC 6.2.1.25)" FT /note="COG: Acyl-coenzyme A synthetases/AMP-(fatty) acid FT ligases" FT /note="Pfam: AMP-binding enzyme::PF00501" FT /db_xref="EnsemblGenomes-Gn:RBRH_00494" FT /db_xref="EnsemblGenomes-Tr:CBW76577" FT /db_xref="GOA:E5AU03" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR011957" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AU03" FT /protein_id="CBW76577.1" FT /translation="MRVLARWRVMAPFRVIVGGKMQALMESHAGATISASSPPAQFNFA FT THLFELNRQRAQRLAYIDDAGTLTYGALQEHARRFASIMRAQGVRPEERILLVMLDTVE FT LPIAFLGALYAGVVPVIANTLLGPSEYAYMIAHSRARIVIASASLLPAVLPALDQAQAD FT SCELIVSGVDHGAMPASHHNTAPTLQHLLDTAMPTAEPIRSSRDDIAFWLYSSGSTGKL FT KGTVHTHANLYWTAELYGKSVLAINEHDVVFSAAKLFFAYGLGNALTFPLSVGATTVLM FT AERPSAKAVFARLVRHRATIFYGVPTLYASMLACARLPRREQVALRLCTSAGEALPKAV FT GERFSAHFGCEILDGIGSTEMLHIFLSNRPGDVEYGTTGTPVPGYEVELRDETGAPVAD FT GEIGDLFIKGPSAALMYWCNREKSRTTFLGDWLRSGDKFRRQPNGRYVYAGRSDDMFKV FT SGQYVSPVEVEMSLAHHEAVLEAAVVGVERDGLLKAYAFVVLKAHVSASDALADEIRAF FT AKQRLAPHKCPREIVFVDELPKTATGKIQRFKLRAQS" FT CDS complement(171338..172048) FT /transl_table=11 FT /locus_tag="RBRH_00495" FT /product="Hydroxylaminobenzoate lyase (EC 4.3.1.-)" FT /function="Hydroxylaminobenzoate lyase (EC 4.3.1.-)" FT /EC_number="4.3.1.-" FT /note="Hydroxylaminobenzoate lyase (EC 4.3.1.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00495" FT /db_xref="EnsemblGenomes-Tr:CBW76578" FT /db_xref="GOA:E5AU04" FT /db_xref="UniProtKB/TrEMBL:E5AU04" FT /protein_id="CBW76578.1" FT /translation="MAGDSGPYSMGELASRRDVSLCFIFSHFCHPVTIYALYCLTTACS FT TTNFIPIVLNDNRGQPPASHHGGIPTPLTDARNANPEAHMSPQDFHRMIARVTEPLVGR FT ELDGALADWLNTRWSPESTEYRELAQACRAGVSQGWMCNREHAGIRYGRIFKPDASIGG FT FSVDMADVAGPHHVHPHGEIDLIMPLTPNATFDGHAAGWCVYDPGSAHRPTVSNGRALV FT MYLLPYGAIEFSPA" FT CDS 171978..172940 FT /transl_table=11 FT /locus_tag="RBRH_00496" FT /product="Transcriptional regulatory protein" FT /function="Transcriptional regulatory protein" FT /note="Transcriptional regulatory protein" FT /note="COG: Shikimate kinase" FT /note="Pfam: Helix-turn-helix::PF01381
Shikimate FT kinase::PF01202" FT /db_xref="EnsemblGenomes-Gn:RBRH_00496" FT /db_xref="EnsemblGenomes-Tr:CBW76579" FT /db_xref="GOA:E5AU05" FT /db_xref="InterPro:IPR000623" FT /db_xref="InterPro:IPR001387" FT /db_xref="InterPro:IPR010982" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU05" FT /protein_id="CBW76579.1" FT /translation="MKHSDTSRRLANSPMEYGPESPANDGSLAGRDPRDPFLTAMGERV FT RLLRARRGMTRKSLAAETGLSERHLANLESGVGNASVLVLRQIALALNCPLAEVIGDET FT TSSAEWLLIRQLLHGRDPASLQRARMALADLFEQTQRDPDRNHRIALIGLRGAGKSTLG FT RMLAQERKVPFVELNRVIEQLAGCSPSEIHSLYGANAYRRYEHRALEAVIAEHPRAVIA FT TTGGLVSEPATFNMLLAHCFTVWLQANPDEHMRRVIAQGDLRPMSGSSEAMEDLKRILA FT GRGELYGRADLSFDTSDKTLADAYLQLRDRLAVRLVADN" FT CDS 172998..174731 FT /transl_table=11 FT /locus_tag="RBRH_00497" FT /product="enoyl-CoA-hydratase/isomerase" FT /function="enoyl-CoA-hydratase/isomerase" FT /note="enoyl-CoA-hydratase/isomerase" FT /note="COG: Enoyl-CoA hydratase/carnithine racemase" FT /note="Pfam: Enoyl-CoA hydratase/isomerase family::PF00378" FT /db_xref="EnsemblGenomes-Gn:RBRH_00497" FT /db_xref="EnsemblGenomes-Tr:CBW76580" FT /db_xref="GOA:E5AU06" FT /db_xref="InterPro:IPR001753" FT /db_xref="InterPro:IPR017633" FT /db_xref="UniProtKB/TrEMBL:E5AU06" FT /protein_id="CBW76580.1" FT /translation="MASSCTIFQINNRVLPCSETPMATLEPVAAPVDFRTDPSRYKHWK FT LRFDGSVATLALDVDEGGGIRSGYKLKLNSYDLGVDIELHDALQRIRFEHPEVRAVVVT FT SSKERVFSAGANIFMLGMSSHAWKVNFCKFTNETRNSIEDASRHSGLKFLAAVNGACAG FT GGYELAMACDEIWLIDDRTSSVALPEVPLLGVLPGTGGLTRLTDKRKVRHDRADLFCTV FT VEGIRGERAKQWRLVDEVVKPSQFAQAVQARALELAAQSDRPGDARGVALTPIERSTHD FT DGIVYQTLEVRLDRSVRTATLTAKAPCGPQPADLDAIVATGANWWPLRFGRELDDAILS FT LRTNEGEIGTWVLRTSGDAQAVLDVDAALMSHRDHWFVRETIGLLRRALARIDVSSRSL FT FALIESGSCFAGTLAELAFAADRSYMQALPGSLSQQPAIVLSEANFGLYPMVTQQSRLA FT RRFYGDDALLEALRDKIGIPVDPLQAERLGLVTAAPDDLDWSDEIRIALEERAAMSPDA FT LTGLEANLRFNGPETMESRIFGRLSAWQNWIFNRPNAAGDKGALKVYGEGVKPQFDVAR FT V" FT CDS 174626..176209 FT /transl_table=11 FT /locus_tag="RBRH_00498" FT /product="PHAF" FT /function="PHAF" FT /note="PHAF" FT /note="COG: Uncharacterized conserved protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00498" FT /db_xref="EnsemblGenomes-Tr:CBW76581" FT /db_xref="InterPro:IPR007814" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="InterPro:IPR017635" FT /db_xref="UniProtKB/TrEMBL:E5AU07" FT /protein_id="CBW76581.1" FT /translation="MAELDFQSPECGRRQRRVEGLWRGRQASIRCRSRLRRVAGARMQR FT FSIKESIMSSINYSDKIPNNVHLADDRMLQRALEQWQPNFLSWWNDMGPSGSQLDDVYL FT RTAVSVEPGGWAHFDYVRMPDYRWGIFLAPGEPDRKIQFGEYRGEAVWQDVPGEHRAKL FT RRIIVTQGDTEPASVEQQRHLGLTAPSLYDLRNLFQVNVEEGRHLWAMVYLLHRYFGRD FT GREEAQALLERRSGDENHPRILGAFNERTPDWLAFFMFTYFTDRDGKFQLSALAESGFD FT PLARTTRFMLTEEAHHMFVGESGVSRVIQRTAQVMNALCTDDVSALRAAGVIDLPTIQR FT YLNFHYSVTIDLFGADQSSNAATFYSLGLKGRFGESKRDDDHRLDTQRYWLLDVRDGQL FT VEREVPMLNAMNEVLRDDYIKDSIAGVNRWNKALEKAGIESRLSVPHKAFNRRIGSFAG FT VRVSPHGRVIDEAEWAANQASWLPTPEDRAFVASLMGRVVEPGRFANWIAPPAMGINRQ FT PIDFQYVRFN" FT CDS 176232..177452 FT /transl_table=11 FT /locus_tag="RBRH_00499" FT /product="Ferredoxin--NADP reductase (EC 1.18.1.2)" FT /function="Ferredoxin--NADP reductase (EC 1.18.1.2)" FT /EC_number="1.18.1.2" FT /note="Ferredoxin--NADP reductase (EC 1.18.1.2)" FT /note="COG: Sulfite reductase, alpha subunit FT (flavoprotein)" FT /note="Pfam: 4Fe-4S binding FT domain::PF00037
Oxidoreductase NAD-binding FT domain::PF00175" FT /db_xref="EnsemblGenomes-Gn:RBRH_00499" FT /db_xref="EnsemblGenomes-Tr:CBW76582" FT /db_xref="GOA:E5AU08" FT /db_xref="InterPro:IPR001433" FT /db_xref="InterPro:IPR001709" FT /db_xref="InterPro:IPR008333" FT /db_xref="InterPro:IPR015701" FT /db_xref="InterPro:IPR017634" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="InterPro:IPR017927" FT /db_xref="InterPro:IPR017938" FT /db_xref="UniProtKB/TrEMBL:E5AU08" FT /protein_id="CBW76582.1" FT /translation="MAMLNQHLIDPQVCIRCNTCEETCPNDAITHDANNYVVNAQVCNG FT CMACVPPCPTGAIDNWHQVLEADAYSIDAQLAWEELPPRQSPAQQGAGVGVASALHRPE FT HLAVSSSDVLRGASVAPGSAARPHVNLYTCDAPATAIVADNYRLTDESADSAIHHIVLD FT FGATLFPVLEGQSIGVVPPGAAPNGRPHHARQYSLANPRDGERRGYNNVSLTVKRVTCD FT HEGNPALGVCSNYLCDLRKGDRVAVIGPFGSTFLMPNHPGSHLLMICTGTGAAPMRAMT FT EYRRRHRGDGASGRLMLFFGARTPQELPYFGPLTTLPKDFIDAELAFSRMPGRPKRYVQ FT DALRERAADVGPWLADRNTHVYVCGLKGMEEGVLLALRDIAQCYGLDWQRVWADLRREG FT RLHLETY" FT CDS 177566..177922 FT /transl_table=11 FT /locus_tag="RBRH_00501" FT /db_xref="EnsemblGenomes-Gn:RBRH_00501" FT /db_xref="EnsemblGenomes-Tr:CBW76583" FT /db_xref="UniProtKB/TrEMBL:E5AU09" FT /protein_id="CBW76583.1" FT /translation="MSKQLPAQAGQADPFDRAYQRPPRFIDRFDHRALSAGFGDDAHDP FT LSIAHQRADGGTFDVLSSFDGLGHTGEDASRQTRPGLSHEGGRTLSPAAAAASIRTAGW FT CAHARTSDCSSRWP" FT CDS 177913..178215 FT /transl_table=11 FT /locus_tag="RBRH_00502" FT /product="Branched-chain amino acid transport ATP-binding FT protein livG" FT /function="Branched-chain amino acid transport ATP-binding FT protein livG" FT /note="Branched-chain amino acid transport ATP-binding FT protein livG" FT /db_xref="EnsemblGenomes-Gn:RBRH_00502" FT /db_xref="EnsemblGenomes-Tr:CBW76584" FT /db_xref="GOA:E5AU10" FT /db_xref="UniProtKB/TrEMBL:E5AU10" FT /protein_id="CBW76584.1" FT /translation="MAVIENLLAAQHRLTQSGLLRGLLATPVYRRVERDALKRAARWLE FT RMVLDLRYHSRDSRRGRDGVSGRAEREQRTAGGRSRLRSGNRPRGAGRYRREFAG" FT CDS 178097..178249 FT /transl_table=11 FT /locus_tag="RBRH_00503" FT /product="Branched-chain amino acid transport ATP-binding FT protein livF" FT /function="Branched-chain amino acid transport ATP-binding FT protein livF" FT /note="Branched-chain amino acid transport ATP-binding FT protein livF" FT /note="COG: ABC-type branched-chain amino acid transport FT systems, ATPase component" FT /db_xref="EnsemblGenomes-Gn:RBRH_00503" FT /db_xref="EnsemblGenomes-Tr:CBW76585" FT /db_xref="GOA:E5AU11" FT /db_xref="UniProtKB/TrEMBL:E5AU11" FT /protein_id="CBW76585.1" FT /translation="MTVFLVEQNANNALQVADRGSVVETGRVVLADTDANLLVNERVKS FT AYLGG" FT CDS complement(178316..178903) FT /transl_table=11 FT /locus_tag="RBRH_00504" FT /product="Regulator of nucleoside diphosphate kinase" FT /function="Regulator of nucleoside diphosphate kinase" FT /note="Regulator of nucleoside diphosphate kinase" FT /note="COG: Transcription elongation factor" FT /db_xref="EnsemblGenomes-Gn:RBRH_00504" FT /db_xref="EnsemblGenomes-Tr:CBW76586" FT /db_xref="GOA:E5AU12" FT /db_xref="InterPro:IPR001437" FT /db_xref="UniProtKB/TrEMBL:E5AU12" FT /protein_id="CBW76586.1" FT /translation="MRRQRRARSERTDLVSTCSDTSPRHRFHWPGTRTKRPLVSAAAWA FT GTGRTQPFDFSLRWRNKMKTCYLTETDVSRLERHAAQASPQSGYQTMLDALLERAAVVE FT ATDIDPSVVTMNSTVTLSNPSSGERMTWTVVYPPNADFSQGRLNVFSPVGLALLGATPG FT DELRVTPPSGAPQTLKVEQIVFQPEAAGDYRL" FT CDS complement(179363..180127) FT /transl_table=11 FT /locus_tag="RBRH_00506" FT /product="Fic family protein" FT /function="Fic family protein" FT /note="Fic family protein" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: Fic protein family::PF02661" FT /db_xref="EnsemblGenomes-Gn:RBRH_00506" FT /db_xref="EnsemblGenomes-Tr:CBW76587" FT /db_xref="InterPro:IPR003812" FT /db_xref="UniProtKB/TrEMBL:E5AU13" FT /protein_id="CBW76587.1" FT /translation="MDSSLQPMLEAVDADKAKLDAARPLPPHTVASLREKLMLEWTYHS FT NAIEGNTLTLRETKVVLEGITVGGKSLREHFEATNHRDAILYVEEIVAKNETLSEWQIR FT NLHSLVLKGIDDKEAGQYHHENVVIAGASTTPPDFLHLPAEMAALIDWHAQAQTVHPVT FT RAAELHTRFVKIHPFVDSNGRTGRLLLNFELMKFGYPPAVIRKEDRLAYYDSLDEACVT FT GDYSGITQLVAASVQRALGTYLDVLGLREDHR" FT CDS complement(180148..180258) FT /transl_table=11 FT /locus_tag="RBRH_04232" FT /db_xref="EnsemblGenomes-Gn:RBRH_04232" FT /db_xref="EnsemblGenomes-Tr:CBW76588" FT /db_xref="UniProtKB/TrEMBL:E5AU14" FT /protein_id="CBW76588.1" FT /translation="MYLAQQVNTTYRDERFIYADFSDAPSGKILRVGVVG" FT CDS 180285..180587 FT /transl_table=11 FT /locus_tag="RBRH_00507" FT /product="DNA-damage-inducible protein J" FT /function="DNA-damage-inducible protein J" FT /note="DNA-damage-inducible protein J" FT /note="Pfam: RelB antitoxin::PF04221" FT /db_xref="EnsemblGenomes-Gn:RBRH_00507" FT /db_xref="EnsemblGenomes-Tr:CBW76589" FT /db_xref="GOA:E5AU15" FT /db_xref="InterPro:IPR007337" FT /db_xref="InterPro:IPR026262" FT /db_xref="UniProtKB/TrEMBL:E5AU15" FT /protein_id="CBW76589.1" FT /translation="MAATTMVHIRIDEALKAQAAQTLASMGLTVSDAIRVFLTRVVADK FT VLPFATEAPNAASCAALVRRGHLACDDREAAPLFLGAPFPRPRSTQECWSETRCL" FT CDS complement(180652..180885) FT /transl_table=11 FT /locus_tag="RBRH_00508" FT /product="Methyl-accepting chemotaxis protein" FT /function="Methyl-accepting chemotaxis protein" FT /note="Methyl-accepting chemotaxis protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00508" FT /db_xref="EnsemblGenomes-Tr:CBW76590" FT /db_xref="UniProtKB/TrEMBL:E5AU16" FT /protein_id="CBW76590.1" FT /translation="MYGAIITAIARIRLWAAHSCHQRLPRAEQQAASLQETVPSMEALT FT TPVKRNAQNVQQASPQAANASEVAHEASAVVS" FT CDS complement(181220..181351) FT /transl_table=11 FT /locus_tag="RBRH_00509" FT /db_xref="EnsemblGenomes-Gn:RBRH_00509" FT /db_xref="EnsemblGenomes-Tr:CBW76591" FT /db_xref="UniProtKB/TrEMBL:E5AU17" FT /protein_id="CBW76591.1" FT /translation="MKRRIFFTPRLSAPPIIAMTGVRALDYAFAIARCRSCYCGIAH" FT CDS complement(181348..182034) FT /transl_table=11 FT /locus_tag="RBRH_00510" FT /note="COG: DnaJ-class molecular chaperone" FT /note="Pfam: DnaJ domain::PF00226" FT /db_xref="EnsemblGenomes-Gn:RBRH_00510" FT /db_xref="EnsemblGenomes-Tr:CBW76592" FT /db_xref="InterPro:IPR001623" FT /db_xref="InterPro:IPR018253" FT /db_xref="UniProtKB/TrEMBL:E5AU18" FT /protein_id="CBW76592.1" FT /translation="MPIKNAAMKTLYDILGVTPHATPTELKAAWRRAAMKWHPDRNRGR FT EHYAQAQFQRINDAYAALTNPLRRAQYDLALHASVRRIAPQSHGRHRRTSRWRWSKWMR FT LFLRNARRVPHARRAARDVSRSHWMAGIGTAIAAVALIADLSIDDAPLRSNFVSTTGAA FT AATSEADPALEEMHTALAQLRALARTARDDTAPAGHDRHPRGSINEAHRRGIICGPGDR FT TRTGKP" FT CDS 182823..184580 FT /transl_table=11 FT /locus_tag="RBRH_00511" FT /product="Transcriptional regulator" FT /function="Transcriptional regulator" FT /note="Transcriptional regulator" FT /note="COG: Response regulator containing CheY-like FT receiver, AAA-type ATPase, and DNA-binding domains" FT /note="Pfam: Bacterial regulatory protein, Fis FT family::PF02954
Sigma-54 interaction domain::PF00158" FT /db_xref="EnsemblGenomes-Gn:RBRH_00511" FT /db_xref="EnsemblGenomes-Tr:CBW76593" FT /db_xref="GOA:E5AU19" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR002197" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR025943" FT /db_xref="InterPro:IPR025944" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU19" FT /protein_id="CBW76593.1" FT /translation="MNSGHRRQLVYVTRSADRALQRLLTRHGWSVATCDTARQAERLVN FT TTGARVGIFDVSSGFDEAIAQFEPVLLRPDMMWVATPTAAQLAAAHVRRCVRSHCFDFV FT AMPGPAQLVVDVVARAYQMAELDAGGDAPRAQGEMIGACEAMQQLFRVIGKVANTDAPV FT LIFGESGTGKELTAKSIHDQSIRATGPFVAINCGAIPPHLLQSELFGYERGAFTGANQR FT KIGYVEAANGGTLFLDEIGDLPLESQAGLLRFLQERTIQRLGGHDAISVDVRIISATHV FT DLEAAVSAGRFRSDLYHRLCVLRLEEPPLRGRGRDIELLAQRMFERYRGDSPRHIRGFS FT AAALNAMYRYSWPGNVRELINRVRRAIVMAEGRVITPEDLELEDVLEQQAPTLALAREN FT AERRAIEGALARHRNRLAGAAQELGVSRATLYRLMLSHGMRTRQGQDDTRPKPSRAVSL FT TRATGRGLAADARARLARAAPDDAPHSAHPPARTSGDTACADDAVVCDFDPHRSCSSTT FT ARADATSLHAHRRNPWLPGSPHAGADTLPDPDERSWHCVFDLAGSGRRTMLDETLNDIV FT KDLRLLQRN" FT CDS 184774..185025 FT /transl_table=11 FT /locus_tag="RBRH_00513" FT /product="Acyl carrier protein" FT /function="Acyl carrier protein" FT /note="Acyl carrier protein" FT /note="COG: Acyl carrier protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00513" FT /db_xref="EnsemblGenomes-Tr:CBW76594" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="UniProtKB/TrEMBL:E5AU20" FT /protein_id="CBW76594.1" FT /translation="MNSKLREILAQWADLDVPIASLPDDASLYDAGMSSLATVKILMAI FT ENAFNVEIPDEWLTRELFTSVASLSQAIKQLQSDEAAA" FT CDS 185022..186266 FT /transl_table=11 FT /locus_tag="RBRH_00514" FT /product="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /function="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /EC_number="1.3.99.2" FT /note="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /note="COG: Acyl-CoA dehydrogenases" FT /db_xref="EnsemblGenomes-Gn:RBRH_00514" FT /db_xref="EnsemblGenomes-Tr:CBW76595" FT /db_xref="GOA:E5AU21" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR013107" FT /db_xref="InterPro:IPR013786" FT /db_xref="UniProtKB/TrEMBL:E5AU21" FT /protein_id="CBW76595.1" FT /translation="MMVAPGRQKAVAIARGPTRAMPAKVGGVARTSSRRWSGPAEHAHL FT QPLLYIVSEHATDVDRDARFPTEALGALREAGLMSSLVPASLGGAATSLKTVAGICEAL FT ARACASSAMMFAMHQASVAWLVLHHEAHEASRALLQRLCAEQMLFGIAGMADATPVAGT FT ASGPRPALLQHHAEQFTLVIDGTTIPYGAYADALLLPAGENGFIAVSKEQYKLERRESW FT DALGMRGLCSDEFRVVVTGESSQILHTARHGAGNLHAIVQLLHSAVWVGIATSALERAQ FT AYSRGRGESAHVLMPGAARLAEANALLQMMRAHLGSALKQASSGPGGLPPRDGAFVDEM FT QVLRTGVSRSALALVNHAMMVCGIDGYRNDTDVSVARHLRDLYAAPLGLGSPCHAAMPP FT TPASDVTPSSDILPE" FT CDS 186275..186469 FT /transl_table=11 FT /locus_tag="RBRH_00515" FT /db_xref="EnsemblGenomes-Gn:RBRH_00515" FT /db_xref="EnsemblGenomes-Tr:CBW76596" FT /db_xref="UniProtKB/TrEMBL:E5AU22" FT /protein_id="CBW76596.1" FT /translation="MLCAHRRAHGSRVSNCKFDVDGVTSTQWMPIERVASRPLSVTITQ FT IRGLQFLYFVKLIKININQ" FT CDS 186489..186647 FT /transl_table=11 FT /locus_tag="RBRH_04233" FT /db_xref="EnsemblGenomes-Gn:RBRH_04233" FT /db_xref="EnsemblGenomes-Tr:CBW76597" FT /db_xref="UniProtKB/TrEMBL:E5AU23" FT /protein_id="CBW76597.1" FT /translation="MPNIDWHRLGNSNLKQFCAFNHTAFRASIRCLGGVFGYAERVLTR FT AQKSDKR" FT CDS 186684..186791 FT /transl_table=11 FT /locus_tag="RBRH_04234" FT /db_xref="EnsemblGenomes-Gn:RBRH_04234" FT /db_xref="EnsemblGenomes-Tr:CBW76598" FT /db_xref="UniProtKB/TrEMBL:E5AU25" FT /protein_id="CBW76598.1" FT /translation="MQHRVCLAAASLFINATLLGGAAVSRLCALRADLY" FT CDS complement(186903..187007) FT /transl_table=11 FT /locus_tag="RBRH_00516" FT /db_xref="EnsemblGenomes-Gn:RBRH_00516" FT /db_xref="EnsemblGenomes-Tr:CBW76599" FT /db_xref="UniProtKB/TrEMBL:E5AU24" FT /protein_id="CBW76599.1" FT /translation="MVFRFGYAAQTQRGVRRISLITIQEQLQPLQSLP" FT CDS 187009..187818 FT /transl_table=11 FT /locus_tag="RBRH_00517" FT /product="Transcription regulator, crp family" FT /function="Transcription regulator, crp family" FT /note="Transcription regulator, crp family" FT /note="COG: cAMP-binding proteins - catabolite gene FT activator and regulatory subunit of cAMP-dependent protein FT kinases" FT /db_xref="EnsemblGenomes-Gn:RBRH_00517" FT /db_xref="EnsemblGenomes-Tr:CBW76600" FT /db_xref="GOA:E5AU26" FT /db_xref="InterPro:IPR000595" FT /db_xref="InterPro:IPR001808" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR012318" FT /db_xref="InterPro:IPR014710" FT /db_xref="InterPro:IPR018490" FT /db_xref="UniProtKB/TrEMBL:E5AU26" FT /protein_id="CBW76600.1" FT /translation="MLYPRDDLHANHLLGALSEEDWRSLEPHLELVRVKSPQLLCDADE FT PIRHMYFPTTAVMSMLYLMEDGATVEVAAIGNEGVVGVPVLTGGGTMPSRVEVRSSGFA FT YRVPASVFRKEFEKSMGIHRLMLLYIQALMTQIAQSALCNRHHSVNEQLCRWLLLAHDR FT LATDELAVTQQMIANMLGVRREGVTEAAGKLQEAGLIRQRRGHITVLDRHGLEARACEC FT YSMIRREFDRLLPRAADVVALERSRTIAPAEGRALRTLGYVRVLQPA" FT CDS 187842..188276 FT /transl_table=11 FT /locus_tag="RBRH_04235" FT /product="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /function="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /EC_number="2.7.8.-" FT /note="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_04235" FT /db_xref="EnsemblGenomes-Tr:CBW76601" FT /db_xref="GOA:E5AU27" FT /db_xref="UniProtKB/TrEMBL:E5AU27" FT /protein_id="CBW76601.1" FT /translation="MLGIVARLSDVLLVAAGAWLAHALRYNGSFDLTDAERSLVALSCA FT LTLLVFPPLGIYRSWRGQTLHRLLSRVTLAWFAVVVLGLCFIFTLHRSNDISRLWLGTA FT VLTCGALLLAGKLFIHAVLRKVRQSGKNHTLGDHRRYRKL" FT CDS 188200..189219 FT /transl_table=11 FT /locus_tag="RBRH_00518" FT /product="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /function="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /EC_number="2.7.8.-" FT /note="Undecaprenyl-phosphate FT beta-glucosephosphotransferase (EC 2.7.8.-)" FT /note="COG: Sugar transferases involved in FT lipopolysaccharide synthesis" FT /note="Pfam: Bacterial sugar transferase::PF02397" FT /db_xref="EnsemblGenomes-Gn:RBRH_00518" FT /db_xref="EnsemblGenomes-Tr:CBW76602" FT /db_xref="GOA:E5AU28" FT /db_xref="InterPro:IPR003362" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR017473" FT /db_xref="InterPro:IPR017475" FT /db_xref="UniProtKB/TrEMBL:E5AU28" FT /protein_id="CBW76602.1" FT /translation="MRYCARSGKAERTTHSVIIVGTESYSRAVLDQMHAASEAGFRPVY FT VFDDSGTVPSACIGGVPVLTDFAQLARIVRAGGIDEMWLALPLSHERVIQRIVREFRHD FT FVNLRFLPDVRSMTLFSQSVTEVLGMPAINLAASPVSDPQLWPKRVFDRLFALAVLVPL FT SPLFIVLGIAVKLSSPGPVLFKQKRKGVDGQEFEIFKFRTMRVHQEQHGVVRQASRHDT FT RITKVGAFLRRTSLDELPQFLNVLLGQMSVVGPRPHAIEHDDLYKDLIDGYMYRYRIRP FT GITGWAQVNGYRGETRKVEKMEARVKFDLFYIQNWTFWFDIKIILITLVKGFVGRNAF" FT CDS 189216..190646 FT /transl_table=11 FT /locus_tag="RBRH_00520" FT /product="Putative capsule polysaccharide export protein FT precursor" FT /function="Putative capsule polysaccharide export protein FT precursor" FT /note="Putative capsule polysaccharide export protein FT precursor" FT /note="COG: Periplasmic protein involved in polysaccharide FT export" FT /note="Pfam: Polysaccharide biosynthesis/export FT protein::PF02563" FT /db_xref="EnsemblGenomes-Gn:RBRH_00520" FT /db_xref="EnsemblGenomes-Tr:CBW76603" FT /db_xref="GOA:E5AU29" FT /db_xref="InterPro:IPR003715" FT /db_xref="InterPro:IPR019554" FT /db_xref="UniProtKB/TrEMBL:E5AU29" FT /protein_id="CBW76603.1" FT /translation="MSRTDRCAARRPGGPTHCCWIKWKENLRPRPYAAHVARLLQPAAQ FT KGETKMLKCPMWMTVAMTVALSGCALAPGPTLDSSRMHDDLSKPTDTTTYDVNLITPEL FT VFKLKESDAADARAREASLHAMPANEVSDYRVGVNDVLGITVWGHLELTQGGNAATAPL FT PDTGTLQGMGSLGAGQQQPQSAFSTNGPGELDAQGQRVAADGTIFFPSLGRVRVLGQST FT VQISRLLYNRLKGRLKDPQIDVRVIQYRSQQVQVTGGVKNPGQLSLTGSPMRVIDAINR FT AGGGNPDADLQRVLVSRGGKVITIDATRILNRGDMRQNIVLQNGDIVNVPDRTQNRVFV FT MGEVPKPQTVFMNQGQLTLADALTAAGSIDPAGANPRQIIVIRHPNPPLTQISNGQDGL FT EEGFKKASYAPADNKPEIFRLDMTQVDAMMLATEFDMKPLDVVYVGTAPAARFNRLLAQ FT ILPSAESFYLVWSVAHNR" FT CDS 190716..193052 FT /transl_table=11 FT /locus_tag="RBRH_00521" FT /product="Chain length regulator (capsular polysaccharide FT biosynthesis) / Tyrosine-protein kinase (capsular FT polysaccharide biosynthesis)" FT /function="Chain length regulator (capsular polysaccharide FT biosynthesis) / Tyrosine-protein kinase (capsular FT polysaccharide biosynthesis)" FT /note="Chain length regulator (capsular polysaccharide FT biosynthesis) / Tyrosine-protein kinase (capsular FT polysaccharide biosynthesis)" FT /note="COG: Uncharacterized protein involved in FT exopolysaccharide biosynthesis" FT /note="Pfam: Chain length determinant protein::PF02706" FT /db_xref="EnsemblGenomes-Gn:RBRH_00521" FT /db_xref="EnsemblGenomes-Tr:CBW76604" FT /db_xref="GOA:E5AU30" FT /db_xref="InterPro:IPR003856" FT /db_xref="InterPro:IPR005702" FT /db_xref="InterPro:IPR025669" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU30" FT /protein_id="CBW76604.1" FT /translation="MEARHIDMGYLPSSGASEGLVPRDLVRVITDNLWAVVGIAAVITA FT LASAYAFLATPLYSADTLVQVEVPKQNELADLVTKQPSQNNSSPNEPPTQTEMAIVTSR FT AVLAPVIAQYKLDVLVTPHRFPVLGKIADALATRGEPSRAWFGLSKYAWGGELVDIAQL FT NVPRELQDKKLELKVLGARRYQLLDEQGNLLVEGVEGQLAQAGPVSMLVERLAARDGET FT FIVERLNEVTAVRRFINQLKVVQVGKETGIVQISYENDDPALATAVANAVTQNYIGSRV FT TQTQEEASKMLAFINNELPRLRDDLKQAEAQLQSHRVASGSMQATTESQSYLQGSIEFD FT RQIAALNLQRTQLLDRFTPQSPEVKTVDAQLAQLRAAKGKFESRFDSLPSADRQSADLA FT RDAKVAEEIYVAMVNKAHELSVSRAGTVGNVHVIDTAVQPSTPVKPRRALIISAAIVLG FT LMLGVLYVISRRYLSQSVSEPEQLESKLRLPVFGAVLFSDEQVRLARTPPLPVLPGARE FT PSLHGDARGAMALVASPDAVADGYQPRPHAGRLLAATRPHDVATEALRGIRTMLNSKLL FT SATNRIVMVTGATPGTGKSFISANLALLYAQAGKRVLLVDADLRRGRLGMHFGLVADTV FT GLAELLGDGLAPEQAIHPTSVANLSLLPAGAXPGNPSELLAMERMAEQLTQFNERYDLV FT LVDTPPVLAVADASIVAGYAGATVLVMRENAQTELEVQETLKRLGRAGAQIAGAIFNGM FT SARRSDRRSYEYIYAYTREGDASAA" FT CDS 192967..194199 FT /transl_table=11 FT /locus_tag="RBRH_00522" FT /product="Mannosyltransferase (EC 2.4.1.-)" FT /function="Mannosyltransferase (EC 2.4.1.-)" FT /EC_number="2.4.1.-" FT /note="Mannosyltransferase (EC 2.4.1.-)" FT /note="COG: Glycosyltransferase" FT /note="Pfam: Glycosyl transferases group 1::PF00534" FT /db_xref="EnsemblGenomes-Gn:RBRH_00522" FT /db_xref="EnsemblGenomes-Tr:CBW76605" FT /db_xref="GOA:E5AU31" FT /db_xref="InterPro:IPR001296" FT /db_xref="UniProtKB/TrEMBL:E5AU31" FT /protein_id="CBW76605.1" FT /translation="MGCRRAAATAAVTSTSTLIRGKAMRRQPERECSHGGAALDGERSH FT AVLLPAPLTINGKFTSQRLTGVQRVARELTAALSQQCGTLAASPLLLVPRDHIDSELPA FT ATPRHVVPYLRGMLWEQLALPFAAGSRTLLSLCNIGPLFKRRQVLMIHDAAVFDLPQGY FT STQFRLWYRFAFALLKRNVQHILTVSSFSKGRIAARLGVPPERISVIPPGVDHFDRLES FT DYAVLQRLSLSFDRFVLIVGSLAPGKNLARTLEAIALLEREHPGLTFVIAGGQNVKVFG FT SSLPRAASAAKHIVWAGYVSDGELKALYENAACFVFPSLYEGFGLPPLEAMYCGCPVIA FT SREASLPEVCGDAALYCDAHDAADIAAKIVELMGDVEQRRAMREKGRAHAQQYRWDTSA FT SRLLQVLRQFG" FT CDS complement(194381..196444) FT /transl_table=11 FT /locus_tag="RBRH_00523" FT /product="Acetoin catabolism regulatory protein" FT /function="Acetoin catabolism regulatory protein" FT /note="Acetoin catabolism regulatory protein" FT /note="COG: Transcriptional activator of acetoin/glycerol FT metabolism" FT /note="Pfam: GAF domain::PF01590
Bacterial regulatory FT protein, Fis family::PF02954
Sigma-54 interaction FT domain::PF00158" FT /db_xref="EnsemblGenomes-Gn:RBRH_00523" FT /db_xref="EnsemblGenomes-Tr:CBW76606" FT /db_xref="GOA:E5AU32" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR002197" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR025662" FT /db_xref="InterPro:IPR025943" FT /db_xref="InterPro:IPR025944" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU32" FT /protein_id="CBW76606.1" FT /translation="MARDPKTAHVDRVIDAVRNGTSDSPDTSPRLLSSWHRSLQLYGID FT PTSPVSPRILTAYELKQIQQQEEDFLLASGQYLSRLHDTLRSAGYCVLLANAQGVTVDY FT RVDPHLRRQYKEVGLYIGSCWSEREQGTCGIGSALAECTPMTVHKVDHFRSLFTTLTCT FT AAPILAPDGKLIGVVDASALQSPDSADSQSIVHQLVRHTAQLIEDGYFVKQTTQYWLLF FT GHGNPHFVEVNPEVLIAFDERGAIVAANREAKQRFPILASGAPAHLSMLFDVRDADLFS FT IDGLQRMTALRSHATSDMLYARIRAPQAGMSPWQPSPLTLPASPRAADDTSVRSAPPSM FT RVFLDSRDPVIARNARIALRLSGEHLPILILGETGAGKEMFAKAIHASGERSKQPFIAV FT NCGAIPESLIESELFGYAPGAFTGARSKGARGRIAQADGGTLFLDEIGDMPIDLQTRLL FT RVLAEGEVLPLGADTPVQVDLSVICATHRDLDAMVASGQFREDLYYRLSGVVLTMPALR FT DRADIEDVIVAVFQDEARRVPRALTLDSTLLARLARHPWPGNVRQLRNVLRYACLLCDT FT QLITAAHLPADVRTQLDTLAQSPHPHPHPHPHPPHASVAWHATNGDATGERFGNTHAYD FT MLAIERSRILDALAEHRWHATRAARALGMSRATLYRRLAKLGIARPRFGEAG" FT CDS complement(196466..196645) FT /transl_table=11 FT /locus_tag="RBRH_00524" FT /db_xref="EnsemblGenomes-Gn:RBRH_00524" FT /db_xref="EnsemblGenomes-Tr:CBW76607" FT /db_xref="UniProtKB/TrEMBL:E5AU33" FT /protein_id="CBW76607.1" FT /translation="MPDAHASDRQPRLTGPARRFMGLAHSVSRIDTLIHSQMKDGWQDI FT GLECLRDTKEQSGA" FT CDS 196885..197763 FT /transl_table=11 FT /locus_tag="RBRH_00525" FT /product="Transcriptional regulatory protein" FT /function="Transcriptional regulatory protein" FT /note="Transcriptional regulatory protein" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /note="Pfam: Transcriptional regulatory protein, C FT terminal::PF00486" FT /db_xref="EnsemblGenomes-Gn:RBRH_00525" FT /db_xref="EnsemblGenomes-Tr:CBW76608" FT /db_xref="GOA:E5AU34" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:E5AU34" FT /protein_id="CBW76608.1" FT /translation="MWFSATWVDVNILWTAMFCVTDRNSDLLQSPRAGQRGVLANATCL FT LDEGAAGLTVAVLVQDVGLHARVRAVLQEYGIACRQFGDDISLVRAVSRHAFSAVLLDA FT TAGVDPLQPILARRLCYRALLMPVILIGVAGDVANSTALFESGADDVVLAPVNARDLMI FT RLQLAILRHRRDARARDAREPVLQRGEYRLDRGACTVLLRDRQVRLTPREFEVAWILFS FT NEGEYVSRAHIARTVWAGSDKRVDGALDQHIYKLRKKLALNGENGWAIQPLYGHGYRVI FT ALNATGPRQAA" FT CDS complement(197794..198213) FT /transl_table=11 FT /locus_tag="RBRH_04236" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: Protein of unknown function FT (DUF1458)::PF07311" FT /db_xref="EnsemblGenomes-Gn:RBRH_04236" FT /db_xref="EnsemblGenomes-Tr:CBW76609" FT /db_xref="InterPro:IPR009923" FT /db_xref="InterPro:IPR025543" FT /db_xref="UniProtKB/TrEMBL:E5AU35" FT /protein_id="CBW76609.1" FT /translation="MPCRAASYPAMPYRILPCLAVLCRTLPCLIGAPPYHPRGAGGGWH FT TPCYEHTRLNATTRRQRCPPCREKAMSDHVYKQIELTGSSTQSIQHAIENAIEKASRTL FT RNLHWFEVTDTRGHIESGKVIHWQVSLKVGLRIED" FT CDS complement(198279..199874) FT /transl_table=11 FT /locus_tag="RBRH_00527" FT /product="Type I secretion outer membrane protein" FT /function="Type I secretion outer membrane protein" FT /note="Type I secretion outer membrane protein" FT /note="COG: Outer membrane protein" FT /note="Pfam: Outer membrane efflux protein::PF02321" FT /db_xref="EnsemblGenomes-Gn:RBRH_00527" FT /db_xref="EnsemblGenomes-Tr:CBW76610" FT /db_xref="GOA:E5AU36" FT /db_xref="InterPro:IPR003423" FT /db_xref="InterPro:IPR010131" FT /db_xref="UniProtKB/TrEMBL:E5AU36" FT /protein_id="CBW76610.1" FT /translation="MMRRFPRVLLSPMSTPEPVPSLFFMSRRWPGLRASPTCRIHPCRV FT VNRRAALATTACVAAACATLLGGCAFAPSERPAPPAPPHYAAQPGAAQSVTAAGVAQRF FT ALGARAVPRWWMLYQSDALNAWVDEGLRNNATLAAAEKTLAAAREQLHAQIGESMLPSI FT DAGGQVQRQRALGMPIQGPPTLRYNTFVGQIRANYTIDLFGAARLANQAVSRRVDVQSY FT QFDAARRTLAANIVSAALAAASLHEQWDAQARIAALAAAEADDTDKRVALGAASQVDAL FT NARQSAQAAAAAVPPLRAQWLAARHALAVLMGRTPDAAPEDLPLDRLTLPDTVPVSLPS FT TLLHERPDVLAADAAVQAAAAEVGVATAQMFPSLTLSASWGQGGLSWPLATRAAGRLWN FT LGAGLTQPLFHGSALRAQRRAALHAYDAALDQYRQTVLNAFRDVADTLVALEQDARTQA FT AALAAQQAAEQATQVARQRYESGALPISAVRASEQQTQSTRIHAVRARAARLANTASLF FT QAMGSPAVDTSAQR" FT CDS complement(199871..203083) FT /transl_table=11 FT /locus_tag="RBRH_00528" FT /product="Acriflavin resistance plasma membrane protein" FT /function="Acriflavin resistance plasma membrane protein" FT /note="Acriflavin resistance plasma membrane protein" FT /note="COG: Cation/multidrug efflux pump" FT /note="Pfam: AcrB/AcrD/AcrF family::PF00873" FT /db_xref="EnsemblGenomes-Gn:RBRH_00528" FT /db_xref="EnsemblGenomes-Tr:CBW76611" FT /db_xref="GOA:E5AU37" FT /db_xref="InterPro:IPR001036" FT /db_xref="InterPro:IPR027463" FT /db_xref="UniProtKB/TrEMBL:E5AU37" FT /protein_id="CBW76611.1" FT /translation="MTGAPYKPPGHSHDEGRFNLSAWTLRHQALVVFVLVLVTLAGILS FT YRNLSQSEDPPFTFKVMVIQTRWPGADAQQVQQHITDRLARKLQETPKIDFLRSYSRPG FT ESLLFFTIKDSAPASTVPDTWYQVRKKISDIAPTLPPGVQGPFFNDEFGDVYTNIYALE FT GDGFSAAQLHDYADQLRGELLRVPGVAKVDYFGDPNQHIYIEISNAQLSRLGISPQQLA FT HAIDTQNAVAAAGVLTTADDRVFVRPSGQYNHVDALADTLVRINNHSFRLGDIATIRRG FT YDDPPVTQMRFNGRPVLGIGVTMQPDGDVIKLGKALDARVQQLRTQLPAGLALTEVSSM FT PHAVSHSVDDFMEAVAEAVGIVLVVSLVSLGLRTGMVVVISIPIVLAVTALVMGVFNIG FT LHKVSLGTLVLALGLLVDDAIIAVEMMAVKLEQGWSRAKAAAFAYTSTAFPMLTGTLVT FT VSGFLPIALAKSATGEYTRSIFEVSAIALLLSWLAAVIVIPLLGYHLLPERKRPAVPEA FT RRHADEREQKPVYGHKQRNGHEQEQEQEHEHDIYDTPFYARLRVWITWCVKRRFAVLVV FT TFVLFVVALGGFGLVAQQFFPSSERPELLIDVRLTESASFDATLRETQRIEALLKGRPE FT IDHAVSFVGSGAPRFYLPLDQQLQLPNFAQFVVTAKSVKDRDTLARFLDDKLTTDFSGV FT RTRLSRLENGPPIGYPVQFRVSGDDIATVRSIATQVASVMQDDARTRNVQFDWDEPGQR FT SVHWVVDQAKARELGVSSQDIASFLQMSLSGYTVTQYRERDKLIGVDLRAPHNERVDPS FT ALASLAMPTPSGPVPLGTLGQLSYGLEYAVIWERDRQPTITVQSDVRGGAQGIDVTKSI FT DKALAGLRAKLPIGYRIEVGGSVEENAKAQASINAQLPLMIIAVLTLLMIQLQSFSRVM FT MVVLTAPLGLIGVVAALLAFGQPFGFVALLGVIAMFGIIMRNSVILVDQIEQDIAAGHG FT RLAAIVGATVRRFRPITLTAAAAVLALIPLLRSNFFGPMATALMGGITSATILTLFYLP FT ALYATWFRVRNDETQPPPQEAR" FT CDS complement(203080..204354) FT /transl_table=11 FT /locus_tag="RBRH_00529" FT /product="Acriflavin resistance periplasmic protein" FT /function="Acriflavin resistance periplasmic protein" FT /note="Acriflavin resistance periplasmic protein" FT /note="COG: Membrane-fusion protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00529" FT /db_xref="EnsemblGenomes-Tr:CBW76612" FT /db_xref="GOA:E5AU38" FT /db_xref="InterPro:IPR006143" FT /db_xref="UniProtKB/TrEMBL:E5AU38" FT /protein_id="CBW76612.1" FT /translation="MSGRRIGSLRPSPLAGVAVKALVLPSASRRRPRLAPCGTAIASVL FT SALVLLNACRDRAAPAAPARPVVAATVHSATAGAMAATTVPGEVAARFSTPLSFRVGGK FT LIERRVHLGDAVHAGQIVAQLDPADARKNAASAAAQLRAAEHRLLFARQQLERDRAQAQ FT SNLISKLQLEQTEDNHAAALAQRDVAAQQAALAKDQLGYTTLVADHEGVITQELADTGQ FT NLSAGQAVYQLAWSGARDVICDLPERTLAFIGLGAKASVTLAALPGQAFTATLRELAPC FT ADPASRTYRAKLTLELPHGGADTVRLGMTARVAFQPDATRAALNHDIVLPATALFHQNE FT RPAVWVIRANAASRDAGQPRDAHKQDVGTLELRPVTVSHYTERSVVVSAGLTDGERVVL FT RGVHTVSAGEQVKPVAPLHPEDFAL" FT CDS 204471..205121 FT /transl_table=11 FT /locus_tag="RBRH_00532" FT /product="Transcriptional regulator, TetR family" FT /function="Transcriptional regulator, TetR family" FT /note="Transcriptional regulator, TetR family" FT /note="Pfam: Bacterial regulatory proteins, tetR FT family::PF00440" FT /db_xref="EnsemblGenomes-Gn:RBRH_00532" FT /db_xref="EnsemblGenomes-Tr:CBW76613" FT /db_xref="GOA:E5AU39" FT /db_xref="InterPro:IPR001647" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011075" FT /db_xref="InterPro:IPR015893" FT /db_xref="UniProtKB/TrEMBL:E5AU39" FT /protein_id="CBW76613.1" FT /translation="MSMFRARPRPRTRLTREQSREQTRQRLMDAAQTLFIKKGFDASSV FT EDVAAAAGYTRGAFYSNFKDKAELLLAVLERNHGDIQQKLQRIFDLQSSAQDIEARILT FT YYSTLYRENKCFLVWMQARLLATRDAKFRARLNALSQQTRSDIAHFIDALCARRRIRSV FT VSAAQLALGLVALCDGIQFFHASDPHVTDEMTEKVLAAFFSAAVFGHRAAGPR" FT CDS complement(205145..205363) FT /transl_table=11 FT /locus_tag="RBRH_00533" FT /db_xref="EnsemblGenomes-Gn:RBRH_00533" FT /db_xref="EnsemblGenomes-Tr:CBW76614" FT /db_xref="InterPro:IPR021527" FT /db_xref="UniProtKB/TrEMBL:E5AU40" FT /protein_id="CBW76614.1" FT /translation="MSTTDPIDQQISQTLRNVRYPATRDTLVAAACSAGASNDVLLALQ FT ALPERDYPDPQSVARWIGSAAGPGLSA" FT CDS complement(205367..205516) FT /transl_table=11 FT /locus_tag="RBRH_00534" FT /db_xref="EnsemblGenomes-Gn:RBRH_00534" FT /db_xref="EnsemblGenomes-Tr:CBW76615" FT /db_xref="UniProtKB/TrEMBL:E5AU41" FT /protein_id="CBW76615.1" FT /translation="MSARRSSPSCRATAVCPTLPPSSRGMSRSEHERHGIANAPTPLLF FT HLET" FT CDS complement(205660..206997) FT /transl_table=11 FT /locus_tag="RBRH_00535" FT /product="Acyl-coenzyme FT A:6-aminopenicillanic-acid-acyltransferase precursor (EC FT 2.3.1.-)" FT /function="Acyl-coenzyme FT A:6-aminopenicillanic-acid-acyltransferase precursor (EC FT 2.3.1.-)" FT /EC_number="2.3.1.-" FT /note="Acyl-coenzyme FT A:6-aminopenicillanic-acid-acyltransferase precursor (EC FT 2.3.1.-)" FT /note="COG: Permeases of the drug/metabolite transporter FT (DMT) superfamily" FT /db_xref="EnsemblGenomes-Gn:RBRH_00535" FT /db_xref="EnsemblGenomes-Tr:CBW76616" FT /db_xref="GOA:E5AU42" FT /db_xref="InterPro:IPR007000" FT /db_xref="UniProtKB/TrEMBL:E5AU42" FT /protein_id="CBW76616.1" FT /translation="MSEQSIPTLRRDQAGWIFVHIEGAPYERGLQHGQLLAREISSAIR FT TAQYLAKWDTGEEFDTFVNAAIDQFTDRVDDEFTAEMRGIADGAQMPYELVLAWNGYMD FT LLQSWWPTHVSQTRPQLAGKPWRGRLGHHCSAFIATGSATRDGRIVMAHNSWDRYAVGD FT AFNVIFDIVPEQGNRILMQGLPGCISSLTDFWITSAGLMVTETTISNFVGYNTSGSPEF FT YRSRKATQYADSIGSWCERFATDNNGGYANSWLLGDTKTGEIARYELGLHYSGFEVTKD FT GFYSGFNTANDLKIRNQECVSEGDDYNDVRRNGARRLRWMQLMEKHHGRIDVELAKEII FT ADHYDVYLDRDDHPSSRTLCGHLELDDARFGGATQGPFNPWGANDGKVVDSDMAVRLEL FT WARWGHPCGRPFDAQAFMRRHPQWNWLNGYMRDRASQPWTLFDAVR" FT CDS complement(207073..208863) FT /transl_table=11 FT /locus_tag="RBRH_00536" FT /product="Chloride channel protein" FT /function="Chloride channel protein" FT /note="Chloride channel protein" FT /note="COG: Chloride channel protein EriC" FT /note="Pfam: Voltage gated chloride channel::PF00654
CBS FT domain pair::PF00571" FT /db_xref="EnsemblGenomes-Gn:RBRH_00536" FT /db_xref="EnsemblGenomes-Tr:CBW76617" FT /db_xref="GOA:E5AU43" FT /db_xref="InterPro:IPR000644" FT /db_xref="InterPro:IPR001807" FT /db_xref="InterPro:IPR014743" FT /db_xref="UniProtKB/TrEMBL:E5AU43" FT /protein_id="CBW76617.1" FT /translation="MRVPALRGIGHALTHRHRAVLAFLLRLRTRAQRLFKLSDKHTMLL FT WATLAGLVGAAATLVFRLGIDWLESLIDPNASGLVQIARDLPWYARLALPSAGGAVAGM FT LLLAARRNDDGKGHADYMEAMTIGEGVVPVRQSLWRSGSSLVTIVSGGSIGREGSMVQL FT AALSASLLGRLVHVDPERLRLLVACGAAAGITSAYSAPIAGALFVTEIVLGSIAMESFG FT PIIVSSVVANVTMRALSGYQAPYEMPPFPAISGLEVLWFVGLGILCGMLAPAFLLLLSA FT SRRLFGRWIAPLPWRLALGGALVGALSIQAPQVWGNGYSVVNAILHQPWTWQALVAVLV FT LKVAATCATAGSGAVGGIFTPTLFVGAALGAIYGLAAHAHLPLATSAPLAYAIVGMGAF FT LAAATHAPLMAILMIFEMTLSYQVVLPLMLASVIAYFIARALAETSMYEVTLRRNRERR FT ERLRLKATQMRELVRPADTVLGLDASVADMTRVFLEYPVKYIYIVDAAGWFQGVVALKD FT ITSDLLDKHGPRERRARDYLRRDFAALTPDMPLAAALQHFLAFQGERLPVVASTQAPKL FT LGVVYKTALLQAYFQMNASD" FT CDS complement(208824..209651) FT /transl_table=11 FT /locus_tag="RBRH_00537" FT /product="S-CRYSTALLIN" FT /function="S-CRYSTALLIN" FT /note="S-CRYSTALLIN" FT /note="COG: Uracil-DNA glycosylase" FT /note="Pfam: Glutathione S-transferase, C-terminal FT domain::PF00043" FT /db_xref="EnsemblGenomes-Gn:RBRH_00537" FT /db_xref="EnsemblGenomes-Tr:CBW76618" FT /db_xref="InterPro:IPR004045" FT /db_xref="InterPro:IPR004046" FT /db_xref="InterPro:IPR010987" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:E5AU44" FT /protein_id="CBW76618.1" FT /translation="MHAGSPAADGRCPSAHCPSTVIMSYELYYWPGLQGRGEFVRLALE FT EAGADYLDVARLPPSGRREDANPQGTEHGIGAMMSILQSQTEPYLPFAPPFLRDGTTLV FT AQTANILLYLGPRLGLAPADEALRHWVHGLQLTIADMVTEAHDTHHPIASALYFEQQRD FT AARQRAADFIANRIPKFMHYFERVLEQNPAGCTHLVGATLSYADLSMFQLIDGLHYAFP FT RATARFATQYPKLTALHEAVRTRPRIAAYLASPRRVPHNESCVFRHYAELDTR" FT CDS complement(209729..210835) FT /transl_table=11 FT /locus_tag="RBRH_00538" FT /product="Hypothetical membrane spanning protein" FT /function="Hypothetical membrane spanning protein" FT /note="Hypothetical membrane spanning protein" FT /note="COG: Predicted membrane protein" FT /note="Pfam: Conserved hypothetical protein 698::PF03601" FT /db_xref="EnsemblGenomes-Gn:RBRH_00538" FT /db_xref="EnsemblGenomes-Tr:CBW76619" FT /db_xref="GOA:E5AU45" FT /db_xref="InterPro:IPR018383" FT /db_xref="UniProtKB/TrEMBL:E5AU45" FT /protein_id="CBW76619.1" FT /translation="MNAMSILISKSSSLSPGTPAGAGAASRRGLLNGVLFVALFAFAVT FT QLAAWPPIARLGMSPLIVGIACGAVYGNALRVAMPDSWAAGVNFSARKLLRIAVAFFGL FT RVSLQEIAQVGLTGLAMSVVVVAATLAIGWWVGTRWLKLDRDTALLTAAGSAICGAAAV FT VAFESTLQSKPHKSAMAVGTVVLFGTLSMFVYPLMANAGWLHLDATGLGLYFGGTIHEV FT AQVVGAASAINAQTVHVATIVKMTRVMLLVPAIFVVAGFIARAARNAQPAGSSTRRGKL FT PVPWFALGFLVLVLVNSLHVIPSHVSYILNSLDTFALTMAMTALGIETRVAQIREAGPR FT ALIAGALLQLWLIAGGYALTLGVERWLG" FT CDS 210937..211818 FT /transl_table=11 FT /locus_tag="RBRH_00539" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory helix-turn-helix protein, FT lysR family::PF00126
LysR substrate binding FT domain::PF03466" FT /db_xref="EnsemblGenomes-Gn:RBRH_00539" FT /db_xref="EnsemblGenomes-Tr:CBW76620" FT /db_xref="GOA:E5AU46" FT /db_xref="InterPro:IPR000847" FT /db_xref="InterPro:IPR005119" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AU46" FT /protein_id="CBW76620.1" FT /translation="MTPDQLLTFAAVAEHQNISRAAEAVHLSQPAVSGQLRLLQEEFGE FT SLYVRNGRGVRLTDAGRQLAVHAARLRDTWQQAHALRDALRGLERGTLRIGASTTPASY FT LLPYLVAHFHRAHPDIEIRTIYGNTSDVCHALQELDIALIEGSVPAELPADTHVHPWHD FT DEIVAIVPAGHPLASDGAAPLSRISQFPLIWRESGSGVRHEVERAFARAGASARAALEL FT AGVEGVKEAVRAGMGVGFVSAMAMRHEDARLISVSLAPQPLTRRFSILVMHGSAASRAA FT LKFLALCGIDSG" FT CDS 211954..212910 FT /transl_table=11 FT /locus_tag="RBRH_00540" FT /product="Dehydrogluconokinase (EC 2.7.1.13)" FT /function="Dehydrogluconokinase (EC 2.7.1.13)" FT /EC_number="2.7.1.13" FT /note="Dehydrogluconokinase (EC 2.7.1.13)" FT /note="COG: Sugar kinases, ribokinase family" FT /note="Pfam: pfkB family carbohydrate kinase::PF00294" FT /db_xref="EnsemblGenomes-Gn:RBRH_00540" FT /db_xref="EnsemblGenomes-Tr:CBW76621" FT /db_xref="GOA:E5AU47" FT /db_xref="InterPro:IPR002173" FT /db_xref="InterPro:IPR011611" FT /db_xref="UniProtKB/TrEMBL:E5AU47" FT /protein_id="CBW76621.1" FT /translation="MIETLLPLDVVTYGEAMALFVATERAHDLAHVRHFTKRIAGADLN FT VATGLARLGFRVGWISRVGADSFGRYVLDVLAEEGIDATHVTVDPRYPTGFQLKSRADD FT GRDPQVEHFRRGSAASHLSLDDYAADYVLGARHLHLTGVAAAISESSRELAFKLAREMR FT GAGKTVSFDPNLRPTLWPSREAMVEQINALAALADWVLPGVAEGAVLTGSGDPAAIARF FT YIERGARGVVVKLGAHGAYYRHGDDEGIVPGVYVERVVDTVGAGDGFAVGVISALLQGR FT TVRHAVERGNRIGALAIQVIGDSEGLPTRAALDALEQ" FT CDS complement(212914..213081) FT /transl_table=11 FT /locus_tag="RBRH_00541" FT /db_xref="EnsemblGenomes-Gn:RBRH_00541" FT /db_xref="EnsemblGenomes-Tr:CBW76622" FT /db_xref="UniProtKB/TrEMBL:E5AU48" FT /protein_id="CBW76622.1" FT /translation="MSTRVACLSPACRLPIVQANRVARLPVKGAVNEHGRPLAIAQRTR FT DRFLYTDRAR" FT CDS complement(213101..213763) FT /transl_table=11 FT /locus_tag="RBRH_00542" FT /product="Bacitracin transport permease protein bcrC FT homolog" FT /function="Bacitracin transport permease protein bcrC FT homolog" FT /note="Bacitracin transport permease protein bcrC homolog" FT /note="COG: Membrane-associated phospholipid phosphatase" FT /note="Pfam: PAP2 superfamily::PF01569" FT /db_xref="EnsemblGenomes-Gn:RBRH_00542" FT /db_xref="EnsemblGenomes-Tr:CBW76623" FT /db_xref="GOA:E5AU49" FT /db_xref="InterPro:IPR000326" FT /db_xref="UniProtKB/TrEMBL:E5AU49" FT /protein_id="CBW76623.1" FT /translation="MPPPSMESLNQTLFLLLNASAPSPAMHALMSFCANALIWAMPATL FT VAGWLRVPSRTRPTHVGVPTPAAGRSQACRGHFVEAALAAALGVGIAQIIGAMWPHPRP FT FAIGLGHAWIAHIDDASLPSDHTTLAFSVACSLLLHAGTRVAGAALALAGLLVGWARIY FT AGIHFPLDVGCGMLLGMACAVLAHRLAPRVVPPLLRRSEPPYRFLCAALIRRGWAVA" FT CDS 213881..214300 FT /transl_table=11 FT /locus_tag="RBRH_00544" FT /db_xref="EnsemblGenomes-Gn:RBRH_00544" FT /db_xref="EnsemblGenomes-Tr:CBW76624" FT /db_xref="InterPro:IPR021389" FT /db_xref="UniProtKB/TrEMBL:E5AU50" FT /protein_id="CBW76624.1" FT /translation="MHARPVMIASALFRGSPSMARPPFLFNDPLREHLARVVSDLLPET FT AHFTDTQTEAGHPALRIDWTVSPFSRRHSKVMLDVVFVDSSLARYAAAPPNERARAEAV FT LRAYLEAVIGSMEEQYALGKEIEPVSEVELGREFA" FT CDS complement(214503..215456) FT /transl_table=11 FT /locus_tag="RBRH_00545" FT /product="Shikimate kinase (EC 2.7.1.71)" FT /function="Shikimate kinase (EC 2.7.1.71)" FT /EC_number="2.7.1.71" FT /note="Shikimate kinase (EC 2.7.1.71)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00545" FT /db_xref="EnsemblGenomes-Tr:CBW76625" FT /db_xref="GOA:E5AU51" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU51" FT /protein_id="CBW76625.1" FT /translation="MHAHACAVIMTLSGTVACRCGRPRDSIQPNGGNRNVVLLLDTRYR FT RGAGLRRDQRDVAGKRRKLGADAIRLAERSRLTLARLVRVSTPRACPGRAAPGGLRTAT FT TMTRLLFFCGHAGTGKTTLAKQLVPALLEATREPLCLLDKDTLYGRYSAAAMQALTHDP FT NDRDSPVYLQTLRGPEYEGLLDTARENVSLGISAVVVGPLSREVRDRRIFDRKWLRVPA FT HVDVHWVWVSVPEHIAHERIVRRANVHDAYKLAHWETYRQRCFEPDPADYPQLLIFDNS FT APHDADRRALRDRLLAPAHPTAPAAPAANRPPFTAG" FT CDS complement(215494..216531) FT /transl_table=11 FT /locus_tag="RBRH_00546" FT /product="Universal stress protein family" FT /function="Universal stress protein family" FT /note="Universal stress protein family" FT /note="COG: Universal stress protein UspA and related FT nucleotide-binding proteins" FT /note="Pfam: Universal stress protein family::PF00582" FT /db_xref="EnsemblGenomes-Gn:RBRH_00546" FT /db_xref="EnsemblGenomes-Tr:CBW76626" FT /db_xref="GOA:E5AU52" FT /db_xref="InterPro:IPR006015" FT /db_xref="InterPro:IPR006016" FT /db_xref="InterPro:IPR014729" FT /db_xref="UniProtKB/TrEMBL:E5AU52" FT /protein_id="CBW76626.1" FT /translation="MTRCILVQQLRSVLFHIAPPASSALKSADFHADSIPLRPDNRTPL FT TADNLPVGTALPFTLTHAAGTPLLPESGIAGRCRARLFAYPFLAAACGRRPARCGPRQR FT ASRRKSWHGEPRCGYPRCEGAPARTPEPLRVHTGNLVHMQPFLSPGSDTRCARSPFATI FT MQRCVRAPGRTNGPSHQENASMYHRILVAIDGSHTSRHALNAALDLAASEGAQLQPVFI FT IDDVPLYYSVPGYDPSIVVRAQTEEGQRVIDEAADAMRARGIAGTPQILTTSSLEGIAE FT CIVRAAQAFNADLLVLGTHGRRGVRRLVLGSVAEQTLRLAQRPVLLIPSASHAPQAAPS FT SIANG" FT CDS 216620..217744 FT /transl_table=11 FT /locus_tag="RBRH_00547" FT /product="PURINE NUCLEOSIDE PERMEASE" FT /function="PURINE NUCLEOSIDE PERMEASE" FT /note="PURINE NUCLEOSIDE PERMEASE" FT /note="COG: Purine nucleoside permease" FT /note="Pfam: Purine nucleoside permease (NUP)::PF06516" FT /db_xref="EnsemblGenomes-Gn:RBRH_00547" FT /db_xref="EnsemblGenomes-Tr:CBW76627" FT /db_xref="GOA:E5AU53" FT /db_xref="InterPro:IPR009486" FT /db_xref="UniProtKB/TrEMBL:E5AU53" FT /protein_id="CBW76627.1" FT /translation="MWGDSCSNKERRMFKKLIGGTVLAASLACAGLGSGHAEQAVDVAQ FT VEPALHADWAGGSGRAVKVMIVSMFGPEGQVWLDQLGPWQAIRVPGLSPDYPSVHCNRS FT DVCVLTTGMGHANAAASTMALVLSRQFDLRRTYFLVAGIAGIDPAQGTIGSAAWAHYLV FT DFGLQWELDAREIPAGWQSGYLGANTKGPAEKPPLDYRTEVFKLNDALVQRAFALSRGV FT QLSDSAPAQVARVRFGYAPANLPPSVIQCDTLASDTWWSGTQLGQRARDWTKLLTHGKG FT VYCTTQQEDNATYEALKRGAAEHRVDLSRVAVLRAGSDFDRPAAGQSSADNLLNYAAQG FT GFQIALQNLYLAGNPLVQEIVTHWKAWRDGVPKH" FT CDS complement(218101..218253) FT /transl_table=11 FT /locus_tag="RBRH_00549" FT /db_xref="EnsemblGenomes-Gn:RBRH_00549" FT /db_xref="EnsemblGenomes-Tr:CBW76628" FT /db_xref="UniProtKB/TrEMBL:E5AU54" FT /protein_id="CBW76628.1" FT /translation="MCRAFAGLVKMLLLHRNLKSFAPPQGLRMQVYRVVASAAARVPHR FT MNPLR" FT CDS 218209..218838 FT /transl_table=11 FT /locus_tag="RBRH_00550" FT /product="GTP cyclohydrolase II (EC 3.5.4.25)" FT /function="GTP cyclohydrolase II (EC 3.5.4.25)" FT /EC_number="3.5.4.25" FT /note="GTP cyclohydrolase II (EC 3.5.4.25)" FT /note="COG: GTP cyclohydrolase II" FT /note="Pfam: GTP cyclohydrolase II::PF00925" FT /db_xref="EnsemblGenomes-Gn:RBRH_00550" FT /db_xref="EnsemblGenomes-Tr:CBW76629" FT /db_xref="GOA:E5AU55" FT /db_xref="InterPro:IPR000926" FT /db_xref="UniProtKB/TrEMBL:E5AU55" FT /protein_id="CBW76629.1" FT /translation="MQQQHFDEASECAAHIASATLPTRYGIFASHVFRVRGDGTEHLAL FT VMGEVRAREAVLTRLHSECLTGDVLGSFRCDCGEQLDAALRQIAAEAAGVLLYLRGHEG FT RGIGLSNKILAYALQEQGRDTVDANRDLGLPDDAREYDSAASILRWLGVSSVRLMSNNP FT DKFDTLRRHGIPVHDRVDLAIPMREENERYIWTKRKRFGHYFSENE" FT CDS 219086..220219 FT /transl_table=11 FT /locus_tag="RBRH_00551" FT /db_xref="EnsemblGenomes-Gn:RBRH_00551" FT /db_xref="EnsemblGenomes-Tr:CBW76630" FT /db_xref="UniProtKB/TrEMBL:E5AU56" FT /protein_id="CBW76630.1" FT /translation="MTMLDEVSALSSPGSLLSPHAHVVAPYDLEVTGKRAHGYRPLSTV FT SWIRNANAAPFTIDYRQQTHLHLINGMGVTLGDSIIGLSALDAIRRLHPSLSVTIYRPA FT HAPDYVKQLYALAAPRFGGMIDLPVPLDSIPATELAIDVGNHLFWPGFATLPMIDFFLC FT ALGMAPHTVPARYKANEWLTTLTLPAPGGAWRARGYTLLCSEASTPVRSIPAAVRVSIV FT DEMWRTFGLPVLGFGTLEHDHYTDIAALSPDTASFLSWIAHARHVVTSDTAAVHVAAGF FT GVPSTAYFTTIAPALRVRDYPYCEAFALDVPELDEMHASGREADLRRVERAYQEWHAAR FT GNWLPPRDCAPGQSVLSQLMTSQPKLTLPEMTPSGLG" FT CDS complement(220512..221126) FT /transl_table=11 FT /locus_tag="RBRH_00553" FT /product="Outer membrane protein" FT /function="Outer membrane protein" FT /note="Outer membrane protein" FT /note="COG: Outer membrane protein W" FT /note="Pfam: OmpW family::PF03922" FT /db_xref="EnsemblGenomes-Gn:RBRH_00553" FT /db_xref="EnsemblGenomes-Tr:CBW76631" FT /db_xref="GOA:E5AU57" FT /db_xref="InterPro:IPR005618" FT /db_xref="InterPro:IPR011250" FT /db_xref="UniProtKB/TrEMBL:E5AU57" FT /protein_id="CBW76631.1" FT /translation="MNAFYRIAAGLLLAAPVVFAAPVHAEQGDILARLRAISIQPDVSA FT SGTLGQLGTGVNNAIVPELDFTYMATRNLGIELILGTSRHQVTSNIGALGGVNVLPPTL FT LLQYHFNPAGTIRPYVGAGLNYTYFYNDGLHAGDTPVSIKHSSFGPALQAGVDVQVTKR FT VFVNADIKKIWMRTSASIGDTQLGSLKIDPLVAGIGVGMRF" FT CDS 221215..221544 FT /transl_table=11 FT /locus_tag="RBRH_00554" FT /db_xref="EnsemblGenomes-Gn:RBRH_00554" FT /db_xref="EnsemblGenomes-Tr:CBW76632" FT /db_xref="UniProtKB/TrEMBL:E5AU58" FT /protein_id="CBW76632.1" FT /translation="MLLLGDGPPRAGIGAGSGYVKVARATSVAAWASIAPRSPAHFACL FT LSGVHLTDECAARQSLRTRLAVEAYLSMRCRAPKTASSNGSRCCGRLDDAKRAVPRHGR FT GPRRR" FT CDS complement(221551..222471) FT /transl_table=11 FT /locus_tag="RBRH_00555" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory helix-turn-helix protein, FT lysR family::PF00126
LysR substrate binding FT domain::PF03466" FT /db_xref="EnsemblGenomes-Gn:RBRH_00555" FT /db_xref="EnsemblGenomes-Tr:CBW76633" FT /db_xref="GOA:E5AU59" FT /db_xref="InterPro:IPR000847" FT /db_xref="InterPro:IPR005119" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AU59" FT /protein_id="CBW76633.1" FT /translation="MAKCYLNEAWSMMSLRQLRYFVEIVEAGSYSLAAERLFIAQSALS FT RQIKELEATAQVQLLVRGARRVELTRAGKALYDGAKRLLFNLNETLVQTRHANRGEQGI FT IRLVHSSSVPFAGPLLERVRCYLDANEHVSAQVSQMPSEEQMASIEQGVNDVGFVRLPV FT HLEYPGVRADELYSEPLMLAVSATHPLAGREAVSIAELREEPFVSLPHHERGGLSFRVA FT ELCMKNGYFPRSARVTSRKTTQLSLIEAGFGVSLVAESMRLIAPAGVRFIRLAGTGNTT FT AVAMLYRSNASALVQAFVAATMGKN" FT CDS 222639..223394 FT /transl_table=11 FT /locus_tag="RBRH_00556" FT /note="COG: Predicted permeases" FT /note="Pfam: Domain of unknown function DUF81::PF01925" FT /db_xref="EnsemblGenomes-Gn:RBRH_00556" FT /db_xref="EnsemblGenomes-Tr:CBW76634" FT /db_xref="GOA:E5AU60" FT /db_xref="InterPro:IPR002781" FT /db_xref="UniProtKB/TrEMBL:E5AU60" FT /protein_id="CBW76634.1" FT /translation="MIFDLTVTHVFIVWLGIALAYVVFGMTGFGTALVASPLLAQFIPV FT SHIVPLLALLDFCAATTNVVRDGRKAELGELKRLVPLMVAGSGMGAVILLATKPDLLLL FT LLGIFVIGYAAYSLSGYRPMTQLSSWSSVPFGLVGGIFSALFGSGGFIYAIYLQGRLEN FT KEHIRITQTTLIGLSTLTRLVMFLVAGVYANRSLLLLAVLLAPGMLAGVWMGRRITLKL FT SREQFVKLVNSVILVSGVFLLVRYFSSIS" FT CDS 223472..225034 FT /transl_table=11 FT /locus_tag="RBRH_00557" FT /product="Pyoverdin chromophore biosynthetic protein pvcC" FT /function="Pyoverdin chromophore biosynthetic protein pvcC" FT /note="Pyoverdin chromophore biosynthetic protein pvcC" FT /note="COG: Aromatic ring hydroxylase" FT /note="Pfam: 4-hydroxyphenylacetate 3-hydroxylase FT family::PF03241" FT /db_xref="EnsemblGenomes-Gn:RBRH_00557" FT /db_xref="EnsemblGenomes-Tr:CBW76635" FT /db_xref="GOA:E5AU61" FT /db_xref="InterPro:IPR004925" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR024674" FT /db_xref="InterPro:IPR024719" FT /db_xref="UniProtKB/TrEMBL:E5AU61" FT /protein_id="CBW76635.1" FT /translation="MTQSTSAALKLKAAEKDEMLTADEYLASLDDGREVFIYGEKVRSV FT TQHVAFRNSARSIARLYDALHAPAFRDTMTTLDPAGYRTHRYFTPARSADDLLRARAAI FT AHWSRLSYGFMGRTPDYKAGFTATLLSDPDFYDPFRDNAIRWYHETARKVLFMNHVLVN FT PPVGRAKAIDSMRDVYLHVEKERDDGIVVRGAKMVATSAAISNATFVAQNSATQYQQGR FT EEDFALCFILPMGTPNLKIVCRRSYEASSLSPFDNPLSSRFDENDSVLIFDGVFVPWEN FT VLIYRDIPKARSFYSASGFLNRYPLQSGTRLAVKLDFLCGALIKLLESNGSYEFRGVRT FT KVADVVGWRNAMWAMTEAMCMAPQKRSDGSVVPRLEAATTVRHFGAQVMTHIKPIFDTI FT LGGSLIMQVASFADMRNPELSGLIDTYFQGTDSSAQERLKLVKLLWDAIGSEFGGRHEL FT YEYNYAGNHEQVRLDMLNHSTACGAIDQCKSLVEQCLADYDVDGWHDPSWQFDGQREVH FT PFA" FT CDS 225031..226122 FT /transl_table=11 FT /locus_tag="RBRH_00558" FT /product="Vanillate demethylase oxygenase subunit (EC FT 1.14.13.82)" FT /function="Vanillate demethylase oxygenase subunit (EC FT 1.14.13.82)" FT /EC_number="1.14.13.82" FT /note="Vanillate demethylase oxygenase subunit (EC FT 1.14.13.82)" FT /note="COG: Phenylpropionate dioxygenase and related FT ring-hydroxylating dioxygenases, large terminal subunit" FT /note="Pfam: Rieske [2Fe-2S] domain::PF00355" FT /db_xref="EnsemblGenomes-Gn:RBRH_00558" FT /db_xref="EnsemblGenomes-Tr:CBW76636" FT /db_xref="GOA:E5AU62" FT /db_xref="InterPro:IPR015881" FT /db_xref="InterPro:IPR017941" FT /db_xref="UniProtKB/TrEMBL:E5AU62" FT /protein_id="CBW76636.1" FT /translation="MMRRIMIYSGKWDRDALDYRALRDQWHVVARSDDVARDMPLAVRL FT LGEDLVLWRDHAGINAWLDYCGHRGARLSLGCVRDGEIECPYHGWRYASSGQCTKVPAH FT PDQTPPAQRLVRVYRVTERYGLVWVCVGQPASDVPPFPEWDDASFRKVYAGPYRYRANA FT LRSVENFLDASHFPFVHANLNGDPNCPDKIEDYEVKMTQNGLETSEIEVFQPYGDHRGI FT PVTARYTYHAFRPTTAYFSKKTGVTERFCTFLNATPVDEDECVIQLIVAINFGENLSDA FT QILQRQDRVFEQDRHIVESQRPYRLPLDLREEMHVRSDRLAVEYRRWLRALGEAATADC FT GVRQXAGAQQHTSSERSKESYHA" FT CDS 226028..227521 FT /transl_table=11 FT /locus_tag="RBRH_00559" FT /product="Diaminobutyrate--pyruvate aminotransferase (EC FT 2.6.1.46)" FT /function="Diaminobutyrate--pyruvate aminotransferase (EC FT 2.6.1.46)" FT /EC_number="2.6.1.46" FT /note="Diaminobutyrate--pyruvate aminotransferase (EC FT 2.6.1.46)" FT /note="COG: 4-aminobutyrate aminotransferase and related FT aminotransferases" FT /note="Pfam: Aminotransferase class-III::PF00202" FT /db_xref="EnsemblGenomes-Gn:RBRH_00559" FT /db_xref="EnsemblGenomes-Tr:CBW76637" FT /db_xref="GOA:E5AU63" FT /db_xref="InterPro:IPR004637" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:E5AU63" FT /protein_id="CBW76637.1" FT /translation="MRLQQRIAVCANLLARSSIPAVSVQRSRIMHKQTLDALSMLEHRE FT SNARTYARSITRVLTRAELATVYDSEGRQYLDCLACAGALPLGHNHPYVMERVSQFLAS FT GHILQALDIVTPAKIEFVEALYRVLPPQFANDAKLQFCGPTGSDAVEAAIKLFKTVTGR FT RSVLAFHGAYHGMTMGALSLMGNRGPKESVAGAMAEVHFLPYPNAYRCPFGVGGAQSDA FT LSLTYIRHLLEDPESGITKPALILLEAVQGEGGCIPASAGWLAGLSELALRHQIPLVID FT EVQTGFGRTGTMFAHEVAGIIPDAIVMSKAVGGGFPLSVLAYRRCYDGWRPGAHAGTFR FT GNQIALVAGAATLEFLRSQGIAQQAAERGARLRAGLESLQRRYACIGDVRGRGLMLGIE FT IVDPHGPPDARGLPPAAGELARRIKHACLDEGLIIETGGRHGAVLRLLPPLIITEAETD FT EILARLERALSTVISAMDAPLLAPAGVSCNAHNPVSETL" FT CDS 227518..228957 FT /transl_table=11 FT /locus_tag="RBRH_00560" FT /product="L-ornithine 5-monooxygenase (EC 1.13.12.-)" FT /function="L-ornithine 5-monooxygenase (EC 1.13.12.-)" FT /EC_number="1.13.12.-" FT /note="L-ornithine 5-monooxygenase (EC 1.13.12.-)" FT /note="COG: Lysine/ornithine N-monooxygenase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00560" FT /db_xref="EnsemblGenomes-Tr:CBW76638" FT /db_xref="GOA:E5AU64" FT /db_xref="InterPro:IPR025700" FT /db_xref="UniProtKB/TrEMBL:E5AU64" FT /protein_id="CBW76638.1" FT /translation="MKAGHDAATALEPCVHDVIGIGFGPANIALAVAIEELTDGLDVLF FT LEKHDAAYWQQGMLLEESDIQNHPLRDLVTPRNPRSRYSFTNFLFENGRLFEHLNLGLS FT FPLRIEYAQYVQWVASFFAHQVSYGVDVTSIEPVIDACSGLLDGYVVRDCTGRAWRARS FT VVVAPGRTPNVPAQFAGLDDPRIVHLNDYLFALRRVCDGGRKPRIAVIGGSQSAVEILL FT HAYGTGSCASVVGITRNFAFRQKDTSPFSDEVYFPEFVKTFFFADQATRNRLRAELMPT FT NYASADKDVLDALYVKRYVNRILGREGLAIRTNTYVDAVTATAEGIRLALVNSVSGEHA FT LDCFDLVVLATGFLDIGDGPRYEPYPPLLRQLAPLLDLSRGHLDVSFDYRVHFSCAVAP FT DAPLYLNGLCESSHGMGDSGSFSLLALRSEAIARSLYAQLSRPAARAGSNTVAPSATAI FT TAIHDTDKNGTSSESTRFVSL" FT CDS 228824..229564 FT /transl_table=11 FT /locus_tag="RBRH_00561" FT /product="Transcriptional regulator" FT /function="Transcriptional regulator" FT /note="Transcriptional regulator" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Putative FMN-binding domain::PF04299" FT /db_xref="EnsemblGenomes-Gn:RBRH_00561" FT /db_xref="EnsemblGenomes-Tr:CBW76639" FT /db_xref="GOA:E5AU65" FT /db_xref="InterPro:IPR007396" FT /db_xref="InterPro:IPR012349" FT /db_xref="UniProtKB/TrEMBL:E5AU65" FT /protein_id="CBW76639.1" FT /translation="MRSCRAPRHVPARIPSRLLPRPLRPSTIRTKMEPLANQPVSFHYD FT AFRFTDPERIDAIIDSFPLALIASTDAGLSHASHVPLFRERQSRNLFGHVDAANPQFCG FT ANTTRARIVFTGPDSYIPPEAYVTRQLPTWNYVAVHLVGTVHVVTDLAQKIEVLRETAA FT RLQPDDARWQFDANDERVARFAPGVLALRVHVEHEEARIKLSQDKGLEDQYAALDCLLS FT TRARSLRPLLETFLPPWEEAAHAR" FT CDS 229464..230624 FT /transl_table=11 FT /locus_tag="RBRH_00562" FT /product="ATPase" FT /function="ATPase" FT /note="ATPase" FT /note="COG: Predicted ATPase" FT /note="Pfam: AFG1-like ATPase::PF03969" FT /db_xref="EnsemblGenomes-Gn:RBRH_00562" FT /db_xref="EnsemblGenomes-Tr:CBW76640" FT /db_xref="GOA:E5AU66" FT /db_xref="InterPro:IPR005654" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AU66" FT /protein_id="CBW76640.1" FT /translation="MRRSTACCLRARVVCGRCWRHSCRPGRRPRMLDDAQVVTSLRSSG FT IEPDASQRRAIEALCMLLVTPGRRWLGALHRLHGVYCYGLPGRGKSMVVDAVFQLAPGS FT KRRIHFHEFLRDIHCRLVKAPRSSDRLADVAKAWLHGVDLLCFDEFHVHDIADAFLIGR FT FLTTAVAEGVRIVLTSNYAPDDLLPNREYHARFAPTIDMIKRHFTIVHFDGPRDYRFSE FT ADTAQPRFFSPLALAREPLRAIFVAREGEAVLQPGVVELAGRPLPVSAAGESTVWVDFD FT VLCMAQRSHVDYLAMADRWRWVIIDNVHATALANPDTLQRLVWLIDILYDRKCGVCIAS FT DIAISDALNGLEGAHDLSRTVSRLAEMQSRAYACFTENPLIIAQEN" FT CDS 230582..231016 FT /transl_table=11 FT /locus_tag="RBRH_00563" FT /db_xref="EnsemblGenomes-Gn:RBRH_00563" FT /db_xref="EnsemblGenomes-Tr:CBW76641" FT /db_xref="GOA:E5AU67" FT /db_xref="InterPro:IPR004370" FT /db_xref="InterPro:IPR014347" FT /db_xref="UniProtKB/TrEMBL:E5AU67" FT /protein_id="CBW76641.1" FT /translation="MFHGKSTDHCSGKLIMPLIKIEEQQPRTADEKVRLVDLLFSVLRQ FT TLGVSPNELQARYQTFEPEDFYPPAGTGEYLGIEITLFAGRSLDVKRRLYGRIVAEVAQ FT ARQIDPSRILVLLREEPLDNWGLHGGRAATDLKFDYAIAI" FT CDS 231013..231294 FT /transl_table=11 FT /locus_tag="RBRH_00564" FT /db_xref="EnsemblGenomes-Gn:RBRH_00564" FT /db_xref="EnsemblGenomes-Tr:CBW76642" FT /db_xref="UniProtKB/TrEMBL:E5AU68" FT /protein_id="CBW76642.1" FT /translation="MKCDESGSADSDAGSTHVPADTFPSAGIAFWCQGTGLVVSAVDRR FT QLASPTLWRMLEAARRSLQGAACAAAAPGSDGGDGHASDESPVRSRDP" FT CDS 231314..231517 FT /transl_table=11 FT /locus_tag="RBRH_00565" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00565" FT /db_xref="EnsemblGenomes-Tr:CBW76643" FT /db_xref="UniProtKB/TrEMBL:E5AU69" FT /protein_id="CBW76643.1" FT /translation="MPRRYGHSTRCLSPTALSFVGCKNGILKLPRLIKPDNGSEFLSKV FT LDKWTNENGVKDRLLSPRQANR" FT CDS 231423..231776 FT /transl_table=11 FT /locus_tag="RBRH_04237" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_04237" FT /db_xref="EnsemblGenomes-Tr:CBW76644" FT /db_xref="GOA:E5AU70" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/TrEMBL:E5AU70" FT /protein_id="CBW76644.1" FT /translation="MGANSSPRCSTSGRMKTASRIDFSRPGKPTDNVKNESFNGRFQEK FT CLSAHGFLSLEDARRQIEAWRWYYNEAFSHWVLVLQRILQWRTPSECARQCGPQDDSVT FT PKRWKFHLRTALM" FT CDS 231873..232160 FT /transl_table=11 FT /locus_tag="RBRH_00566" FT /db_xref="EnsemblGenomes-Gn:RBRH_00566" FT /db_xref="EnsemblGenomes-Tr:CBW76645" FT /db_xref="UniProtKB/TrEMBL:E5AU71" FT /protein_id="CBW76645.1" FT /translation="MSTPLRLLYKGFELRPLVFARQFSRFDGHSRYAEGYDVAVRICRL FT GTDGVAGAGRVFKVDQEHVFADFGVARRAACQRAQDIIDGKVDGASVIGM" FT CDS 232269..232481 FT /transl_table=11 FT /locus_tag="RBRH_00567" FT /product="SSU ribosomal protein S21P" FT /function="SSU ribosomal protein S21P" FT /note="SSU ribosomal protein S21P" FT /note="Pfam: Ribosomal protein S21::PF01165" FT /db_xref="EnsemblGenomes-Gn:RBRH_00567" FT /db_xref="EnsemblGenomes-Tr:CBW76646" FT /db_xref="GOA:E5AU72" FT /db_xref="InterPro:IPR001911" FT /db_xref="UniProtKB/TrEMBL:E5AU72" FT /protein_id="CBW76646.1" FT /translation="MTTVIPKPNEPVEVALRRFRRSIESTGLIKELRARMAYEKPTTER FT KRKKAAAVARLRKQMRRSLPPRKLY" FT CDS complement(232832..235312) FT /transl_table=11 FT /locus_tag="RBRH_00568" FT /product="Mechanosensitive ion channel" FT /function="Mechanosensitive ion channel" FT /note="Mechanosensitive ion channel" FT /note="COG: Small-conductance mechanosensitive channel" FT /note="Pfam: Mechanosensitive ion channel::PF00924" FT /db_xref="EnsemblGenomes-Gn:RBRH_00568" FT /db_xref="EnsemblGenomes-Tr:CBW76647" FT /db_xref="GOA:E5AU73" FT /db_xref="InterPro:IPR006685" FT /db_xref="InterPro:IPR010920" FT /db_xref="InterPro:IPR011014" FT /db_xref="InterPro:IPR011066" FT /db_xref="UniProtKB/TrEMBL:E5AU73" FT /protein_id="CBW76647.1" FT /translation="MPFRITAMPVSFRPPLCQPTRQLVWVATVFVVMVVALSVAVRVSA FT APTPTPSAAASPSSGTPATSASNTVVALTPEQARAALQVLNDPRRRAQFEDTLRAIAAA FT GTLASPTVPPPPAVAANAPPAASGPAGSLAKALDADGLVTQLSRHIAQSASTFGQRVRL FT SSSALLDFPSVRQWWAWHLSSPQGRHTLLGLLELLLAALVPSLMLEMLVRRTVRRSRSA FT LAAHHATPHEPPAPSRQSDLRPGDASAPRAFASHAAHHWSRLQVLPRALVHLLLGAVPL FT TAFALCASMLLSVLDDSNTQAASAVGVVVDAYVIGRAVLLACAFFFAPNAPHLRLLPLQ FT DRWASFAQGWMTRIVVVAGAGGALAGAAGRLGMTQEAQLALVKLVALAVHIMAAIAILQ FT CRVPVARAIRGYFTKRPALAYLGHWLADIWAGSTVFVILALWLVWALDVRHGYEMVLHL FT GGLSLAVLLAARVVAIVVFGALGRVFGQGVDDSISSVGRRRAYRYYPLLRKVLSVVIGV FT ATLLVLLSIWGLHVGTFLVHNPIGNRLGSALVTIAIAALVAVLVWEIANVGAERRLERW FT TAAGDVIRAARLRTLLPMLRTTLFIATLMIVGLTALSQIGVNTGPLLAGASIFGVALGF FT GSQKLVQDFITGIFLLMENAMQVGDWVTVAGVSGSVEYLSIRTVRLRGGDGSLYTVPFS FT SVTTVNNTNRGIGNAAVKVVIAAGADVQYAIQTLVDIGAELRSDDKFKDGILSDFSFWG FT VDQIDGASITLVGQIACRDTRRWPVQREFNRRVLERFTERGIELANPQRNFVIDARATA FT QQPSGPDAGTSPNR" FT CDS complement(235722..237074) FT /transl_table=11 FT /locus_tag="RBRH_00570" FT /product="Citrate/L-malate proton symporter" FT /function="Citrate/L-malate proton symporter" FT /note="Citrate/L-malate proton symporter" FT /note="COG: Na+/citrate symporter" FT /note="Pfam: Bacterial sodium:citrate symporter::PF03390" FT /db_xref="EnsemblGenomes-Gn:RBRH_00570" FT /db_xref="EnsemblGenomes-Tr:CBW76648" FT /db_xref="GOA:E5AU74" FT /db_xref="InterPro:IPR004679" FT /db_xref="UniProtKB/TrEMBL:E5AU74" FT /protein_id="CBW76648.1" FT /translation="MAMPPSAVRSTRQFLRQALLFRFRGFDASACWQRLMKRHIGIIPV FT PAYGLTLACLSALIALEKLPSELPVLIAALAVVGFTCFEIGARVPVLRHMGGPVIVTLL FT LPSCLTHHQWLPTSLIVSIRELWAATNILYLFCILVIAGCLLGMDRQVLIKGITRFCVP FT VVAGSVTAALAGTATGIAFGLSAHNTFFFIVVPIMAGGIGEGAIPLTIGYAALLQQPQG FT QLFAQVVPAIVLGNLGAVASAAILHRVSRSWPQDAQVWLKTADNPTLLCRKSVPIEHIA FT AAATIAISLYFAGLVTQHFTGLPAPIGMLGFAVLIKLIGAVPSHLEHGAHWNYRFFACA FT VSYPLLCGVGITLMPWDAVIAALSPVHFVTALVTVLVLMTTGFLVGRWTGLPAIESALI FT NACHSGMGSVGDLAILTAANRLPLMPFAQLATRIGGALTVMVALLLLGQCV" FT CDS complement(237611..238294) FT /transl_table=11 FT /locus_tag="RBRH_00572" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: Phosphopantetheine attachment site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_00572" FT /db_xref="EnsemblGenomes-Tr:CBW76649" FT /db_xref="GOA:E5AU75" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AU75" FT /protein_id="CBW76649.1" FT /translation="MIRFVDGRMYRSGDRGRLGIDGRLEHLGRLDNQVKIRGFRIELDE FT IRAVLLEYPYVSAAAVVVNRASVDDAASARLDAYVVTDQDRIADVRCHAMRLLPEHMVP FT STFTALESLPLTANGKLDVSKLPAPKLSSSTDKATRQPALEVSQDPASDTLLEKLRCIW FT GDAFGVEVGHDDNFFELGGNSLFAVRIARVMREQGLPPLPPRELYLRQTLRSVVDYLND FT VHEPA" FT CDS complement(238203..240602) FT /transl_table=11 FT /locus_tag="RBRH_00574" FT /product="Peptide synthetase" FT /function="Peptide synthetase" FT /note="Peptide synthetase" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501" FT /db_xref="EnsemblGenomes-Gn:RBRH_00574" FT /db_xref="EnsemblGenomes-Tr:CBW76650" FT /db_xref="GOA:E5AU76" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020845" FT /db_xref="UniProtKB/TrEMBL:E5AU76" FT /protein_id="CBW76650.1" FT /translation="MIIQLSNAMSLHVTPNVSLQAEPHCDEATDNYDYLPLLSKGRPIS FT ALCHGMHVRVGNRSDASRLIARFHECIACAGLASDQAALWHEELPISSHSAAATRRITF FT ELSRPIDSGSSALRAVVLAFADDVAELILIGSRRFIDSPALRTIAKWLTGTDLPDTRAP FT FVRSYPATDNVPDSHRSASIPEWGLGGQPARPGYSATIGHVWDLAVNPRCLVEAISVVL FT TRFDGQTQAEFGMIGHPDMTGDAGLPAACVVRVSVKDDTSVAELAAEVNRCLSFAPETK FT ISGDVNITPVGIVWDDKREAYDEAIHVRSYLTPPFDLTLEPCVQDGHVVRIAYGFNQSC FT FSLEMVRAFDRALAIVCAELTREQGSGKNKALATIGLLDAASASQVAAIGTCGVLPADF FT TPFRIEQRIASFALSQPDAKALTFEDRSLTYLELEELANRIAGVLGMLGVREGDRVGVC FT LARSLELVPVMLAVLKAGAAYVPIDPGYPADRIAYTLKDACPSLVISDKAAAVAQNIRT FT IDVASLLERAAAFDSAVRPPAAESGVAAYVIYTSGSTGRPKGVVVPHRNVASLVAATAD FT DFELSSQDTWTMFHSSAFDFSVWEVWGCLATGGHLVVAPYWVTRSPDEFVQLLVREHVT FT VLSQTPSAFAQLIASESRSCEKLAVRLVIFGGEPLDTRMLLRWFDRYPETACRLVNMFG FT ITETTVHVTAETLTRAHALTNSRTVGRALPGWKVYVMDAYGHMLPPGVPGEIYVGGAGV FT AQHYLNREDLNAQRFLNDPFRRWPHVSQRRSRTFGNRRPPRTPRPS" FT CDS complement(240599..241423) FT /transl_table=11 FT /locus_tag="RBRH_00575" FT /product="Carveol dehydrogenase (EC 1.1.1.243)" FT /function="Carveol dehydrogenase (EC 1.1.1.243)" FT /EC_number="1.1.1.243" FT /note="Carveol dehydrogenase (EC 1.1.1.243)" FT /note="COG: Dehydrogenases with different specificities FT (related to short-chain alcohol dehydrogenases)" FT /note="Pfam: short chain dehydrogenase::PF00106" FT /db_xref="EnsemblGenomes-Gn:RBRH_00575" FT /db_xref="EnsemblGenomes-Tr:CBW76651" FT /db_xref="GOA:E5AU78" FT /db_xref="InterPro:IPR002198" FT /db_xref="InterPro:IPR002347" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR020904" FT /db_xref="UniProtKB/TrEMBL:E5AU78" FT /protein_id="CBW76651.1" FT /translation="MQLNGKVAVITGAARGIGRACAQQFAREGAQLILLDIANDINGVP FT YPLGSQSQLACTEALCRAEGAPAWALSVDVRDPHAIHEAIEFAIKRCGSIDVLLNNAGI FT AAPSGKAVHEIDENEWQLMIDVDLSGAWRMIRAVGQSMLERRSGSIINVSSTAGLVGYR FT HFAGYVAAKHGVIGLTRAAALDFAPFKVRVNAICPGSVRDDAGVEGRMLSEIARSLSVS FT VDEHEATFVQAQPMNALIEPEDIASAAVWLASDGARQVTGSIVTVDGGFSAR" FT CDS complement(241413..242126) FT /transl_table=11 FT /locus_tag="RBRH_00576" FT /product="Thioesterase (EC 3.1.2.-)" FT /function="Thioesterase (EC 3.1.2.-)" FT /EC_number="3.1.2.-" FT /note="Thioesterase (EC 3.1.2.-)" FT /note="COG: Predicted thioesterase involved in FT non-ribosomal peptide biosynthesis" FT /note="Pfam: Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00576" FT /db_xref="EnsemblGenomes-Tr:CBW76652" FT /db_xref="GOA:E5AU77" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR012223" FT /db_xref="UniProtKB/TrEMBL:E5AU77" FT /protein_id="CBW76652.1" FT /translation="MRKLFCFPFAGAGASVFRPWIEPLSDSIEVVSVQLPGREQLLAAP FT PFTNVHQAISKLSTHLAPAVAEAHEIVIFGHSLGAVLAYEFAKTIHADKSCLLMVSGSP FT APSRMREQRATGLDDEQFVERVRELAGYSHPALEDPDMRELLLPTLRADVEMHEGYKPI FT STTALKMPIVGVRGDRDELVSREDVVAWGDATQSVFEYVEVEGGHMYLTETPERLFDLF FT RQAGNRMLSGKRYAA" FT CDS 243037..244068 FT /transl_table=11 FT /locus_tag="RBRH_00577" FT /db_xref="EnsemblGenomes-Gn:RBRH_00577" FT /db_xref="EnsemblGenomes-Tr:CBW76653" FT /db_xref="InterPro:IPR003347" FT /db_xref="UniProtKB/TrEMBL:E5AU79" FT /protein_id="CBW76653.1" FT /translation="MNMNNHMQINRVRNISTDDFNELVQLYQPFILENAIEDWGALTKW FT TPAYLRHALGGLQVKCKHSDTHIHPNIGSYYETQKPISRWRYFLKRIRPKSSKEAMSLK FT SMSFGEYLDLISDPVEGARYYLTGDELLIFNGKWSPELEVLRDDFILPKYFDEQSMNSA FT GLWFSAKGVRSHLHFDGGGSHNLNAQITGRKYVQMYSPYQMSSLYPYYFTHFSNIGRYN FT FSKIDVENFSKKKFPLFDGVECHEGEIKKGDLLFVPAYWYHSFKHLDEFNSNINFWWVP FT ESIQLSPVSARDALMRASQKILSKNKVAPFGLLKLINRLEENIIKETFEENGGKLSRSG FT VQI" FT CDS 244545..252092 FT /transl_table=11 FT /locus_tag="RBRH_00578" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
NAD dependent epimerase/dehydratase FT family::PF01370
Male sterility FT protein::PF07993
Phosphopantetheine attachment FT site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_00578" FT /db_xref="EnsemblGenomes-Tr:CBW76654" FT /db_xref="GOA:E5AU80" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR010080" FT /db_xref="InterPro:IPR013120" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AU80" FT /protein_id="CBW76654.1" FT /translation="MSDSITSSMHPLTTGQTAIWLAQQLRPDSPVYNIGQYTSIEGAID FT PAVFEAAMRQVVDEVDSLRLQFVESNEGVRQYVGSPEWSFPLVDFSAESDPQAAADAWM FT RADYEQPVDILKGPLFNYALLKVAPDRVLWYQRCHHIVMDGFGFFLIAQRVAHLYSAMC FT EGTELEPCPFGSVHQLFESDVQYSASAQWKRDEAYWLKRCADWSSPATLASRSAPPLQH FT RLRQTIYFSAQSIERYADDANRLAQLITAAMAAYFYRLTGVEDVVLGFPVTARFGADRN FT TPGMMSNVLPVRIAVQPDMNLSSLMQHAAQEIQRGFRYQRYPNEALRRKLGLMPDQRLL FT GTMVNVMPFDYDLKFGGCKSINYNLLNGPVEDLMVAVYTLPGSHQLRIDFNANPACYTK FT DELVAHQRRFIQFLETLAADPERPIKDIELLDAAERHLLLVERNTTQCDYPADWCVHQM FT VEAQVARTPDATALVYNAQTLSYAQLNAQANRLAHRLVELGVKPDARVAICVERSPAMV FT VGLLAILKAGGAYVPLNPAYPNERLAHILADAEPVIVLADMAGRAALGETMLASRTVLD FT PNVPSQCADTNPSVAQLTARHLMYVIYTSGSSGAPKGVQNEHQALVNRLIWMQQAYQLT FT PADRVLQKTPFDFDVSVWEFFWTLMSGATLVVAAPDAHRDTAALTDLIIRQRITTVHFV FT PSMLEPFLRSEGVQYCTSLKRLFCSGEALPGASVKLCRTLLPDTQLYNLYGPTEAAIDV FT TAWCCPANYAEETVPIGKPIANTCIYLLDRHGHLVPSGAVGELYIGGAGVARGYLNRPE FT LTAACFLSDPFSTAPNARMYKTGDFARYLPDGNLEFMGRSDHQVKVRGYRVELSEIETV FT LQRHPDVAQAIVAIRDDRQGHKQLIGYVVADPQGKNKLDVAGLRQHVAHHLPEYMVPVA FT VVLLDALPLTPSGKVDRHALPEPEVVSGYSRTPRSPQEQKLAELFAEVLDVQQVGIDDN FT FFDLGGTSLLAMRLVSRIRTVLDVEFTIRMLYENLTVASLAQRLTQNTAVRPPLRPQQR FT PEPLPLSFAQSRLWFIQQLNGPSAIYNIPVALRLSGELNVDALQTAFHDLLARHESLRT FT GFTEVDGVPAQHIFAQEDIHFLLEIVKVTEQTLPDALKQAAARPFNLHEGIPLRAALFR FT LDAQEHVLLVTLHHIAGDGWSWTPFGRDLSKAYASRLVGEAPDWEPLPVQYADYTLWQR FT NLLSCEDKADSLIAQQLEYWRQALAGLPERLMLPTDRPHPPVASHKGACLSFHIDANLH FT RQLLVLAREQQASLFMVLHAALATLLTRMGSGNDIAVGSPIAGRTDEALNNLVGFFVNT FT LVLRTNTSGNPHFRALLQQVRETCLAAYSRQDLQFERLVEVLNPARSSAHHPLFQVSLT FT MYNNALPQFNLAGLHIEEEKVELLVTKLDISFHFDETPNENGINAIVQYATDLFDRKTI FT EQLTQRFVRLLESVTQEPDQPIGNIRLLDDAERRKLLIEWNDTIRPIRETTLPALFEDQ FT VAKTPNAIALVFNGQSVSYAELDIRANRLAHFLIAKGVGPEDVVAIAMPRSPSMVIAML FT AVLKAGAAYLPLDPHHSAERFFITLSDAQPVAMLRFGQANQTVANNLLVLQLDDLDLQA FT ALETCPNVAPTDRDRISPLNPRHPAYVIYTSGSTGTPKGVVVTHHSLVNYIDSIQSWVS FT EHANMVWISNVSADLGNTSLYGAIFSGKKLTIVRDEEILDPKFISENYLEDESVFKITP FT SHLSSLIKSMPNKGDNSKRTFFLGGERIDGELVAGIRLNWRNSRIINHYGPTEATIGML FT VGELPHEISLESTPFLPLGRPISNTQAYVLDNGLQPVPVGVAGELYIAGSSLARGYLDR FT PGLTSERFVADPFGPPGSRMYRSGDLMKWRSDGSLDFLGRVDDQVKIRGFRIELREIEA FT VLRRNPAVRQVAVITRDDHSGSQQLVSYVVPKGDGTSIDPVLLRRQIAQQLPDYMVPAA FT IVLLDALPLTPNGKLDRKALPIPSFTSERYRAPDTLQEQALATLFAKALNLPHVGIDDS FT FFDLGGHSLSAVQLTLKIQKVFNVNVPVRMLFEADTVAKLAERIESDALATSQSADSDG FT TEQLMRADALLAEDISKKTISNDSHGTWENVLLTGATGFVGRYILLELLRQTNANVICL FT VNEKDKKEAMKRVVSALKETQRQDLDISRISTICGDLSKKDFGLSHQEIEYLSDKVDAI FT LHNGAAVNHFFSYHELRQANVLATEALIRLSATGRSKSFHYVSTVSVMPRAKTGTFTEI FT SDTSIMPIANGYVQSKWVGEQLTSAAAMRGIPSSIYRLGRITADSQTGYCNMKDSVYRI FT ICAIKTLGLSFNTNKLFFQTPVDCAAQAIVKLATRQDKSYQVAHIMNNQSLKLNDFVCE FT IDKKENCSIKNVDFNEWLARLKERADETLDENLMSLLSIMDKNTLEDKKRDPLENSESL FT ISISAEDTINKLRELGFEYPSVENDYIESIIDFLMKQEAKIMLEGDVVVRK" FT CDS 252140..253387 FT /transl_table=11 FT /locus_tag="RBRH_04238" FT /db_xref="EnsemblGenomes-Gn:RBRH_04238" FT /db_xref="EnsemblGenomes-Tr:CBW76655" FT /db_xref="GOA:E5AU81" FT /db_xref="InterPro:IPR003819" FT /db_xref="UniProtKB/TrEMBL:E5AU81" FT /protein_id="CBW76655.1" FT /translation="MENQYKGVTTRALRNDERAISSSEPQTPLVIEPLHSKNRNFLKRF FT MKENSCQIISDIERYGAVLFRGFDIHSAADFEEQVLSIQGMRGMSEFMMSEPGRITVSG FT TRHVIHPNVNFKTGGTLDPVGGIHSESYYVPDVPRFISFFCEKPPLLGGETGLFDICKI FT YNDLPERLKEKLEQQRYLAGIFSIWQIAKRYNLPYEVAKDFCEKIDMSMVDYHGDQYAF FT MYKPSVAEHPTTKEKSIIIHFAGELNGHGLTKELIRQFSSDYASFKWCIHRLVWSFPYI FT RKNLFALRHPIIVLTCGGRLMGRVFDSSSNVIPSRETDNLRVGNVFEKEEIQLIAKLMR FT KYHSSFPWKRGDFIIIDNLKLAHAGMPGLGSRIIKVLMCNPLNMTYGKNSSGLYKAEEA FT AETRGAEVIKCSSACV" FT CDS complement(253449..253562) FT /transl_table=11 FT /locus_tag="RBRH_00579" FT /db_xref="EnsemblGenomes-Gn:RBRH_00579" FT /db_xref="EnsemblGenomes-Tr:CBW76656" FT /db_xref="UniProtKB/TrEMBL:E5AU82" FT /protein_id="CBW76656.1" FT /translation="MNNLHQKNIGILAFSIIHHINYAYYSTLYFRIKLYAP" FT CDS 253561..254046 FT /transl_table=11 FT /locus_tag="RBRH_04239" FT /product="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /function="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /EC_number="2.6.1.18" FT /note="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /note="COG: Adenosylmethionine-8-amino-7-oxononanoate FT aminotransferase" FT /db_xref="EnsemblGenomes-Gn:RBRH_04239" FT /db_xref="EnsemblGenomes-Tr:CBW76657" FT /db_xref="GOA:E5AU83" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:E5AU83" FT /protein_id="CBW76657.1" FT /translation="MTSHAVLDDMSHFWMPFTANRQFKMAPRLFESAKGMYYWTSDGQQ FT ILDACAGLWCINAGHCREEIISAVSTAMAKLDYAPTVQFGHPLAFEAASKVARLMPEGL FT NRIFFTNSGSEAVDTALKIALAYHRARGEGQRTCFIGRDGSYHGAGFGGYVGWWNRG" FT CDS 253928..254884 FT /transl_table=11 FT /locus_tag="RBRH_00580" FT /product="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /function="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /EC_number="2.6.1.18" FT /note="Omega-amino acid--pyruvate aminotransferase (EC FT 2.6.1.18)" FT /note="COG: Adenosylmethionine-8-amino-7-oxononanoate FT aminotransferase" FT /note="Pfam: Aminotransferase class-III::PF00202" FT /db_xref="EnsemblGenomes-Gn:RBRH_00580" FT /db_xref="EnsemblGenomes-Tr:CBW76658" FT /db_xref="GOA:E5AU84" FT /db_xref="InterPro:IPR005814" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:E5AU84" FT /protein_id="CBW76658.1" FT /translation="MRLLTIGRAAKANVLVLLVETVAIMVLDSVGMSVGGIGANRKAFS FT GSLLPRTNHMPTIHNLEHNAFSRGQPAWGAHLADELERLIAVNDPSTIAAVIVDPTAGT FT VLVPPQGYLQRLREITAKHGILLIFDEVITGFGRLGKATASEFFGVTPDLLTMAKAINS FT GAIPMGGVAAHQRIYDTIVDGTEPEEVELFHGYTYSAHPTAAAAAIAALNIYHNEKLFD FT RAALLAPIFEDAVHALRDVPYVKDIRNIGLCAAIELEPRPNGEGNRAKEAFAKCFEAGV FT LIRQGGNILAFAPPLIIDEAQIGQIFETVRKVLVDIK" FT CDS 255135..256532 FT /transl_table=11 FT /locus_tag="RBRH_00581" FT /product="Na+ driven multidrug efflux pump" FT /function="Na+ driven multidrug efflux pump" FT /note="Na+ driven multidrug efflux pump" FT /note="COG: Na+-driven multidrug efflux pump" FT /note="Pfam: MatE::PF01554" FT /db_xref="EnsemblGenomes-Gn:RBRH_00581" FT /db_xref="EnsemblGenomes-Tr:CBW76659" FT /db_xref="GOA:E5AU85" FT /db_xref="InterPro:IPR002528" FT /db_xref="UniProtKB/TrEMBL:E5AU85" FT /protein_id="CBW76659.1" FT /translation="MSFYKKSGYDISVPFTWPRIQEEVRAILALAVPLFGGHLSFIGTG FT LINVMLAGQLSAHVLAAVTIGSSVWMLAVLVLSGLMMALQALVAQLKGAGRHAEVGPLF FT LQALWGSIMLSLFLTALACFLGPFLIQFIATTPELVRDTRNFLFAICIAGPALGIFYAC FT RGLFEGLSMARQTFKFNLIGFALTGPIGYVLMYGAFGLPALGAVGNGIAGGIIAWVQTL FT AFLVYIYRKGFYFKLRHQVGSVMPKFKIIYDLLRFGLSVGMTRLIEGGFFIASALVIGR FT IGAESVANHQIAINTVAIACTVSFVLSVAITVRVAQAKGCGNPDDIWKSGIIGIGLTFF FT TQSCCGCLILLGSNSIVSLYTSDSSIIANSAILMQFACLLQLLDGLQTVFCGVLRGLRD FT TRVPIFITFFAYWIVGMPVGWWLSITRHWGMVGMWIGLIVGLGLAGGLLLVRFVRISHG FT GRLYNRQ" FT CDS 256714..256995 FT /transl_table=11 FT /locus_tag="RBRH_00582" FT /note="COG: Dihydroxyacid dehydratase/phosphogluconate FT dehydratase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00582" FT /db_xref="EnsemblGenomes-Tr:CBW76660" FT /db_xref="GOA:E5AU86" FT /db_xref="InterPro:IPR000581" FT /db_xref="InterPro:IPR015928" FT /db_xref="UniProtKB/TrEMBL:E5AU86" FT /protein_id="CBW76660.1" FT /translation="MVCHRAVPLMQHTGLAVLRGNLAPDGAVIQTGAADPGLLVRTRPA FT VVSRDYNDMTARIESDALFVDQYRVIVLQHAGPARAPGVPEWGQLPSS" FT CDS 257083..257559 FT /transl_table=11 FT /locus_tag="RBRH_00583" FT /product="Large-conductance mechanosensitive channel" FT /function="Large-conductance mechanosensitive channel" FT /note="Large-conductance mechanosensitive channel" FT /note="COG: Large-conductance mechanosensitive channel" FT /note="Pfam: Large-conductance mechanosensitive channel, FT MscL::PF01741" FT /db_xref="EnsemblGenomes-Gn:RBRH_00583" FT /db_xref="EnsemblGenomes-Tr:CBW76661" FT /db_xref="GOA:E5AU87" FT /db_xref="InterPro:IPR001185" FT /db_xref="InterPro:IPR019823" FT /db_xref="UniProtKB/TrEMBL:E5AU87" FT /protein_id="CBW76661.1" FT /translation="MAQLIQEFKQFAIKGNVMDLAVGVIIGGAFSTIVNSVVKDLIMPV FT IGAVTGGLDFSNKFIRIGHVPATFMGNPGSYKDLQAAGVAVFGYGAFITVVVNFLILAV FT IVFLLVKAVNELRRLDAHKAEETPAASAPPSEDILLLREIRDALKRSDDGVERT" FT CDS complement(257914..258408) FT /transl_table=11 FT /locus_tag="RBRH_00585" FT /product="CoA-transferase family III protein" FT /function="CoA-transferase family III protein" FT /note="CoA-transferase family III protein" FT /note="COG: Predicted acyl-CoA transferases/carnitine FT dehydratase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00585" FT /db_xref="EnsemblGenomes-Tr:CBW76662" FT /db_xref="GOA:E5AU88" FT /db_xref="InterPro:IPR003673" FT /db_xref="InterPro:IPR023606" FT /db_xref="UniProtKB/TrEMBL:E5AU88" FT /protein_id="CBW76662.1" FT /translation="MPYQVFAAKDGQMVLTIGNDGQFRKFCEVVHCASWATDPRFATNA FT ARVTHRDTLIPIIQQVLNTRTIEQWIGPLTSAGVPCGPINNIAQTFTNPQVVHRGMRAD FT LAHPLAGTVPTVANPIKMSGSPIHYRGAPPTLGQHTKSVLSSVCGLDSEEIARLRNARV FT I" FT CDS 258484..258849 FT /transl_table=11 FT /locus_tag="RBRH_00586" FT /product="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /function="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /EC_number="1.3.99.2" FT /note="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /note="COG: Acyl-CoA dehydrogenases" FT /note="Pfam: Acyl-CoA dehydrogenase, middle FT domain::PF02770" FT /db_xref="EnsemblGenomes-Gn:RBRH_00586" FT /db_xref="EnsemblGenomes-Tr:CBW76663" FT /db_xref="GOA:E5AU89" FT /db_xref="InterPro:IPR006089" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009100" FT /db_xref="UniProtKB/TrEMBL:E5AU89" FT /protein_id="CBW76663.1" FT /translation="MVRRSRRPATCLGWRPENLIASFALTEPGAGSDAASLRTRAERDD FT EYVINGTKRFITNAPEAGIYTVMARTQPDIAGADGISAILVERGTPGLSLGKPDKKMGQ FT RGAHTCDVIFENCRVPV" FT CDS 258892..259407 FT /transl_table=11 FT /locus_tag="RBRH_00587" FT /product="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /function="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /EC_number="1.3.99.2" FT /note="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /note="COG: Acyl-CoA dehydrogenases" FT /note="Pfam: Acyl-CoA dehydrogenase, C-terminal FT domain::PF00441
Acyl-CoA dehydrogenase, C-terminal FT domain::PF08028" FT /db_xref="EnsemblGenomes-Gn:RBRH_00587" FT /db_xref="EnsemblGenomes-Tr:CBW76664" FT /db_xref="GOA:E5AU90" FT /db_xref="InterPro:IPR006089" FT /db_xref="InterPro:IPR009075" FT /db_xref="UniProtKB/TrEMBL:E5AU90" FT /protein_id="CBW76664.1" FT /translation="MKVLDKGRLHIAAICVGAAQRMLDDALRYAMQREQFGQPIAEFQL FT IQAMLADSQAEIYAARSMVLDTARRRDNNEDVSMEASCCKLFASEMCGRVADRAVQIHG FT GAGYVSEYAIERFCRDVRLFRNLALRSAGMICSAGRSKSVSNIAARHTRAFRQAGSPTG FT WHAQRRSG" FT CDS 259674..259829 FT /transl_table=11 FT /locus_tag="RBRH_00588" FT /db_xref="EnsemblGenomes-Gn:RBRH_00588" FT /db_xref="EnsemblGenomes-Tr:CBW76665" FT /db_xref="UniProtKB/TrEMBL:E5AU91" FT /protein_id="CBW76665.1" FT /translation="MAYASQGRHRASAGTASGEIVTPPCGERSDSTLLLDYRGVEQWRF FT DDGRVD" FT CDS 260565..263870 FT /transl_table=11 FT /locus_tag="RBRH_00589" FT /product="Insecticidal toxin complex protein TcaA" FT /function="Insecticidal toxin complex protein TcaA" FT /note="Insecticidal toxin complex protein TcaA" FT /note="COG: Rhs family protein" FT /note="Pfam: Salmonella virulence plasmid 28.1kDa A FT protein::PF03538" FT /db_xref="EnsemblGenomes-Gn:RBRH_00589" FT /db_xref="EnsemblGenomes-Tr:CBW76666" FT /db_xref="InterPro:IPR018003" FT /db_xref="UniProtKB/TrEMBL:E5AU92" FT /protein_id="CBW76666.1" FT /translation="MFSIAKIMPDLFTSQSGNADQHLLDAGYRNVFDIALTSRAAFIES FT VPALTAKDARAVYHQARQRATNLKALYRAWQLHQEPVIQRLTKLNTRPDAPLLKDALVR FT NIGGDGDFTDLMERASAYADATSIQSLFSPGRYAAALYRVASALHDADSNLHIDQRRPD FT LKNLVLSEATMQQEVTSLDILLQVLQSGSEGISALSDRYFPMTLPYDDNLTQINVALSA FT QARTLNGLWDTLTDSTAKAVSQQALALGAARRAENVRADSVYLTGNVFYLQALDGDTEP FT MVYLSHYTNGNGVVGAQLVAGNADNAAAAIVAPLVLTWSVAQHCYYLGVPDGTQMAGNA FT ANVLNGCFLRGNHNTNPDKDGDFAQMASRSGGTKPMSSFHLPITLIPGKQKNQYYLKTD FT KGYVGVDNSGQSNWKAALIVTAPRDKALLVMMCQDDAGNPIEDGSTPFPEVVFEQPSPP FT ARETLSMTPVSYQLMTNTDLSETDIADHYGMEGAGLRSAGALATTLNPISTFCEKTRLN FT FNQLLELTAQQSYLDNGKESRAYSRFLHFGEQEPTRVNVYGAAYLNGTLGDTETDQSRY FT LWVQKDGKNLNLMDDTVVELAGRAEKLVRLSHLTGLSFEALDWVIVNASRCVPEHHNKP FT VLDKPVLEALAEYVRLKQRYGLDVNTFVTFIDAANTYAPDQVSSFYASTFRPADGGDAI FT ALGTAVNYKQNQQDELSTICCKALGVTSDEFARIGGWCFGRAGKFTLDEHTAGQLYRFG FT AIPRLLGLTFAQAEVLWRLMGGGQDTLLEQLGQPQSLAPLAILSRTEKILDWMASVGLN FT LLQLQGMVSTVWSGTATAEMFNFLKNVCDSVNPSSTAATRQDALDEALQQKVLRALAAG FT FNLKSNVMGGVTTWLEKLTAQTDSAFTLAHYWYAIQTRFSQANVNLDDLQKDTGLVLTT FT QRLSQLVLIAQWLTLTEQDLQLLTAYPARLIGAAVTVPTPDMAVLLTLSRFKQWQTQVV FT VSRDEAMRCFDQLNAKEMTLGKAAELIAALHQLDANTVAQMSVSLLGEDTWPKSFDVLW FT QLLTWLRVGQALNVGTTTLEQLQTMMQADPSAEDRTLLASVARNLSAGISARR" FT CDS 263893..267501 FT /transl_table=11 FT /locus_tag="RBRH_00591" FT /product="Insecticidal toxin complex protein TccB" FT /function="Insecticidal toxin complex protein TccB" FT /note="Insecticidal toxin complex protein TccB" FT /db_xref="EnsemblGenomes-Gn:RBRH_00591" FT /db_xref="EnsemblGenomes-Tr:CBW76667" FT /db_xref="UniProtKB/TrEMBL:E5AU93" FT /protein_id="CBW76667.1" FT /translation="MSASLFSQTLKEARRDALVDRYIATQVPADLKDRIHNANDLYEYL FT LLDTQISDRVSTSPLAEAISSLQLFIHRAIEGYDGALAEDAKSYFAQEHFLYNWDAFNR FT RYSTWAGKERLKFYAGNYIDPTLRLNKTQLFQTLEQGISQGKLSDALVQSKISEYLAEY FT NTLSNLEYIHAAKGGDEKTVFFAARTQNQPYKFYWRKLTLAAREDERGPIPIQWTEWRE FT IAAGIADPYKGLVKLFWDKSRLNVCWYNKIDKGDEGFSCAKNIWCMDNNFSWASKEKRF FT AYCFEEIERKGVTGTVEDQHIKTQYSSDAEFIFCKDYFVLKNADSGVQPGFGVTLGDES FT GNIIKTLSDLGDYIFYNNDFYPKKILKISHGKGDSGSNYLIFSCNGSFSDFGKIEKLKD FT FINYDSYGEFTTSGNFKLSSDGEEISLSLTNNVDLPKLFDDRHDALFNYSVQKDLGGLT FT AFSGPYGMYLWEIFFHIPFLVAVRMQTEQRYDEANTWFKRIFNSSGYRDDDGNLLYDDN FT SNPRYWNVLPLQLDTAWDTSQPATTDPDVIAVADPMHYKLAIFLHVLDLLIARGDHAYR FT MLERDTLVEAKMYYIQAQQLLGPRPDIRITNTWPNPTLSAEAGAIDKPTRSHLSGALTF FT ASWLRTGDAADMGDGHFLPPYNDVLLGYWDKLELRLYNLRHNLSLDGQPLNLPLYATPV FT DPAELQRQQAGGDDASSGVMSSQGHVQGWRYPLVADRARSAVGLLTQFGSSLQLALERQ FT DNEKMTLLLQTQQQIVLKQQADLQQSNLKGLQHSLSALQASRDGATLRQSHFRNLIDGN FT LSAAEIAGLTLRSTAMTTNLAATGLLIAGGVADAVPNTFGLANGGSQWGAPVLGTAHAT FT QAVAVAQDQSAGISEVTASYQRRQEEWQLQHDIAKNEVTQLDAQIKSLTEQIAMAQKQI FT ALAETEQAHAQALYEFQTTRFTGQALYNWLAARLSALYYQLYDVTLPICLQAKAALVQE FT LGDQDTDGVFRVPVWDNLWQGLLAGEGLSVELQKLDSIWLARGAMGLEATRTVSLATLF FT GAETFKDKLQTVLDGNPVDPSGGVRLSLTDNIFQATLDLSVLELDKSYNMKGKTRRIKS FT VAVTLPTLLGPYQDIEATLIFGKETATLSHGLNDSGRFVTDLNDSRFLPFEGMDVTQGT FT LSLNIFHAGKDDGAQRDVVANLNDIIVHLHYIIRDT" FT CDS 267726..273725 FT /transl_table=11 FT /locus_tag="RBRH_00592" FT /product="Insecticidal toxin complex protein TcaC" FT /function="Insecticidal toxin complex protein TcaC" FT /note="Insecticidal toxin complex protein TcaC" FT /note="COG: Rhs family protein" FT /note="Pfam: Salmonella virulence plasmid 65kDa B FT protein::PF03534" FT /db_xref="EnsemblGenomes-Gn:RBRH_00592" FT /db_xref="EnsemblGenomes-Tr:CBW76668" FT /db_xref="GOA:E5AU94" FT /db_xref="InterPro:IPR003284" FT /db_xref="InterPro:IPR022044" FT /db_xref="InterPro:IPR022045" FT /db_xref="UniProtKB/TrEMBL:E5AU94" FT /protein_id="CBW76668.1" FT /translation="MMDRTIRAESNTPRVIELPSLSLPKGGGAIQGLSETLSVGGVSGA FT ASLTLTLPTTDAGGITPALALAYSSGAGNGAFGLGVALSMPSISRRTAKGVPRYTDTDE FT FVDAGGEVLVRVGETADQTLNDRVFHVTPYAPRIASSFDRLDYWQAQDDASCAFWRVQA FT ADGTQHLFGYTQAARLADPATPEHIARWCLEESVTPHGEHVYYAYQGEDNSGIDTSVPV FT EQPRERRAQRYLKRVCYGNRQACADLYLMSGTPVPTNWYFELVFDYGEHAADANAIPTY FT APQRAWCARLDPFSDYAAGFEVRTHRLCRQVLMFHRFEALGPDPVLVRRLYLEYDEQPV FT LSRLRAAWMTGYGPDPASGEPAAVSLPPVELDFGTFVLGQGQFESFAPLAGLNDGMVYQ FT LVDLYGEGVPGVLYRDGTSYWYRAPVRAENGEDAIAYEAWQALPQLPVGGLGPNTRQSL FT MDLTGNGQLDWVIAQPGLAGFFALGPDKHWQAFVPFSAFPTEFLHPDAQLVNLVGAGLP FT DLALIGPKSVRLYANRREAGFDRPEEVPYTPPGRLPGNNGAHTELVAFSDVLGSGQPHL FT VRVRHDTLVCWPNLGRARLGAPITLATLPFEAHTFHPARVRLADLDGSGAADLIYLDST FT SFQVFFNHGGNGLAEPVVFAWPDGVHYDDTCQVSFADIHGTGCAALVLTVPHPTPRHWV FT CDFVAGKKPYLLERVNNNRGLDTQLTYRSSAQAWLDEKQATPDAVSHLPFPVQVISQVT FT HTDEITGNTLTQTYQYRHGFYDGYEREFAGFGSLEQWDTERNASNADDDTLTAPVLTKT FT WFRVGAEQDDAPHADYYAGDEKAPALGPTRWTDDQHQPIAQPDAELLRAMRRALRGRVM FT REEVYGVDDTPAAAHPYTVTEYRYQVRVVHDAPDARVLLPMQLEQWSAQYERMPDDPMM FT THQVLLQADQYGYPTDTATVHYPRRTNPAPSDECQDTQQQQLRVTRTQQRWIHLNQPNA FT PWRLGLPCEAKAQALQPPASAGEWLGYEQLTDGRMDTAPGELIHWQRQNYADAHDSVLP FT FGQASVEGLLACTWQAEMTLEMLQQACDGLPPPGALEPWVEQARYRIEEGYYWIESPRA FT HYLGASHFYRLSHQRDAFGAETHIEYDGSGLCVTRVTDALGYVMQADHDYRRLQPTCVV FT DVNENRHEAAYDPLGRVRVTSFYGTQGDGKVGFAPVNEYRSAVTTLDAALADPAGAIQH FT AASVWYDALSSWMGRLEPSTLNESEQAMLCRHGLLTADGQIRARWRWLTAAPPGLSLER FT WAHIQVQLEQAPRTPMHTVRFTSDGYPDNAHQQIRCTVAFTDGLGRALQTKQRVAAGPA FT WTSDAHGNLVLEAGQPVSQDTPTRWAVSGLVEYNNKGLAVRVYQPYFIDTPRYVNDASL FT RQCAPHDTLYYDPLGRNTRVQTAAGYQRRSRFEVWFDTHEDENDTGDDPLYRGTPTVEV FT RDNRGLTVRQIRYNRVPDDPERQVLVTRHAFDASGALVSSADPRHVGPDTVNFHYQRTL FT SGQLLRTDSVDAGAQLQLRDARGLITWMASGNGHGQHWTYDLLGRPIARFEQPAGVTQA FT CRERLIYGAPDSDARRNDRGQLVRHADPAGINEIGGYSLSGEPLSETRGFLATLDAPDW FT PEDEAAQRALLESERYISRWTYNALGETVTHTDAGGHCRRYELNIAGQLQTVWLRLAGQ FT NERCVASDFIYNAASQPLQVRAGNGVVRTYVYEVSTQRLSCLSAQRERDATVLQNLIYT FT YDPVGNITRIEDAAQPVHYTRNQRVEAASDYRYDALYQLVQATGRESAQASQQSAALPL FT WQSLDATQRVNYTRQYTYDASGNLCQMQHTGAQHYTLRMVVAAGSNRAVPEAWDAAPEQ FT VDRYFDANGNLTQLQPGQPVDWNTCDQLSRVVQIERGDNESDDERYAYSSAGQRARKVR FT RWRAGSQQHSDDVRYLPGLERREHRQADVDDPTRSNVTEALQVVVVDASGIALRVMHWE FT AGKPEHD" FT CDS 273736..274875 FT /transl_table=11 FT /locus_tag="RBRH_04240" FT /product="INSECTICIDAL TOXIN COMPLEX PROTEIN TCCC" FT /function="INSECTICIDAL TOXIN COMPLEX PROTEIN TCCC" FT /note="INSECTICIDAL TOXIN COMPLEX PROTEIN TCCC" FT /note="COG: Rhs family protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_04240" FT /db_xref="EnsemblGenomes-Tr:CBW76669" FT /db_xref="InterPro:IPR022385" FT /db_xref="UniProtKB/TrEMBL:E5AU95" FT /protein_id="CBW76669.1" FT /translation="MRYSLDNQLGSSTLELDNTGQLLTYEEYYPYGGTAVWAAKSELEA FT KYKYVRYSGKERDATGLYYYGYRYYMPWLGRWLNPDPARIVDGLNLYQMVKNSPILRYD FT DNGLMWKTAITGVTGVAGVVYEAYKHRQKLPAHSETEIKAHEASKKTYGDQKADEIINK FT IGERKDKFDISIKIEETIIGRVKAVGHVAQGKVPGVEALKTGVDTVATVGEFATTGDVK FT QVNKSALTKAAATDAYNNLGLSVEAIKKASKGAAVATTMSSEKNEELVTAANQFKEEVK FT DEVITGVATGMSVGAVLDGAAAVVPHPAAKIALKGASVLWRVGGAVNMAEKVAEASEKH FT KEAISSEFGHEAFSQMKNINSIKRGEILEKYKIMTGGKS" FT CDS 275177..275308 FT /transl_table=11 FT /locus_tag="RBRH_00593" FT /db_xref="EnsemblGenomes-Gn:RBRH_00593" FT /db_xref="EnsemblGenomes-Tr:CBW76670" FT /db_xref="UniProtKB/TrEMBL:E5AU96" FT /protein_id="CBW76670.1" FT /translation="MARASQERHRASAGTAPGEIVTSPCGGRSDSTLLLDYRGVEQW" FT CDS complement(275344..275439) FT /transl_table=11 FT /locus_tag="RBRH_04241" FT /db_xref="EnsemblGenomes-Gn:RBRH_04241" FT /db_xref="EnsemblGenomes-Tr:CBW76671" FT /db_xref="UniProtKB/TrEMBL:E5AU97" FT /protein_id="CBW76671.1" FT /translation="MPWAPSGVDLPGLCRLAEGRGCVTSTIRAIA" FT CDS complement(275569..275703) FT /transl_table=11 FT /locus_tag="RBRH_00595" FT /db_xref="EnsemblGenomes-Gn:RBRH_00595" FT /db_xref="EnsemblGenomes-Tr:CBW76672" FT /db_xref="UniProtKB/TrEMBL:E5AU99" FT /protein_id="CBW76672.1" FT /translation="MPRRREVIVFKLGYFFIFFPPDVVFIQQKRLLRCTRSLTGRLIV" FT CDS 275906..279085 FT /transl_table=11 FT /locus_tag="RBRH_00596" FT /product="Insecticidal toxin complex protein TccA" FT /function="Insecticidal toxin complex protein TccA" FT /note="Insecticidal toxin complex protein TccA" FT /note="Pfam: Salmonella virulence plasmid 28.1kDa A FT protein::PF03538" FT /db_xref="EnsemblGenomes-Gn:RBRH_00596" FT /db_xref="EnsemblGenomes-Tr:CBW76673" FT /db_xref="InterPro:IPR018003" FT /db_xref="UniProtKB/TrEMBL:E5AU98" FT /protein_id="CBW76673.1" FT /translation="MPGGKMNQKTSPLINVLESRYGATGQLATLGYESVFDVSRVTREQ FT FIREHRERISVQSAGVLYDQALGYAQQVAFRFRQRRLTRLVQQTLGPFTVPGPSYDEQF FT QVNWHQMSAVDAIEANTSPAAYLVSLYNLAIKQENDNASAPGNNAIHPLAQRRPDIPKL FT VVDNDSLNQRLPALTMVNQILNSAIEPTLPTGKTVDEILAATYYPHTLPYHFAYQQTTE FT GFAVSGTSLADVIQQVDTAWPYFIKPITGTDTPARKHAIQLASPLAPPLQALLKTPPYF FT STHMLTLEQLTAQWGSGDYSTTEMTLWQDLSAHAYVTPLQESVVDGPTELIWNGEDVAA FT KITLKTSGGQTVVVRGKRKEYWNRSINNASMTDGAPYQRYPQLQFIDADNAELDLRKDP FT LRADFFIRMQQYSDNKSYYTDISFTLILDGNERPVLYTTTQKDFYKNQFGINPDLIVKD FT YPTYFSSVKILTERTGLTVSQLENMLCARVGGDTVVLSPNIVIRNAIFTNGHTDQTPHM FT PYHYGAVYLHAGKKPAIAMMQDDDGKLTLTGLTDDRLDRLNRLMRVQRAMQLPFDQLDQ FT LIIAGMRAEGADPRKADGNLGLYMNANTTRLLGVFCHYRQHYGATAEQFAALVHQITPY FT AITPNVPLLDRLFNSQRLFDEPYTLDWENVDYTATATTPNKGRDARIAKQLAAGLKLTD FT AEFALLAGLVAQHQGNITEHTFPNSLDAVSALYRLTTLARWLDMSIASALALIRLLDNA FT KMLGDDRPLLAQLAGVPSIAVLNENGEGKTHDVLDGLMLLSNAVHWLQAQNLTVEQCAM FT WLLPVPPHIGNQRQLDFIRQLSESVARTLVTPTHYDHSGAPSIDTEGKPIDWGVLMTEK FT ELVNAQGLVMDNAHTATQTQIEAAVRAVVDQQKLEAAEKAQATAALSALIYNAQQSQRG FT ILSSTLAQLLAQPQAVVSSLVRWAGSTPCALLQHTLALSELSSAQQIPADYLALLAMLT FT RGAQMSTCFQLSAAMLDAYLAHPAWFGETHSYVDGTRFCHVVSPRLLSRLVASNVTDRK FT RFARLFKLGQR" FT CDS 279467..283012 FT /transl_table=11 FT /locus_tag="RBRH_00597" FT /product="Insecticidal toxin complex protein TccB" FT /function="Insecticidal toxin complex protein TccB" FT /note="Insecticidal toxin complex protein TccB" FT /db_xref="EnsemblGenomes-Gn:RBRH_00597" FT /db_xref="EnsemblGenomes-Tr:CBW76674" FT /db_xref="UniProtKB/TrEMBL:E5AUA0" FT /protein_id="CBW76674.1" FT /translation="MQSNFAKQLNESRRDALQAYYLGYVAPTLPNVENQPVTADDLYQY FT LLIDTKVGKEVETSQVAQAIASLQQYLYRIALNQEPGFNPMSPQDVASWREIDSQYARW FT SASQQVSDYPENYIFPSTRQDKSHFFEELENSLNQNRLNADRVQDAVLSYLNEFEAVSN FT LLVINGCCSQIDFGGGTYYFIGRTAAEPHSYYWRSMDLSKNGGTDEYPQITPNCWNDWR FT AIDLPLNSRNVLSWTVRPVFFNNRLYVSWVERDPTPKKKSDGTNVTPEVHAYRVYYGYL FT RYDGSWSAPNTAELQEVKQDGGSSSVLSGGVLEIEEGTNFVLRKVDTVAIVDFSRGVLG FT GTRPEGNLFIGIFVYEGGQDKIPTQSAFLFCDTSFINIATTGDNVKPNFLVYRPGEQKN FT GIFYQSLQYSLQGKKYRIQSCEKRSSHTDSGIPSSWPDALAAPSVSIANDGLTLQVGAN FT LGRCPDETRDGGVWESLYVFPDTDQAPAGSTSNRTHYHLTAGDASRSIKFSFDGSNYRF FT YNTKIKYDAAYGNVDISAGVYTFYTATLPDYRGNWGGPLKFVTDGSHNIAFKGGVPTSK FT TLDLHGKSFRFYNNPATEIFFSVGPENGYWDSYHLTYAIKKNANKISVTYQFQHKLKVY FT TVQNGNEKSVVASNETAQRWVLQPTDHRAATHVISSEDYPNQGIITYHLRHEIVRTPSS FT GSAGSAYQTWSVQVELVSVDTPTQVPQLCTRYDSQQGNVQFITFNGVQAEDGGFALPDT FT RLNTTFVRELIRRANVSLGTLLHYTTQAMPQEPQLRVDSGAPDGRLQPMDFTSANGLYF FT WELFVHVPYLVATRFGDENQNTDAQHWLHYIFDPSAKDKATDAVTGLTPPDYWNVYPLC FT PLGEGAKVATASFLMRDALNPDAQAYANPVIYQKAVFMAYVRTLIATGDNEYRLLTPDG FT LTAARVFYDQARELMGPLPTVSMSSHWKPNTLEAIASQKHAAVRELEHEPGVQWLALPA FT QNLSLLSILDNPNFRPPLNTQLLTYWQMLEARLYNLRHSLTLDGKPLVLPLYATPADPL FT ALLTQRAQAGSLGNSGNGASQVILPYRFQSLLPSAYRAIDMLSQFGNTLLSVLERGENA FT HQLELSQQHLVDLSNFTISLQQQELDALNADVDTLQAQKAIAEQRYQYYLDSYNDNISR FT AEQESMDLANYRQLR" FT CDS 283009..284235 FT /transl_table=11 FT /locus_tag="RBRH_04242" FT /product="Insecticidal toxin complex protein TccB" FT /function="Insecticidal toxin complex protein TccB" FT /note="Insecticidal toxin complex protein TccB" FT /db_xref="EnsemblGenomes-Gn:RBRH_04242" FT /db_xref="EnsemblGenomes-Tr:CBW76675" FT /db_xref="UniProtKB/TrEMBL:E5AUA1" FT /protein_id="CBW76675.1" FT /translation="MTVSVAAMYAVAGGLDMAPNVFGLANGGSRWGAATQAVSLGMSVA FT RTAMEAKAGRLAQSEAYRRRRDDWRLQYEQAQLESQVIDKQLQALAIRQKAAQTVIDQA FT YTQQAQQQAMLDFLSSRFTQASLYQWLASQLSALYYQAYDAVLSLCMNVQACWQYELGD FT FSTYWVPTNAWNDNYRGLLVGETLSLSLQRMESAYLSRNDRRLNITRTFSLKALLADKP FT NDFEKQKAQGKFEFTLSEQDFDTNYPGHYARCLQQISVTLPTLTGPYQDVQALLTQTRS FT QTLLQPDIDGVRYMNNNQEGSGTHVVSNLRPSQQIALSSGIDDSGTFALLAQDGRYLPF FT EGTGAVSSWTLVFPRAVDETIDGRKLPADPAQQATLEALNDVLIQVQYTALDGGASFAN FT AVKQTLIPS" FT CDS 284433..288902 FT /transl_table=11 FT /locus_tag="RBRH_00598" FT /product="Insecticidal toxin complex protein TcaC" FT /function="Insecticidal toxin complex protein TcaC" FT /note="Insecticidal toxin complex protein TcaC" FT /note="COG: Rhs family protein" FT /note="Pfam: FG-GAP repeat::PF01839
Salmonella virulence FT plasmid 65kDa B protein::PF03534" FT /db_xref="EnsemblGenomes-Gn:RBRH_00598" FT /db_xref="EnsemblGenomes-Tr:CBW76676" FT /db_xref="GOA:E5AUA2" FT /db_xref="InterPro:IPR003284" FT /db_xref="InterPro:IPR022044" FT /db_xref="InterPro:IPR022045" FT /db_xref="UniProtKB/TrEMBL:E5AUA2" FT /protein_id="CBW76676.1" FT /translation="MNMPVTQSASNVTLSEPTLPKGGGAMRGLGEALGPVGSSGVATMT FT LPLPISAGRGYAPQLALRYASGSGNGPFGVGWHLGLTSIGRRTACGTPQYGDEDEFIGP FT GGDVLEPERDADGAMVPPSEVSTYNDLDLDDTYRVTRYFPRIERDFARIEHWIGQTHGG FT DFWLVHDAGGDLHCFGKTASARIADPAQPSHIAVWLLEESVSPNGQHIGYWYKPEDDAG FT VDLQGSEARRDHAANRYLTQVKYGNVLAANALYLFTSSKLDDEPWLFSLVFDYGERGTD FT PLIRPPWLAAAHWPVRHDAFSRYDYGFEVRCHRLCRQALMFHHFPDELGEPATLVARLL FT LEYDENPVLTRLVGVQRLAYEPDDTDEPDDTLQSLPPLELDYTPFDASVSSGQWQPCDL FT FPGLNNAHPYQLVDLYGEGIAGILYRVGHLWYYRAPMRSSEGGDAVTYDAWRPLPEIPS FT LQSPAMALTDINGDGRLDWLVTQPGLAGYFSLAPDGTWSTFTPLSALPVEFFSQQATLA FT DLMGAGLSDLALIGPKSVRLYANKRHGFARGIDVEQASTLPIAGRDAREVVAFCDLLGS FT GQQHLIRIRCDEVTVWPNLGRGRLGQPFSFAPLPFSAQQFNPACVYLADLDGSGAADLL FT YAQSDRIRIFFNQSGNGFAPPVDLALPPGVRFDRLCALSVADIQGQGMASLVLSVPHPS FT PKHWRYDLARAKPYLMNVINNNMGMAHRIVYRSSAQEWLDEKQSSTRSVSGLPFPVHVV FT SRHIQLDEISGNQLVQQYQYRQGVYDGREREFRGFGFVETQDTHEDAKPAGRNVSDAPP FT RLSRTWYHTGREADEATLYGEPWQDPDAFNCSPTRLTRWDANTSQDVLLDDSDAKRRWW FT LYRALNGSVLRTEVYGLDGTSRQQTPYRVTMARYQVREVQSAGSDHTPVAMPLPLEQLD FT YAYERIDGDPQVSQTVTLRIDAYGVPLHSVTVHYPRRAKPLTSPYPDTLPPSAWHSSYD FT PQQQCLRLTEQRASVWHLTHPQQWRLGLPWQQRHNALTYDAARVPVGGLNFENLSQVDG FT LLGDDQVRVFGGQSVVVYRDTDAHGAPDFVALVDHQEVAELDSSSLAAYDGLLDEPTLT FT AKLTQAGYHTSPTVLAVPNAVEAPVWVIASDYRTYRGPDNFYVPSEVQKTRLTGATQLS FT YDPYYCVVTQVQDALGNITSAQYDYRFLQPWRMTDVNDNHHEVQFDAMGRVVASTFYGT FT EQARDVGFDPITVSPVPTGLTVAQAIDQAGVSAQRVASVHATDLFAWMGQVSRADLPTE FT DADECWQQLIAERLITPQGHIRASARDGLCSGVLKRLSEPVRQALARAARNPVNVVTLT FT ADRYPNDTEQQVRVDIAYTDGFGRTLQGCAKVPGGLAWQCTADGEIVVGADGKPEEVDT FT GSAPRWAVSGRIEYDNKGQPVRRYQPYFMNDWAYVADRAMRSCGYADTTYYDPIGRAMR FT VVTAKGYERRTSIYPWFVVNEDENDTAG" FT CDS 288918..292238 FT /transl_table=11 FT /locus_tag="RBRH_00599" FT /note="COG: Rhs family protein" FT /note="Pfam: RHS Repeat::PF05593" FT /db_xref="EnsemblGenomes-Gn:RBRH_00599" FT /db_xref="EnsemblGenomes-Tr:CBW76677" FT /db_xref="InterPro:IPR006530" FT /db_xref="InterPro:IPR022385" FT /db_xref="UniProtKB/TrEMBL:E5AUA3" FT /protein_id="CBW76677.1" FT /translation="MVKHERYAMNETEWENVCRGTPVIQVMDNRGLGVRTLHYNRDSST FT SPLDERVSVAQHTEWGHLRSTTDARLFDAQQQDPRVAPNVRCVSSLSGRALRRDSVDAG FT LSVALFDVEGRMAWSQDGRGTQWRQVCDTLGRTVATYVQASDEVERCHERIVYGEQVPQ FT ASAHNLRGQVARYYDSAGQVRTAGYTLSGKSLQDTRQLLANRDTPANWAGDDETAWTAQ FT LSADAWTTARQYDALGDTVSQTDAKGNRQRFRVDVSGRLQTSWLKLADARDEQIIVGDM FT QYTAAGQRLSQTAGNGVVTTYDYEAQTQRLLRTDTRREDGTSLQAQEYTYDPVGNILAV FT GDATQPTRHFRNQRVAPLHTYRYDALYQLLEASGRENASAGRQGPALPTPQRDPINLTN FT YTRSYTYDRGGNLTAIRHQGQGANAYRNDIVIATQSNHGVAQTEQGNLRPEDIDGGGFF FT DRNGNGLQLQPGQPLEWSERNQLRQVTIVDRGNDDDNDRETYGYDGSGMRVWKQRRTKT FT GSTWRTEEVVYLPGLELRTTRVDDNVEEALEVVTAADGVARVLHWRVGQPTQIPNDQYR FT WSVSNLIGSVNLELDSDARILTREEYYPYGGTAVWGGNDCEVKYKFVRYSGKERDATGL FT YYYGHRYYQPWLGRWASADPAGPVDGLNLYMMVKNNPINHEDPNGLKASNWQLFKTMAK FT KHGPKLVPWVTPILAAGAVALGVPGVVIGAVAATAGLIYSGYQGYKAFQRFRRGDGSGD FT ATRRSQEAVIATASPKQLSFLGKVGRALRWGGAAAAVAGGIAAAVGAAPLVVAGVGIAA FT ALGGAAFAVGAASRLARRHAAHQARQIQREGGGIVSYGARSAATTFVSAEMHGASHTGA FT AVAMAGTAPISMLGWAEQNAEASVAGAHAGGVAVGEYESISRAVGVETATDIPALVGTA FT LGGGAMGYLHGQLEGATEVGQAAGAMARQTRARLWLGFDAVNAYTRSLGESMFDTGVSL FT VRDVAHYMGFTGGRSWAGRAVQFGSRMAGWLLGNRIRAAAGYTIGSAVLGAVGVGALPA FT STGAITFAAAAGGAAYGGYHALPEGGFISGMRRIATGVINRATTHWLAFPNLGTSSTA" FT CDS complement(292719..293768) FT /transl_table=11 FT /locus_tag="RBRH_00600" FT /product="Dihydropyrimidinase (EC 3.5.2.2)" FT /function="Dihydropyrimidinase (EC 3.5.2.2)" FT /EC_number="3.5.2.2" FT /note="Dihydropyrimidinase (EC 3.5.2.2)" FT /note="COG: Dihydroorotase and related cyclic FT amidohydrolases" FT /note="Pfam: Amidohydrolase family::PF01979" FT /db_xref="EnsemblGenomes-Gn:RBRH_00600" FT /db_xref="EnsemblGenomes-Tr:CBW76678" FT /db_xref="GOA:E5AUA4" FT /db_xref="InterPro:IPR011059" FT /db_xref="InterPro:IPR011778" FT /db_xref="UniProtKB/TrEMBL:E5AUA4" FT /protein_id="CBW76678.1" FT /translation="MHRDMGVLVHEHGVSSFKHFMAYKNAIMADDETLVNSFARSLELG FT ALPTVHAENGELVFQLQRQLLVRGLTGPEAHPLSRPPEVEGEAANRAIRIAQVLGVPVY FT IVHVSTKDALDSIARARSEGQRVFGEVLAGHLVIDESVYRDPNFTRAAAHVMSPPFRSA FT EHREALWRGLQGGYLHTTATDHCVFCASQKAIGRNDFTKVPNGCGGIEDRMAILWDRGV FT NTGRLTPNEFVRVTSTNAAQIFNLYPRKGAIAVGADADLVVWDPLATRTISSSTHHQNV FT DFNVFEGITVRGVATHTIARGELVWADGELRACRGAGRYLKRPSNPSYFEAARLANRRR FT EVQPVQRDQ" FT CDS complement(293677..294177) FT /transl_table=11 FT /locus_tag="RBRH_04243" FT /product="Dihydropyrimidinase (EC 3.5.2.2)" FT /function="Dihydropyrimidinase (EC 3.5.2.2)" FT /EC_number="3.5.2.2" FT /note="Dihydropyrimidinase (EC 3.5.2.2)" FT /note="COG: Dihydroorotase and related cyclic FT amidohydrolases" FT /db_xref="EnsemblGenomes-Gn:RBRH_04243" FT /db_xref="EnsemblGenomes-Tr:CBW76679" FT /db_xref="GOA:E5AUA5" FT /db_xref="InterPro:IPR011059" FT /db_xref="UniProtKB/TrEMBL:E5AUA5" FT /protein_id="CBW76679.1" FT /translation="MAILIRGGTLIDANQAWRADVLCTGSNEGGTIVQIGAELHAPAGA FT TVIDAVSQYVMPGGIDPHTHMELPFMGTVASDDFYTGTAAGFAGGTTSIIDFVIPGPRQ FT SLMDAFHQWRSWAEKAAADLWFPRCGHVVGRIRASRHGCTRARARRIQFQAFHGIQERN FT HGR" FT CDS complement(294305..295582) FT /transl_table=11 FT /locus_tag="RBRH_00601" FT /product="Dihydropyrimidine dehydrogenase [NADP+] beta FT subunit (EC 1.3.1.2)" FT /function="Dihydropyrimidine dehydrogenase [NADP+] beta FT subunit (EC 1.3.1.2)" FT /EC_number="1.3.1.2" FT /note="Dihydropyrimidine dehydrogenase [NADP+] beta subunit FT (EC 1.3.1.2)" FT /note="COG: Dihydroorotate dehydrogenase" FT /note="Pfam: Dihydroorotate FT dehydrogenase::PF01180
4Fe-4S binding domain::PF00037" FT /db_xref="EnsemblGenomes-Gn:RBRH_00601" FT /db_xref="EnsemblGenomes-Tr:CBW76680" FT /db_xref="GOA:E5AUA6" FT /db_xref="InterPro:IPR005720" FT /db_xref="InterPro:IPR012135" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="UniProtKB/TrEMBL:E5AUA6" FT /protein_id="CBW76680.1" FT /translation="MADLRCTIAGIASPNPFWLASAPPTDKAYNVNRAFEAGWGGAVWK FT TLGLDPHVINVSSRYGATTYNGQRIAGLNNIELITDRPLDVNLREIAQIKHDWPDRALI FT VSMMVPCNEQAWKSILPQVEDTGADAVELNFGCPHGMSERGMGAAVGQVPEYVEMVTRW FT VKQASRLPCLVKLTPNITDIRLGSRAAYAGGADGVSLINTINSIVAVDLEQMAPMPTVD FT GKGTHGGYCGPAVKPIALNMVAEIARDPNTPGLPISGMGGISNWRDAAEFIVLGAGSVQ FT VCTAAMHYGFRIVTDMIDGLSNWMDEKGFATLDEVRGRAVPNVTDWKYLNLQYDIKARI FT DQSKCIQCGLCHIACEDTAHQAITGYRDGRRHFEVIDANCVGCNLCMHVCPVDQCITME FT RVDAGRYANWTTHPNNPARVVKSPVA" FT CDS complement(295654..297057) FT /transl_table=11 FT /locus_tag="RBRH_00602" FT /product="Dihydropyrimidine dehydrogenase [NADP+] alpha FT subunit (EC 1.3.1.2)" FT /function="Dihydropyrimidine dehydrogenase [NADP+] alpha FT subunit (EC 1.3.1.2)" FT /EC_number="1.3.1.2" FT /note="Dihydropyrimidine dehydrogenase [NADP+] alpha FT subunit (EC 1.3.1.2)" FT /note="COG: NADPH-dependent glutamate synthase beta chain FT and related oxidoreductases" FT /note="Pfam: Pyridine nucleotide-disulphide FT oxidoreductase::PF00070
Pyridine nucleotide-disulphide FT oxidoreductase::PF07992" FT /db_xref="EnsemblGenomes-Gn:RBRH_00602" FT /db_xref="EnsemblGenomes-Tr:CBW76681" FT /db_xref="GOA:E5AUA7" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR023753" FT /db_xref="InterPro:IPR028261" FT /db_xref="UniProtKB/TrEMBL:E5AUA7" FT /protein_id="CBW76681.1" FT /translation="MMSSSQTGDITAGRLSADQLAANFADVAPPLGAHAAVVEANRCHY FT CYDAPCVSACPTGIDIPGFIRKIGNGNLKGAARDILLVNPLGGMCARVCPTEILCEGAC FT VRNKQDGKPVAIGALQRHATDHQMAREATSGKPLFTRAADTGRHVAVVGSGPAGLACAH FT TLAQAGHRVTIFDAHDKPGGLNEYGIAAYKTVDDFAQREVRWLLSIGGIELRAGQRLGR FT DITVARLCAQFDAVFIGIGLSGVNALHVDGETIDGVLDAVDFIARLRQSVTLDAVPVGR FT RVVVIGGGNTAIDAAVQSLKLGAQQVTMVYRRSVEQMSATWAEREFARKQGVVLREWAR FT PLCIVGAPHPQPGLRPQVSAVRFEATTLDADGKLVGTGETFNIDADVVLKAIGQTLIPD FT GLEARLLTVDGGRIVVDADGATSMPGVWAGGDCTNHPGLDLTVQAVQDGKLAAHAIHRH FT FTRTAVKAA" FT CDS complement(297145..298410) FT /transl_table=11 FT /locus_tag="RBRH_00603" FT /product="N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" FT /function="N-carbamoyl-L-amino acid hydrolase (EC FT 3.5.1.87)" FT /EC_number="3.5.1.87" FT /note="N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" FT /note="COG: Acetylornithine FT deacetylase/Succinyl-diaminopimelate desuccinylase and FT related deacylases" FT /note="Pfam: Peptidase family M20/M25/M40::PF01546" FT /db_xref="EnsemblGenomes-Gn:RBRH_00603" FT /db_xref="EnsemblGenomes-Tr:CBW76682" FT /db_xref="GOA:E5AUA8" FT /db_xref="InterPro:IPR002933" FT /db_xref="InterPro:IPR010158" FT /db_xref="InterPro:IPR011650" FT /db_xref="UniProtKB/TrEMBL:E5AUA8" FT /protein_id="CBW76682.1" FT /translation="MNTITDGVLSTALKVNGKRLWDSLIEMARIGATPRGGVCRLALTD FT LDKQARDLIVDWAKAAGCTVSVDRMGNVFMRRAGRDDTLPPVVTGSHADSQPTGGRFDG FT IYGVLGGLEVIRALNDHGIVTERPIETVIWTNEEGSRFAPAMVASGVFAGVFSLEYGLS FT RKDVDGKTIGDELSRIGYAGEQPCGGRPIHAAFELHIEQGPILESENKTIGVVTDAQGQ FT RWYEIVLAGQEAHAGPTPMPRRRDALLGASRVVQLVNEIGLRHAPLACATVGMMQVHPN FT SRNVIPGRVLFTVDFRHPSDDVLARMDAELREGIAQLADAGRLDAQVEQIFYYAPVPFD FT ATCVRSVRAAAERFGYSHRDIVSGAGHDACYLAQVTPTSMIFVPCIDGISHNEVEDAKP FT EWIEAGANVLLHAMLERACEPE" FT CDS 298617..298724 FT /transl_table=11 FT /locus_tag="RBRH_00605" FT /db_xref="EnsemblGenomes-Gn:RBRH_00605" FT /db_xref="EnsemblGenomes-Tr:CBW76683" FT /db_xref="UniProtKB/TrEMBL:E5AUA9" FT /protein_id="CBW76683.1" FT /translation="MKSMLSMLHRMNESSNDRMRRAAPWMLHGYIDAIG" FT CDS 298727..299140 FT /transl_table=11 FT /locus_tag="RBRH_00606" FT /product="ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE (fabL) FT (NADPH) (EC 1.3.1.9)" FT /function="ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE (fabL) FT (NADPH) (EC 1.3.1.9)" FT /EC_number="1.3.1.9" FT /note="ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE (fabL) FT (NADPH) (EC 1.3.1.9)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00606" FT /db_xref="EnsemblGenomes-Tr:CBW76684" FT /db_xref="GOA:E5AUB0" FT /db_xref="UniProtKB/TrEMBL:E5AUB0" FT /protein_id="CBW76684.1" FT /translation="MRAGARVASQTAVELVEPALRQWVTDIRQDEARWCAMLTHAIISL FT DATPTSRTGAFYGKAMAIRNIGERLAFLNRGQRWVMRRLCALLPTVRDARLRSDLQAML FT AAHQRNVLRVDARAGTAADEPGMPAPQRPAAPQ" FT CDS 299094..299420 FT /transl_table=11 FT /locus_tag="RBRH_04244" FT /db_xref="EnsemblGenomes-Gn:RBRH_04244" FT /db_xref="EnsemblGenomes-Tr:CBW76685" FT /db_xref="UniProtKB/TrEMBL:E5AUB1" FT /protein_id="CBW76685.1" FT /translation="MSRACLHRSGLPRRSSAPGCRACATKMTVVCIQHDAGIRALASQS FT RYGYCVCPPCLTRRVEPWRPDWRLKAKGWRAPCGLRGAELPPVLFHFPDDVVFPQSGTT FT KVGR" FT CDS 299417..299770 FT /transl_table=11 FT /locus_tag="RBRH_00607" FT /db_xref="EnsemblGenomes-Gn:RBRH_00607" FT /db_xref="EnsemblGenomes-Tr:CBW76686" FT /db_xref="UniProtKB/TrEMBL:E5AUB2" FT /protein_id="CBW76686.1" FT /translation="MNNGLNSRDTGVEHARTSVATTLREATWQGSRHARAAQPATVRLT FT VHASTGELRIIAVWAALGAYAGHVTQSRIRCNRKLAVDVLELDFRDIPDAALMDIAAHL FT SAAPWVRDARVQG" FT CDS 300648..300983 FT /transl_table=11 FT /locus_tag="RBRH_04245" FT /db_xref="EnsemblGenomes-Gn:RBRH_04245" FT /db_xref="EnsemblGenomes-Tr:CBW76687" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014710" FT /db_xref="UniProtKB/TrEMBL:E5AUB3" FT /protein_id="CBW76687.1" FT /translation="MAGVGSEKVFENSKVIVWNFTLEPGAFSPLHTHEHDYMWYTIEGA FT VLQIFDEDGKDLGTLDVPTGAVYSLKLNNGYLEVLSEIGNGIQVPATHKTRNTGTTPYR FT EILVEYK" FT CDS 301142..301762 FT /transl_table=11 FT /locus_tag="RBRH_00608" FT /product="Uracil DNA glycosylase superfamily protein" FT /function="Uracil DNA glycosylase superfamily protein" FT /note="Uracil DNA glycosylase superfamily protein" FT /note="COG: Uracil-DNA glycosylase" FT /note="Pfam: Uracil DNA glycosylase superfamily::PF03167" FT /db_xref="EnsemblGenomes-Gn:RBRH_00608" FT /db_xref="EnsemblGenomes-Tr:CBW76688" FT /db_xref="InterPro:IPR005122" FT /db_xref="UniProtKB/TrEMBL:E5AUB4" FT /protein_id="CBW76688.1" FT /translation="MKLVQPHLRYASLDTLLRDVRACRVCDTQLPAGARPVVRASRDAR FT LLIVGQAPGAKVHASGVPWSDASGKRLRDWLDMTEAEFYDTSRVAIIPMGFCYPGRGAS FT GDNPPRPECAQLWLEQLLSHLPRVELTLLVGQYAQRHFLGARRKSSLTETVRAWAEYTP FT TYVPLPHPSPRNQLWFKRHPWFGDQVLPMLKQRIAALFGTPPR" FT CDS 301819..301950 FT /transl_table=11 FT /locus_tag="RBRH_04246" FT /db_xref="EnsemblGenomes-Gn:RBRH_04246" FT /db_xref="EnsemblGenomes-Tr:CBW76689" FT /db_xref="UniProtKB/TrEMBL:E5AUB5" FT /protein_id="CBW76689.1" FT /translation="MRSIVLLAWLARAVPMRAAGRGDEPTVFQDAALRRATVIIHKR" FT CDS 302213..302836 FT /transl_table=11 FT /locus_tag="RBRH_00609" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Uncharacterized protein containing FT double-stranded beta helix domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_00609" FT /db_xref="EnsemblGenomes-Tr:CBW76690" FT /db_xref="GOA:E5AUB6" FT /db_xref="InterPro:IPR006045" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014500" FT /db_xref="InterPro:IPR014710" FT /db_xref="UniProtKB/TrEMBL:E5AUB6" FT /protein_id="CBW76690.1" FT /translation="MPRPFYLRRAPRGFGAEGDGHVRRGGATSARPPGVSYAPVPTPEA FT FMLPPKDWIPNNDRLPVLLYRAGLSPYEYDLAACFEATFARYGWPPRWRGCIYDFPHFH FT STAHEALGIAQGVASVELGGPGARKVQLERGDVLVLPAGTGHRCLSASEDLVVVGAYPT FT GQQWGICREPLPEDAVQAMRSLAVPDSDPLGGAHGPLTRLWRAG" FT CDS 302862..303251 FT /transl_table=11 FT /locus_tag="RBRH_00610" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Uncharacterized conserved protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00610" FT /db_xref="EnsemblGenomes-Tr:CBW76691" FT /db_xref="InterPro:IPR007438" FT /db_xref="UniProtKB/TrEMBL:E5AUB7" FT /protein_id="CBW76691.1" FT /translation="MSIRIVQLGSPRADDEGLRIGTVRRPPRGVPKAEFARRDYYDVWL FT PILSPDADGVAQAKSAHGQAEWNAFARSFRAAMNSGDASKVLDVLAALSKSTNFSIGCY FT CEDESRCHRSILRELLKARGAQIRS" FT CDS complement(303264..303560) FT /transl_table=11 FT /locus_tag="RBRH_00611" FT /db_xref="EnsemblGenomes-Gn:RBRH_00611" FT /db_xref="EnsemblGenomes-Tr:CBW76692" FT /db_xref="UniProtKB/TrEMBL:E5AUB8" FT /protein_id="CBW76692.1" FT /translation="MTDSTRRATAMRTARTCLGCARRPRSNRAWARLRAMRSYRDRWRR FT YPRCGYASTCRGLGVAAGEGLAMDLATYLAREVSRLRRSPRPTCRGLDRERIR" FT CDS 303536..303706 FT /transl_table=11 FT /locus_tag="RBRH_00612" FT /db_xref="EnsemblGenomes-Gn:RBRH_00612" FT /db_xref="EnsemblGenomes-Tr:CBW76693" FT /db_xref="UniProtKB/TrEMBL:E5AUB9" FT /protein_id="CBW76693.1" FT /translation="MLDELNQSLKSPAIVSKQGGITGWRLHTHGGQRADLTVVGEQIVW FT FYRDLQLFRKN" FT CDS 303762..304136 FT /transl_table=11 FT /locus_tag="RBRH_00613" FT /db_xref="EnsemblGenomes-Gn:RBRH_00613" FT /db_xref="EnsemblGenomes-Tr:CBW76694" FT /db_xref="InterPro:IPR025421" FT /db_xref="UniProtKB/TrEMBL:E5AUC0" FT /protein_id="CBW76694.1" FT /translation="MSSQAIWRDTSIIVRRFIMKSMFYAAVAASVFAVPIASFAQANAP FT LTRAQVQAELAQLEKAGYQPGLASPYYPADIQAAEARLSAQQTSSVGGVATGASRSGAG FT NAAVSPREPANEVNSVYFGQ" FT CDS 304388..304675 FT /transl_table=11 FT /locus_tag="RBRH_00614" FT /product="Acetyltransferase (EC 2.3.1.-)" FT /function="Acetyltransferase (EC 2.3.1.-)" FT /EC_number="2.3.1.-" FT /note="Acetyltransferase (EC 2.3.1.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00614" FT /db_xref="EnsemblGenomes-Tr:CBW76695" FT /db_xref="GOA:E5AUC1" FT /db_xref="UniProtKB/TrEMBL:E5AUC1" FT /protein_id="CBW76695.1" FT /translation="MVRAQGPAQPRLHDGAQMSYREARAAWLTVMPVPPCIPFHCTLRA FT ATLEDFDFAEALTCTNMGVYYRRRHGLTWHADLFLTSWWLLENYIVERDR" FT CDS 304685..304945 FT /transl_table=11 FT /locus_tag="RBRH_00615" FT /product="Acetyltransferase (EC 2.3.1.-)" FT /function="Acetyltransferase (EC 2.3.1.-)" FT /EC_number="2.3.1.-" FT /note="Acetyltransferase (EC 2.3.1.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00615" FT /db_xref="EnsemblGenomes-Tr:CBW76696" FT /db_xref="GOA:E5AUC2" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUC2" FT /protein_id="CBW76696.1" FT /translation="MLHISNEEDALHIRDLQLASEVGGAGGGTFLLETVHAWARRRCLR FT ILRLHMFADNPVTRLDARRGYQDVGGQLADFGMIKQMERVA" FT CDS complement(305021..305896) FT /transl_table=11 FT /locus_tag="RBRH_00616" FT /product="Transcriptional regulator, AraC family" FT /function="Transcriptional regulator, AraC family" FT /note="Transcriptional regulator, AraC family" FT /note="COG: AraC-type DNA-binding domain-containing FT proteins" FT /note="Pfam: AraC-like ligand binding FT domain::PF02311
Bacterial regulatory helix-turn-helix FT proteins, AraC family::PF00165" FT /db_xref="EnsemblGenomes-Gn:RBRH_00616" FT /db_xref="EnsemblGenomes-Tr:CBW76697" FT /db_xref="GOA:E5AUC4" FT /db_xref="InterPro:IPR003313" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014710" FT /db_xref="InterPro:IPR018060" FT /db_xref="InterPro:IPR020449" FT /db_xref="UniProtKB/TrEMBL:E5AUC4" FT /protein_id="CBW76697.1" FT /translation="MLSADIPVLRTDIASHHAPTRGHPIRVRSRPMPASHGFAGHTHPW FT AQLTYSSRGVLRMTSMNTTWIVPPSRAVYVPPHMPHQVAVIEDAFLRTIYIDGSACPVG FT LSGCRVVKVSPLMREVIAALDARELPRRREALLCELLLDEMMRSRPLPLGVPLPTEKRP FT RGLCEAVLVDPAHAQTLEMVAARAGASVRTIARLFRQELGVSFSQWRQQAVLARAIPLL FT SQGYPLARVARQFGYQSQSAFSAMFRRAFGESPRAFFTRQDGAPGACESQVFEPDEVAG FT PIGSTWPPAP" FT CDS 306153..306542 FT /transl_table=11 FT /locus_tag="RBRH_00617" FT /product="S-adenosylmethionine:2-demethylmenaquinone FT methyltransferase (EC 2.1.-.-)" FT /function="S-adenosylmethionine:2-demethylmenaquinone FT methyltransferase (EC 2.1.-.-)" FT /EC_number="2.1.-.-" FT /note="S-adenosylmethionine:2-demethylmenaquinone FT methyltransferase (EC 2.1.-.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00617" FT /db_xref="EnsemblGenomes-Tr:CBW76698" FT /db_xref="GOA:E5AUC3" FT /db_xref="InterPro:IPR005493" FT /db_xref="UniProtKB/TrEMBL:E5AUC3" FT /protein_id="CBW76698.1" FT /translation="MACKRHRAALIPGDTMTTFAAPDLCDAHEGSLATGTLRVLAPVFR FT AFGRASTFAGPVSTHPRLWRGAGHTRVERMRNRHLRVRGAPTAQPKTGVGERDVAVVLP FT GVTTRSGEWIYGDANGILVFTTKLT" FT CDS 306558..307022 FT /transl_table=11 FT /locus_tag="RBRH_00618" FT /product="Butirosin biosynthesis protein BtrG" FT /function="Butirosin biosynthesis protein BtrG" FT /note="Butirosin biosynthesis protein BtrG" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: AIG2-like family::PF06094" FT /db_xref="EnsemblGenomes-Gn:RBRH_00618" FT /db_xref="EnsemblGenomes-Tr:CBW76699" FT /db_xref="InterPro:IPR009288" FT /db_xref="InterPro:IPR013024" FT /db_xref="UniProtKB/TrEMBL:E5AUC5" FT /protein_id="CBW76699.1" FT /translation="MLNVFVYGTLRANEANDIGRAAQRSGLPQPRWLGRGSVKGTLYDL FT GAYPGLVPDTAAGEVYGDVFEIDETLLPVLDKIEAVFPHHPLEFQRNMIQIQLNGRLLP FT CQFYPVDAASTVGRTPIKCGDWVAHRQMRDHGAQPGEPDIALSKVVESAA" FT CDS 307226..307528 FT /transl_table=11 FT /locus_tag="RBRH_00619" FT /product="RelB protein" FT /function="RelB protein" FT /note="RelB protein" FT /note="COG: Antitoxin of toxin-antitoxin stability system" FT /note="Pfam: Phd_YefM::PF02604" FT /db_xref="EnsemblGenomes-Gn:RBRH_00619" FT /db_xref="EnsemblGenomes-Tr:CBW76700" FT /db_xref="InterPro:IPR006442" FT /db_xref="UniProtKB/TrEMBL:E5AUC6" FT /protein_id="CBW76700.1" FT /translation="MLYLYNLSYIGSNPMRTIHFSDARSNLKTVIDQVVDDADVTLVTR FT RDAPNAVIMSQDYYDSLMETVHLLRSPANVGHLERSIAQLRKGKATERKLAEDAE" FT CDS 307525..307794 FT /transl_table=11 FT /locus_tag="RBRH_00620" FT /product="RelE protein" FT /function="RelE protein" FT /note="RelE protein" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: Plasmid encoded toxin Txe::PF06769" FT /db_xref="EnsemblGenomes-Gn:RBRH_00620" FT /db_xref="EnsemblGenomes-Tr:CBW76701" FT /db_xref="GOA:E5AUC7" FT /db_xref="InterPro:IPR009614" FT /db_xref="UniProtKB/TrEMBL:E5AUC7" FT /protein_id="CBW76701.1" FT /translation="MSDRRVLFTPDAWEDYVYWQGQDRKTLKRINQLIREAQRAPFEGI FT GKPEPLKANLSGFWSRRIDDTNRLVYEADDFQISVISCRYHYQA" FT CDS complement(308023..308382) FT /transl_table=11 FT /locus_tag="RBRH_00621" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00621" FT /db_xref="EnsemblGenomes-Tr:CBW76702" FT /db_xref="GOA:E5AUC8" FT /db_xref="InterPro:IPR009057" FT /db_xref="UniProtKB/TrEMBL:E5AUC8" FT /protein_id="CBW76702.1" FT /translation="MWRRQLLRKLSHEQEAKQVSPEVRERAVRLVREQRSKHPSMWAAV FT ESIAPMIGCTPQTLLDCVKRDERARGKRDGVSTAERERIKALEREVKELRRTNEILKLA FT SAFFAQAQLERRFKS" FT CDS 308281..308424 FT /transl_table=11 FT /locus_tag="RBRH_04247" FT /db_xref="EnsemblGenomes-Gn:RBRH_04247" FT /db_xref="EnsemblGenomes-Tr:CBW76703" FT /db_xref="UniProtKB/TrEMBL:E5AUC9" FT /protein_id="CBW76703.1" FT /translation="MLAYQAHGALSHFRGNLFGFLFMAQFSQELAPPQNPGRFRIPTLL FT VH" FT CDS 309004..316521 FT /transl_table=11 FT /locus_tag="RBRH_00622" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_00622" FT /db_xref="EnsemblGenomes-Tr:CBW76704" FT /db_xref="GOA:E5AUD0" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUD0" FT /protein_id="CBW76704.1" FT /translation="MDASVMPTTYALSAAQTEIWLAQQLHPDSPVYNIAQYTVIEGAID FT ATVFEAALRQVIDEADTLRLQFIDSDDGLRQRIGTPAWSMPVLDLTAQADPQAAAQAWM FT RADYQQPVNLMQGPLFCYALLKVAPAQWMWYQRYHHIIMDGLGQYLIAQRVAHVYSAMC FT AGGEPKPCALGSVLKLLNSDAQYQTSAQRERDEAYWLKHCANWPEPTTLASRAASALQH FT RLRQTAYVATQALGDAASDVSQLAQLLTAALAAYLHRLTGAQDVVLGFPVTARLGTDRH FT IPGTLAHDIPLRFTVQPEMNLSSLLQQAAQIQRGFRYQRYPSEALRRRLGLPPGQALFG FT AAVNVMPFDYDLSFDGYPSTNHNLLNGPVDDLMLGVYWTPNNSQCRIDFNANPACYTAE FT ELEAHQRRFVRFVQALAADATRPICGFDLLDAEERHRLLVEWNATQQDYPAHQCIHQLF FT EAQVERTSEATALVYEDQALSYAELNAQANRLAHELIGLGVKPDARVAICVERSPAMVV FT GLLAILKAGGGYVPLDPAYPGERLAHILEDAAPEIVLADASGRAALGEVALADRTVLDP FT NTLPEQAETNPSVPALTSRHLAYVIYTSGSTGMPKGVMVHHQGVVRLVRNTDYVQVEPE FT ACFAFASNMAFDATTFEIWAPLLNGARIEVIDRDILLSPSALACKLKQSRVTILFLTTA FT LFNQVAREQVDAFSDLHYLLFGGEAADSQCVFRVLQKAKLQHLLHVYGPTETVTYASWY FT EVRSVNLDKSIPIGRPLANTRIYLLDAHGQPVPLGAVGELYIGGAGVARGYLNRPELTA FT ECFVCDPFVNEPEARMYKTGDLARYLPDGNIEFLGRNDHQVKIRGFRIELGEIEVCLAQ FT HAQVREAVVLALGEGQDKRLMAYVVAEADDALASTLRTHVAAALPEYMVPSAFVRLDAL FT PLTPNGKLDRRALPAPDAEAFVHRAYEAPQGELETTLAEIWFELLDVEKISRHDSFFAL FT GGHSLLAVRTIERLRRRGLEISVRALFDTPVLSTLAQSLGQHREVVVPPNRITPEMTTL FT TPDLLPLIELTQSDINRIVEQVPGEVANIQDIYALSPLQDGILFHHLLASEGDPYLLIV FT QLAFDTRERLDRYLNAIQQVINRHDILRTAFVWEGLSTPAQVVWRQALLSVTELMLDAK FT DGPIAEQLAQHFDPRHTRLDLTQAPLLRFAIAQDTDGRWLLVQLLHHLVIDHSTLEGMH FT EEVRAFIEGKGGTLPAAQPFRNLVAQARLGVSQAEHERFFTEQLADIEEPTLPFGLSEV FT HRDGKQVSEAYRRLPQALNDRLRTHAKRLDVSLASLCHLAWAQVLARTSGQQKVVFGTV FT LFGRMQASEGVDSAMGLFINTLPLRVDLEASVESAVRATHARLAALLEHEHAPLALVQR FT CSGVPEGTPLFSALLNYRHNEISRREHYLLPGIELLSSNRRTNYPLMLAIDDYGQALEL FT NVQVVESLDPHRVCGYMQQALESLAEALEMEPKRPMQQLEVLPNEERTLLLETWNATQQ FT NYPAHQCIHQLFEAQAERTPEAVAVVFGAQQITYADLNRRSNQLARHLRTLEVGPETVV FT GLCVERSIEMVVGLLGILKAGGVYVPLDPSYPAERTAYILEEARVPVLVVQSHLEAALP FT PICARRVRLDTDWAQIASEPDTPVASNVTPDNLAYITYTSGSTGQPKGVMTRHSGAVNY FT LSFLIRHYSLTEADVVLNVASLVFDASVRDLFGPLASGARVVLIPTAHAKEPGQYVSVM FT NEQCVTKLLSITPSFLRSVCLAAENQRMSHTLSLILTSGEVLEAGLCAQVHQMLGAQVR FT VVNQYGPTECTMTSTWFEVVLQQTGTVPIGRPIANTRIYLLDTHGQPVPQGAIGELYIG FT GAGIARGYLNRPELTAERFVHDPFVGEPEARMYKTGDLARYLPNGNLMFLGRTDHQVKI FT RGFRIEMGEIEACLAKHAQVREAVVLALDEGQDKRLVAYVVAKPDDALASTLRTHVAAA FT LPEYMVPAAFVRLDALPLTPNGKLDRRALPALNAGAFAHQAYEAPQGELETTLAQIWSE FT LLGAEQVGRHDDFFALGGHSLLALRLMNRVVALGVELPLATLFAAPTLAGLAAALDAQR FT ADGAVLPAITPVSRDDALPLSFAQQRLWFLAQLDGVSDSYHIPLALRLRGALNRVAWQQ FT ALDALWGRHEALRSVFVSVKGQPQVQLLPAEAGMPMTWYDLRGVVDAATQLAQLSAEAA FT QAPFDLAHGPLMRACGIQLADDEHVMLLVQHHIVSDGWSIGVLARELNALYRAACDGKA FT NPLPALTIQYPDYAAWQRQWLSSERLKAQSEYWRMELADAPVLLELPTDRPRPAQQSFE FT GAYVPIRIDAPTTQALRRLSQAQGATLFMTVLAAWSAVLSRLSGQEDLVIGTPSANRHH FT PQIEPLIGFFVNTLALRVDVSGEPSAAQLLERVRRTALEAQAHQDVPFEQVVETVQPPR FT RLEHTPLFQVMFAWQSNEAGDCQLPGLEITPADLAYDRGQV" FT CDS 316508..317692 FT /transl_table=11 FT /locus_tag="RBRH_04248" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501" FT /db_xref="EnsemblGenomes-Gn:RBRH_04248" FT /db_xref="EnsemblGenomes-Tr:CBW76705" FT /db_xref="GOA:E5AUD1" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR020459" FT /db_xref="InterPro:IPR020845" FT /db_xref="UniProtKB/TrEMBL:E5AUD1" FT /protein_id="CBW76705.1" FT /translation="MVKFDLDLHLHEAGGQIVGALCYATALFDRGTIERHVGYLQTMLQ FT AMAADASQSVTRVELLAPAERTLLLQTWNATQQDYPAHQCIHQLFEAQAERTPEATALV FT YEDQTLSYAELNAQANRLAHQLLGLGVKPDARVGICVQRSPAMVAGLLAILKAGGAYVP FT LDPAYPGERLAHIVQDAAPQMVLADAAGRAALGDAALADRPVLDPNRLPEQPETNPSVP FT ALTPRHLAYVIYTSGSTGMPKGVMVEHDQVVRLFDATQSWYHFDENDTWCLFHSFAFDF FT SVWELWGALRHGGKLIMVPHHVVRSPQDFHRLVCEQGVTVLNQTPSAFKMFIASQAQSV FT LRDQLRYVIFGGEALEPSILQAWYATRAGQGPQLVNMYGITETTVHVTYRPLQL" FT CDS 317705..318913 FT /transl_table=11 FT /locus_tag="RBRH_00623" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: Phosphopantetheine attachment site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_00623" FT /db_xref="EnsemblGenomes-Tr:CBW76706" FT /db_xref="GOA:E5AUD3" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUD3" FT /protein_id="CBW76706.1" FT /translation="MGSPIGVRIPDLKIYLLDAYKQPVPLGATGELYIGGAGVARGYLN FT RPELTAERFVRDPFASERDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEI FT EACLARHAQVREAVALAVGEGQDKRLVAYVVAEPDEALAGTLRTHVAAALPEYMVPSAF FT VRLDAFPLTPNGKLDRRALPVPDAQAFAQQAYEAPQGELESMLAAVWSELLGIEQVGRH FT DNFFALGGHSLLAVRLMDRVAALGIALPLTTLFAAPTLADLAQRVSAQDSVQDDSFAVL FT LPIQSHGARPALFCVHPVTGLSWHYRGLANHLEADQPVYGLQARGLDDVTSPALTIEAM FT AMDYVQQIRCIQPEGPYYLLGWSFGGKVVHSMATQLEQQGERVALLAVLEDWPAVCAAG FT PAK" FT CDS 318891..319019 FT /transl_table=11 FT /locus_tag="RBRH_00624" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00624" FT /db_xref="EnsemblGenomes-Tr:CBW76707" FT /db_xref="UniProtKB/TrEMBL:E5AUD2" FT /protein_id="CBW76707.1" FT /translation="MLRDQQSNVITVQDGKRIVLAQFTVPLEVRQSRRNQPMPQSA" FT CDS 319075..319344 FT /transl_table=11 FT /locus_tag="RBRH_00625" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: DNA replication protein" FT /note="Pfam: IstB-like ATP binding protein::PF01695" FT /db_xref="EnsemblGenomes-Gn:RBRH_00625" FT /db_xref="EnsemblGenomes-Tr:CBW76708" FT /db_xref="GOA:E5AUD4" FT /db_xref="InterPro:IPR002611" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUD4" FT /protein_id="CBW76708.1" FT /translation="MGIVHALIDAGYRVLLMRTSEIVQKLQAARQSLQLPSALAQLARF FT DLIILDDLSYARKDQAETSVLFELIAERYERRSLLITANQPFSG" FT CDS 319351..319512 FT /transl_table=11 FT /locus_tag="RBRH_00626" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00626" FT /db_xref="EnsemblGenomes-Tr:CBW76709" FT /db_xref="UniProtKB/TrEMBL:E5AUD5" FT /protein_id="CBW76709.1" FT /translation="MTVAAIDRLVHHSTIFEMNVESYRRRTASDKQTGQRRQFSSDNHK FT EGATIMAE" FT CDS 319549..319956 FT /transl_table=11 FT /locus_tag="RBRH_00627" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_00627" FT /db_xref="EnsemblGenomes-Tr:CBW76710" FT /db_xref="UniProtKB/TrEMBL:E5AUD6" FT /protein_id="CBW76710.1" FT /translation="MSVNRPFCLTLSTQALEQAAILSEVQPQIAVVDRGYKGVAIDGVK FT VYHPGLRRGIRRGLRAMIRRRSAIEPVIGHMKANGKLDRNWLKGALGDAIHAVLCGAGH FT NLRMILRKLRLFYALIRVVLLNRQAYMVSAA" FT CDS complement(320013..320537) FT /transl_table=11 FT /locus_tag="RBRH_00628" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: DNA replication protein" FT /note="Pfam: IstB-like ATP binding FT protein::PF01695
IstB-like ATP binding FT N-terminal::PF08483" FT /db_xref="EnsemblGenomes-Gn:RBRH_00628" FT /db_xref="EnsemblGenomes-Tr:CBW76711" FT /db_xref="GOA:E5AUD7" FT /db_xref="InterPro:IPR002611" FT /db_xref="InterPro:IPR013690" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUD7" FT /protein_id="CBW76711.1" FT /translation="MLMQQTLTQLKSLKLDGMARAFEEQAALTASASLSFEERFGMVVE FT RELAWRDTRRLERLLKSAKLKNPQACIEDIEYRQNRGIDKSVVAALASCDWIRNAQNLI FT LTGPTGAGKTWIACAFGQQACRQGFSVSYVRVARLFEQLKTFVVWMLRLRPYRGCIAEN FT STGCTRHNSVV" FT CDS complement(320690..322105) FT /transl_table=11 FT /locus_tag="RBRH_04249" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Integrase core domain::PF00665" FT /db_xref="EnsemblGenomes-Gn:RBRH_04249" FT /db_xref="EnsemblGenomes-Tr:CBW76712" FT /db_xref="GOA:E5AUD8" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR017895" FT /db_xref="UniProtKB/TrEMBL:E5AUD8" FT /protein_id="CBW76712.1" FT /translation="MMPAHRMSMRKLKEVLRLKWACGLSHRQISRAIGISVGAISAYAA FT RASAAGLDWAAVEALADDELEIRLELPAQTALSSRRVEPDYAAMHRDLRRKGVTLQLLW FT EEYVEAHPGQRTYRYTQFCQRYKDWAAVLKRSMRQQHRAGEKLFADFAGQTVLVLSRDG FT GVAFKAHVFVAVLGASNYTYACATRSETMSDWIGSLIDAMEFYGGVPELLVPDNPKALI FT AKADRYEPVLGNTTQDFVNHYATAMLPARPCKPQDKAKVKVGVQIVERWILARLRNHRF FT YSLAELNKAIGQLIADLNQRPLKKLDGNRREWFERLDRLALRPLPTHRYEIATFVKCRV FT SIDYRVEVDHHYYSVAHSLVRQEVYARVTRHGVEILHRGKRVAAHVRSRLRNKHTTLPE FT HMPAAHRAHMEWTPKRLLNWGACIGPGAEAIAKHLLTNRPHPRWGTARASDCCRSRAST FT ARTGWKPPASGHS" FT CDS complement(322130..322360) FT /transl_table=11 FT /locus_tag="RBRH_01879" FT /db_xref="EnsemblGenomes-Gn:RBRH_01879" FT /db_xref="EnsemblGenomes-Tr:CBW76713" FT /db_xref="UniProtKB/TrEMBL:E5AUE0" FT /protein_id="CBW76713.1" FT /translation="MASWVRACEQIAYLGERDQWFRSMVIADHRFPKRAIILPKRVITF FT PERTETADHANETRWPLRLGGGVAHVINDGR" FT CDS 322370..322534 FT /transl_table=11 FT /locus_tag="RBRH_01880" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01880" FT /db_xref="EnsemblGenomes-Tr:CBW76714" FT /db_xref="UniProtKB/TrEMBL:E5AUD9" FT /protein_id="CBW76714.1" FT /translation="MIYSLIGTARLNGVEPFAYLRAVFERVADHPINRIDELLPWRVVP FT TEHVEQQAA" FT CDS 322696..323139 FT /transl_table=11 FT /locus_tag="RBRH_01881" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: DNA polymerase III, alpha subunit" FT /note="Pfam: Plasmid pRiA4b ORF-3-like protein::PF07929" FT /db_xref="EnsemblGenomes-Gn:RBRH_01881" FT /db_xref="EnsemblGenomes-Tr:CBW76715" FT /db_xref="InterPro:IPR012912" FT /db_xref="InterPro:IPR024047" FT /db_xref="UniProtKB/TrEMBL:E5AUE1" FT /protein_id="CBW76715.1" FT /translation="MLLAMGWEGGHAHEFVFRNTNYGEPDPDYPSDPPMLDEARVTLVK FT ALGALKSFTYIYDYGDNWQHRIKVEKVLPANAQLRSPLCLDGRNACPPKDVGGAPGYID FT FLDAIIDPSHEEHDHFLKWCGGSFDPDAFDLDFANQRLFEVKF" FT CDS 323506..323862 FT /transl_table=11 FT /locus_tag="RBRH_01882" FT /product="Virulence-associated protein B" FT /function="Virulence-associated protein B" FT /note="Virulence-associated protein B" FT /db_xref="EnsemblGenomes-Gn:RBRH_01882" FT /db_xref="EnsemblGenomes-Tr:CBW76716" FT /db_xref="InterPro:IPR007159" FT /db_xref="UniProtKB/TrEMBL:E5AUE2" FT /protein_id="CBW76716.1" FT /translation="MTTHDPLKAWSAVAAHVHTRIYIERQIVYSTSTVHTSGTAMHTTR FT VFKNGNSQAVRIPADLAYDRSDVEIEIERVGDEIRIRPMRRPLTGVLKKFAKFGPDFMA FT EGRGEQEQAEREGL" FT CDS 323859..324263 FT /transl_table=11 FT /locus_tag="RBRH_01883" FT /product="VIRULENCE-ASSOCIATED PROTEIN C" FT /function="VIRULENCE-ASSOCIATED PROTEIN C" FT /note="VIRULENCE-ASSOCIATED PROTEIN C" FT /note="COG: Predicted nucleic acid-binding protein, FT contains PIN domain" FT /note="Pfam: PIN domain::PF01850" FT /db_xref="EnsemblGenomes-Gn:RBRH_01883" FT /db_xref="EnsemblGenomes-Tr:CBW76717" FT /db_xref="GOA:E5AUE3" FT /db_xref="InterPro:IPR002716" FT /db_xref="InterPro:IPR022907" FT /db_xref="UniProtKB/TrEMBL:E5AUE3" FT /protein_id="CBW76717.1" FT /translation="MMPRFMLDTNMCIYLMKNQPEEVAKRFAQCYVGDVVMSAVTYAEL FT EYGVVVSANRTRERRNLAALIEDIPVAPFDTAAATAYGPVRKATSERKKDALDKLIAAH FT AIALDVILVTNNERDFASYPGIRLENWLNK" FT CDS complement(324386..324628) FT /transl_table=11 FT /locus_tag="RBRH_01884" FT /db_xref="EnsemblGenomes-Gn:RBRH_01884" FT /db_xref="EnsemblGenomes-Tr:CBW76718" FT /db_xref="UniProtKB/TrEMBL:E5AUE4" FT /protein_id="CBW76718.1" FT /translation="MIVTFDAQGRLNVDQIKQRVSSLFEVFLASKLGRNNREGTAKVVD FT AAARFTVQGSQWTPTPALIQALDEAALALRRCSGI" FT CDS complement(324612..324815) FT /transl_table=11 FT /locus_tag="RBRH_01885" FT /db_xref="EnsemblGenomes-Gn:RBRH_01885" FT /db_xref="EnsemblGenomes-Tr:CBW76719" FT /db_xref="UniProtKB/TrEMBL:E5AUE5" FT /protein_id="CBW76719.1" FT /translation="MGYTIRTFLITPDEGILKIGMTRYWNMLGAPDSHRLPEFADQRVR FT LAHLDGSQAHALDQSGFCDCHF" FT CDS complement(324910..325077) FT /transl_table=11 FT /locus_tag="RBRH_01886" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Integrase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01886" FT /db_xref="EnsemblGenomes-Tr:CBW76720" FT /db_xref="GOA:E5AUE6" FT /db_xref="InterPro:IPR002104" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="UniProtKB/TrEMBL:E5AUE6" FT /protein_id="CBW76720.1" FT /translation="MRHTHASHALARGAELIMVHDNLRHSSIPTTSIYLHSDEVQRVRR FT FDQAFEARKA" FT CDS complement(325587..325982) FT /transl_table=11 FT /locus_tag="RBRH_01888" FT /product="DNA binding protein" FT /function="DNA binding protein" FT /note="DNA binding protein" FT /note="COG: Predicted transcriptional regulator" FT /db_xref="EnsemblGenomes-Gn:RBRH_01888" FT /db_xref="EnsemblGenomes-Tr:CBW76721" FT /db_xref="GOA:E5AUE7" FT /db_xref="InterPro:IPR010982" FT /db_xref="UniProtKB/TrEMBL:E5AUE7" FT /protein_id="CBW76721.1" FT /translation="MTKAKATVSHYEQEIAELRADRDLAIEYLKAAMESLDNPKDRAGA FT LLALRTVAHAYGGLAWVAAEAGITREALYRALSLKDNPTLKTLLAVLKAVGMRLSVEPW FT ITRTRNRQRFSSAVLGSRTRSRLLEHA" FT CDS complement(325979..326143) FT /transl_table=11 FT /locus_tag="RBRH_01889" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: Phage derived protein Gp49-like FT (DUF891)::PF05973" FT /db_xref="EnsemblGenomes-Gn:RBRH_01889" FT /db_xref="EnsemblGenomes-Tr:CBW76722" FT /db_xref="InterPro:IPR009241" FT /db_xref="InterPro:IPR014056" FT /db_xref="UniProtKB/TrEMBL:E5AUE8" FT /protein_id="CBW76722.1" FT /translation="MLELRVHVGPGYRVYCGRHGNALVILLCGGDKRSQTADIRRAKEY FT WIDWKRRQA" FT CDS complement(326588..327136) FT /transl_table=11 FT /locus_tag="RBRH_01890" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Integrase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01890" FT /db_xref="EnsemblGenomes-Tr:CBW76723" FT /db_xref="GOA:E5AUE9" FT /db_xref="InterPro:IPR002104" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="UniProtKB/TrEMBL:E5AUE9" FT /protein_id="CBW76723.1" FT /translation="MGDFSRRLGSDGHDQWWLDTVGKGQRARRVPASPELIVELTRYRQ FT ACGLSPLPRRVEDTPLVVPFRGGRRGLSRSALHDAIKRIFRDAASWLRARGPEFADRAD FT ELVRASAHWLRHTAGSHQADAGLDLRTVRDNLGHMSLTTTSLYLHEEEDTRHRQTVHGH FT RMNWGDQEPVEPLTREPQR" FT CDS complement(327326..327877) FT /transl_table=11 FT /locus_tag="RBRH_01891" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Integrase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01891" FT /db_xref="EnsemblGenomes-Tr:CBW76724" FT /db_xref="GOA:E5AUF0" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR023109" FT /db_xref="UniProtKB/TrEMBL:E5AUF0" FT /protein_id="CBW76724.1" FT /translation="MSCNALEASCFVDPALGAPPTVSLTPFTAVQPVEALVLPEHLDGR FT DGTNRGARETAQLAARNDLDAVRAWLSNYADTKTTFDTHRKEAERLLLWAVVQRGKPLS FT LLTHEDLQQFNAFLADPQPASRWVSATGGKYPRGDARWRPFNGPLSAASQRQARVILNG FT LFTWLVDAGYLRSNPMALLR" FT CDS 327969..328628 FT /transl_table=11 FT /locus_tag="RBRH_01892" FT /db_xref="EnsemblGenomes-Gn:RBRH_01892" FT /db_xref="EnsemblGenomes-Tr:CBW76725" FT /db_xref="InterPro:IPR021104" FT /db_xref="UniProtKB/TrEMBL:E5AUF1" FT /protein_id="CBW76725.1" FT /translation="MSDVLSPDAALTTEIARLKATHSNTRELYREVCALLFFRFGITPT FT ANRLYQLVRKGSMGTPTAVLSEFWHELREKSRVKLDHPDLPSELRDAAGTLVATLWERA FT AATAHAALEDVRAEMRLERDAAAAEVAAAREAAAHAERTLEEPRAERQALQAQLGDSRQ FT HIGTLEGSLAALQRASAEAEKARRARQRIPTQSALGRTSGPIRRPRPPTRALKKSR" FT CDS complement(328774..329118) FT /transl_table=11 FT /locus_tag="RBRH_01894" FT /db_xref="EnsemblGenomes-Gn:RBRH_01894" FT /db_xref="EnsemblGenomes-Tr:CBW76726" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AUF2" FT /protein_id="CBW76726.1" FT /translation="MSKLTVHVSGARDMGQRFVNAFERAAKGEHFKESHVTFLSWQEMV FT AALTPKRLELLRYLHREGADSVKALACALSRDYKRVHADVAALEVAGLVVREDGRLTAP FT WEALAAEVAL" FT CDS complement(329115..329408) FT /transl_table=11 FT /locus_tag="RBRH_01895" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01895" FT /db_xref="EnsemblGenomes-Tr:CBW76727" FT /db_xref="UniProtKB/TrEMBL:E5AUF3" FT /protein_id="CBW76727.1" FT /translation="MKKKATLLFEDRMVYPDGAILEMRIWRLPECDAERPHGLKYSLFY FT GQGSARIIGYDNERGKGDHRHYRDHEVPYVFSTAEQMVRDFLGDVERERSGK" FT CDS 329488..329673 FT /transl_table=11 FT /locus_tag="RBRH_01896" FT /product="MazE protein" FT /function="MazE protein" FT /note="MazE protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01896" FT /db_xref="EnsemblGenomes-Tr:CBW76728" FT /db_xref="UniProtKB/TrEMBL:E5AUF4" FT /protein_id="CBW76728.1" FT /translation="MFLASVGSSLNADVRPDGVMLAPARRKYSLDDLIAQCDMKTFFPE FT DMAAWSEVKPVGREAW" FT CDS 329667..330017 FT /transl_table=11 FT /locus_tag="RBRH_01897" FT /product="MazF protein" FT /function="MazF protein" FT /note="MazF protein" FT /note="COG: Growth inhibitor" FT /note="Pfam: PemK-like protein::PF02452" FT /db_xref="EnsemblGenomes-Gn:RBRH_01897" FT /db_xref="EnsemblGenomes-Tr:CBW76729" FT /db_xref="GOA:E5AUF5" FT /db_xref="InterPro:IPR003477" FT /db_xref="InterPro:IPR011067" FT /db_xref="UniProtKB/TrEMBL:E5AUF5" FT /protein_id="CBW76729.1" FT /translation="MVRRVKFARGDIVRVSLNSTAGREQQGDFRPALVLSAAAFNALGV FT ALVAPITQGDASARFARFAVPLSGSGTETQGVALVNMARMLDLEARGARKLERAPVEVV FT EDALARFQTIIE" FT CDS 330146..330511 FT /transl_table=11 FT /locus_tag="RBRH_01899" FT /db_xref="EnsemblGenomes-Gn:RBRH_01899" FT /db_xref="EnsemblGenomes-Tr:CBW76730" FT /db_xref="InterPro:IPR021104" FT /db_xref="UniProtKB/TrEMBL:E5AUF6" FT /protein_id="CBW76730.1" FT /translation="MDARAAQTLPPELRDAAGTLLATLWERAAATAHTALEEVRAEMRL FT ERDAAAAEVAAAREAAAHAERTLEEPRAERQALQAQLGTHASTLARWKAAWPRCSARVL FT KLKKRGARGSAYPPSPH" FT CDS 330781..331059 FT /transl_table=11 FT /locus_tag="RBRH_01900" FT /product="DNA-damage-inducible protein J" FT /function="DNA-damage-inducible protein J" FT /note="DNA-damage-inducible protein J" FT /note="Pfam: RelB antitoxin::PF04221" FT /db_xref="EnsemblGenomes-Gn:RBRH_01900" FT /db_xref="EnsemblGenomes-Tr:CBW76731" FT /db_xref="GOA:E5AUF7" FT /db_xref="InterPro:IPR007337" FT /db_xref="InterPro:IPR026262" FT /db_xref="UniProtKB/TrEMBL:E5AUF7" FT /protein_id="CBW76731.1" FT /translation="MATTTMVHIRIDETVKAQAAQTLASMGLTVSDAIRVFLTRIVADK FT ALPFAIQAPNAASRAAMAEAREIIESRHVRFATSDALMNDLEKNTRK" FT CDS 331031..331360 FT /transl_table=11 FT /locus_tag="RBRH_01901" FT /product="DNA damage inducible protein yafQ" FT /function="DNA damage inducible protein yafQ" FT /note="DNA damage inducible protein yafQ" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: Plasmid stabilisation system protein::PF05016" FT /db_xref="EnsemblGenomes-Gn:RBRH_01901" FT /db_xref="EnsemblGenomes-Tr:CBW76732" FT /db_xref="InterPro:IPR004386" FT /db_xref="InterPro:IPR007712" FT /db_xref="UniProtKB/TrEMBL:E5AUF8" FT /protein_id="CBW76732.1" FT /translation="MTLKRTPASKRATLPRASDYTKAFLKDWQRLSYSGRYDMNRLKEA FT MTLLIANDGPLAAEWLDHSLAGEWDSHRECHIGGDFLLIYKLADIGKHSLVIFVRAGTH FT SELFS" FT CDS complement(331428..332426) FT /transl_table=11 FT /locus_tag="RBRH_01902" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase IS116/IS110/IS902 family::PF02371" FT /db_xref="EnsemblGenomes-Gn:RBRH_01902" FT /db_xref="EnsemblGenomes-Tr:CBW76733" FT /db_xref="GOA:E5AUF9" FT /db_xref="InterPro:IPR002525" FT /db_xref="InterPro:IPR003346" FT /db_xref="UniProtKB/TrEMBL:E5AUF9" FT /protein_id="CBW76733.1" FT /translation="MEPTTIAIDLAKRVFQIHFVDTDGTIHSKALKRAQMLPFFANRPA FT ARIVMEACGSAHHWARQLSRLGHEVRLIAAQFVRPFVKSNKNDAADAAAIWEASQRPGM FT RFVAVKSAHQQAMLALHRMRQQLVRIRVMQVNQLRGLLYEFGVVLPQGRRPSIQAAQAA FT IATLADQFPAMLIDSLRDQLSRLHLLDDQIQRIEQRILEWRRGDPACRRISEIPGVGPL FT TATAAVSVIGQAKTFRSGREFAAYLGLVPRQNSSGGKVRLGGISKRGDVYLRTLLIHGA FT RSVISSSRHLPERLHALLTRRPTNERWAGCKTALLPAAFLQTTGFIQGKSV" FT CDS 332739..333029 FT /transl_table=11 FT /locus_tag="RBRH_01904" FT /db_xref="EnsemblGenomes-Gn:RBRH_01904" FT /db_xref="EnsemblGenomes-Tr:CBW76734" FT /db_xref="UniProtKB/TrEMBL:E5AUG0" FT /protein_id="CBW76734.1" FT /translation="MIARIGDYVPVQDMMSFSTVDRRTYHAMQTRRLVHRYWRRANRPR FT VVNQSTSCSMKWAARSPIQRSMPNPWKFSAPAQARIQSSKVCPINCGISAG" FT CDS complement(333213..333530) FT /transl_table=11 FT /locus_tag="RBRH_04250" FT /db_xref="EnsemblGenomes-Gn:RBRH_04250" FT /db_xref="EnsemblGenomes-Tr:CBW76735" FT /db_xref="UniProtKB/TrEMBL:E5AUG1" FT /protein_id="CBW76735.1" FT /translation="MLNNLVQSGIKKVTDKAQETVGHASGEGELKKVTDKAHEAVDQAA FT NQADQLSDQFHQATASIQMAYEGMVKGLRATVMNKPFKALATVAVLGFASGLLCARGRR FT R" FT CDS complement(333849..334034) FT /transl_table=11 FT /locus_tag="RBRH_01906" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01906" FT /db_xref="EnsemblGenomes-Tr:CBW76736" FT /db_xref="UniProtKB/TrEMBL:E5AUG2" FT /protein_id="CBW76736.1" FT /translation="MGSLKVARLHAGQLTTQRAAMDEVMDWLCFYNAHRLCPTLNYVSL FT IEYEANWFAAQQGQAA" FT CDS complement(334022..334378) FT /transl_table=11 FT /locus_tag="RBRH_01907" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01907" FT /db_xref="EnsemblGenomes-Tr:CBW76737" FT /db_xref="GOA:E5AUG3" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/TrEMBL:E5AUG3" FT /protein_id="CBW76737.1" FT /translation="MSSDASLAYVRAIHAQIKSKYGWPHMCKELLARGVRGQVAAGSEV FT VYAATHEDGGSHGCAVHGMVSALSQGMIVHSDCGSQYGSSLFQNTLRVYNTRSSMNRRG FT NCWGNAPTENLWAR" FT CDS 334547..335170 FT /transl_table=11 FT /locus_tag="RBRH_01909" FT /db_xref="EnsemblGenomes-Gn:RBRH_01909" FT /db_xref="EnsemblGenomes-Tr:CBW76738" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUG4" FT /protein_id="CBW76738.1" FT /translation="MDFGLNAALNDYQAYMCALESCPQPAASAPPPTLKPASGALANPL FT ASRPTTYHDLPPELIQQIGDYVPVQDVGNFSAVDRRTYHAMHSRRVVYRYWQRANQAVS FT LASVNQLLKEMDGTLADPAQHVEPIEALRRRLEALPYRERGEAFKRMYAAAQRNSTSLT FT RWRSGVRPRRGMSGRNSLTVWSYCCLAQLSLSSVIRRSWLGLGP" FT CDS 335038..335820 FT /transl_table=11 FT /locus_tag="RBRH_01910" FT /db_xref="EnsemblGenomes-Gn:RBRH_01910" FT /db_xref="EnsemblGenomes-Tr:CBW76739" FT /db_xref="UniProtKB/TrEMBL:E5AUG5" FT /protein_id="CBW76739.1" FT /translation="MAQRRAPEEGNVWTELADSLELLLFGSAEFVERYQALVARLGSLR FT VSEQAELIPVLCRQMIRFRGSDSRRPGLYAVLREHALQLPPSHQGTSVGMLASAIWVLP FT HAERLAQYTQLRDVALSLPDKQLGVALSYLPEGLTELPREHHAHELQLLVPALLRVLPA FT QRAQVALGLLMYTHRLDDALVQWVWQQGLSLLNGAGEVALCDVLSRLRAQGAISNLDDR FT QWNIARVEITRFMEANQFSEPARARIQDSVPWLRSRSH" FT CDS complement(336037..336204) FT /transl_table=11 FT /locus_tag="RBRH_01911" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01911" FT /db_xref="EnsemblGenomes-Tr:CBW76740" FT /db_xref="UniProtKB/TrEMBL:E5AUG6" FT /protein_id="CBW76740.1" FT /translation="MRAVVYEFADSRAGEHARQFLGDWRDLKNVLKRLPIHRADDIATL FT LPHCLAPAPA" FT CDS 336094..336270 FT /transl_table=11 FT /locus_tag="RBRH_04251" FT /db_xref="EnsemblGenomes-Gn:RBRH_04251" FT /db_xref="EnsemblGenomes-Tr:CBW76741" FT /db_xref="UniProtKB/TrEMBL:E5AUG7" FT /protein_id="CBW76741.1" FT /translation="MDGQSFEHVFQIAPVTEELASMFARAAIGELIDHGAHVGELRCGI FT CLYVCALPFSMRI" FT CDS 336240..336425 FT /transl_table=11 FT /locus_tag="RBRH_04252" FT /db_xref="EnsemblGenomes-Gn:RBRH_04252" FT /db_xref="EnsemblGenomes-Tr:CBW76742" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUG8" FT /protein_id="CBW76742.1" FT /translation="MRAAIQHADLILVVQDGKIVETGTHRSLLAQQGVYADLWYKQAHL FT SAPPSDSVNLAETADP" FT CDS complement(336500..337480) FT /transl_table=11 FT /locus_tag="RBRH_01912" FT /product="DNA integration/recombination/inversion protein" FT /function="DNA integration/recombination/inversion protein" FT /note="DNA integration/recombination/inversion protein" FT /note="COG: Integrase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01912" FT /db_xref="EnsemblGenomes-Tr:CBW76743" FT /db_xref="GOA:E5AUG9" FT /db_xref="InterPro:IPR002104" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="InterPro:IPR023109" FT /db_xref="UniProtKB/TrEMBL:E5AUG9" FT /protein_id="CBW76743.1" FT /translation="MTKADLFAAQQRTDWDRAPIQSFEAWLARQAGRGASRTLRSSSAQ FT VYLAQWRAFVRYLQARRLSLSAATPDTISAFLASLSRENRDQRARYRKLIERVFIDIDA FT CTQQSGSVNPAVGALRDSRATWKRVKGNQDTDFLLSQERQNIIDMLLSPVTATHYERWC FT SLRDRALVATFLGAGLKVSQTLRLTVKCINIGSDRLMHITSPGSRFSHQPRPEPFALSA FT LARWLVERHTSGVDSAWVFPGGRDGRPMHAVTALRATEAIVRACGVADRRQARTSPQTL FT RNSYIAALFEAGQTTLAVSEVLGVELITAERLKKAWQKWAARQSV" FT CDS 337625..338083 FT /transl_table=11 FT /locus_tag="RBRH_01913" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_01913" FT /db_xref="EnsemblGenomes-Tr:CBW76744" FT /db_xref="UniProtKB/TrEMBL:E5AUH0" FT /protein_id="CBW76744.1" FT /translation="MAQKAVGVTMPNRDATSVANWLTGNRALRIVSRDRAGVYAEGITL FT NAPQAIQVADQWPLLTSLGNAIERALSRCQRHIREVTCSHAMGRSCAIIKVGWQYARLR FT ALQHWSGIKSTPVDSPSGRNGHQQPASWIPIERILSSAVVKAAKASVL" FT CDS 338108..338224 FT /transl_table=11 FT /locus_tag="RBRH_04253" FT /db_xref="EnsemblGenomes-Gn:RBRH_04253" FT /db_xref="EnsemblGenomes-Tr:CBW76745" FT /db_xref="UniProtKB/TrEMBL:E5AUH1" FT /protein_id="CBW76745.1" FT /translation="MVVSVVRLSHLRRVEASLPDCLRASLMGLQPQVNVTGF" FT CDS complement(338205..338987) FT /transl_table=11 FT /locus_tag="RBRH_01914" FT /db_xref="EnsemblGenomes-Gn:RBRH_01914" FT /db_xref="EnsemblGenomes-Tr:CBW76746" FT /db_xref="UniProtKB/TrEMBL:E5AUH2" FT /protein_id="CBW76746.1" FT /translation="MAQRRAPEEGNVWTELADSLELLLFGSAEFVERYQALVARLGSLR FT VSEQAELIPVLCRQMIRFRGSDSRRPGLYAVLREHALQLPPSHQGTSVGMLASAIWVLP FT HAERLAQYTQLRDVALSLPDKQLGVALSYLPEGLTELPREHHAHELQLLVPALLRVLPA FT QRAQVALGLLMYTHRLDDALVQWVWQQGLSLLNGASEAALCDVLSRLRAQGAISNLDDR FT QWNIARVEITRFMEANQFSEPARARFQDSVPWFRSRSH" FT CDS complement(338855..339610) FT /transl_table=11 FT /locus_tag="RBRH_01915" FT /db_xref="EnsemblGenomes-Gn:RBRH_01915" FT /db_xref="EnsemblGenomes-Tr:CBW76747" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUH3" FT /protein_id="CBW76747.1" FT /translation="MAWHYRQEHGVHSPSLCLASCFQLACCAASLRIAPFFYRLPSLPM FT DFDLHAALNDYQAYMCALESCPQAAASAPPPTLKPASGALANPLASRPTTYHDLPPELI FT QQIGDYVPVQDVGNFSAVDRRTYHAMHSRRVVYRYWQRANQAVSLASVNQLLKEMDGTL FT ADPAQHVEPIEALRRRLEALPYRERGEAFKRMYAAAQRNSTSLTRWRSGVRPRRGMSGR FT NSLTVWSYCCLAQLSLSSVIRRSWLGLGP" FT CDS 339662..339817 FT /transl_table=11 FT /locus_tag="RBRH_01916" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01916" FT /db_xref="EnsemblGenomes-Tr:CBW76748" FT /db_xref="UniProtKB/TrEMBL:E5AUH4" FT /protein_id="CBW76748.1" FT /translation="MKTLTGWREALEVLTRREQLQRKACCYLGLSRRVATYTLKQPRKD FT RSAASD" FT CDS 339835..340062 FT /transl_table=11 FT /locus_tag="RBRH_01917" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01917" FT /db_xref="EnsemblGenomes-Tr:CBW76749" FT /db_xref="UniProtKB/TrEMBL:E5AUH5" FT /protein_id="CBW76749.1" FT /translation="MPRLGYRRMSAWLALGESRVRRMWQALQLNIAQRCPRRRRCGNDI FT GLPGATQPNSDQISAATIDRLLRDVREQAL" FT CDS complement(340355..340558) FT /transl_table=11 FT /locus_tag="RBRH_04254" FT /db_xref="EnsemblGenomes-Gn:RBRH_04254" FT /db_xref="EnsemblGenomes-Tr:CBW76750" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="UniProtKB/TrEMBL:E5AUH6" FT /protein_id="CBW76750.1" FT /translation="MGARLLDNRLAIVALITVQICDNFFDVGGHSLLVIRLISRIHASF FT GVAITIRTLFEAPNILWCHGSA" FT CDS 340469..340753 FT /transl_table=11 FT /locus_tag="RBRH_01918" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01918" FT /db_xref="EnsemblGenomes-Tr:CBW76751" FT /db_xref="UniProtKB/TrEMBL:E5AUH7" FT /protein_id="CBW76751.1" FT /translation="MPSYIKEVVTNLHRYKGHDSEAIVEQARAHSMQAQIPPRKCRKMP FT RNYDKHLYRHRHLVENAFLHLKPWRGIATRYAKRLDSFVAAAQIRCPTL" FT CDS 341171..341305 FT /transl_table=11 FT /locus_tag="RBRH_04255" FT /db_xref="EnsemblGenomes-Gn:RBRH_04255" FT /db_xref="EnsemblGenomes-Tr:CBW76752" FT /db_xref="UniProtKB/TrEMBL:E5AUH8" FT /protein_id="CBW76752.1" FT /translation="MISMSVDIGKLSAPESTIILSDLAKLRRLNKGAKNLYGFKWIGK" FT CDS 341493..342617 FT /transl_table=11 FT /locus_tag="RBRH_01920" FT /product="3-oxoacyl-[acyl-carrier-protein] synthase III (EC FT 2.3.1.41)" FT /function="3-oxoacyl-[acyl-carrier-protein] synthase III FT (EC 2.3.1.41)" FT /EC_number="2.3.1.41" FT /note="3-oxoacyl-[acyl-carrier-protein] synthase III (EC FT 2.3.1.41)" FT /note="COG: 3-oxoacyl-[acyl-carrier-protein] synthase III" FT /note="Pfam: 3-Oxoacyl-[acyl-carrier-protein (ACP)] FT synthase III::PF08545
3-Oxoacyl-[acyl-carrier-protein FT (ACP)] synthase III C terminal::PF08541" FT /db_xref="EnsemblGenomes-Gn:RBRH_01920" FT /db_xref="EnsemblGenomes-Tr:CBW76753" FT /db_xref="GOA:E5AUH9" FT /db_xref="InterPro:IPR013747" FT /db_xref="InterPro:IPR013751" FT /db_xref="InterPro:IPR016038" FT /db_xref="InterPro:IPR016039" FT /db_xref="UniProtKB/TrEMBL:E5AUH9" FT /protein_id="CBW76753.1" FT /translation="MRSTGIQALAVHLPDGVRTNAWWDGETSSPQKAKSSTMALTSSGS FT SKRRRINPYDAAMEHYLEDPFFGSVERRVVTNGEGSVELGVKAAQQVLDAADVSSDKVD FT CLIAVSMFPDRVGSGDAGYLAQALNTGGGAFNVEATCGGSMSALLTACAWVQAGLKERI FT LVVTTSRLSRAIEADDVTLKLCGDASAAFLVGPVKSGFGLLGAESLHTGKTCGTWLLDA FT IEDSSPTTSSGQRIRLRVDPSISHVLRTTAEPYLLDTTEGALAKAGLGIKDIDVVVLNT FT PTAWHAEFSANALGIELDRVVNTFPQVANIGPVLMPFNAYTATACGRIKAGDRVLLYGF FT GGQAEASAAVFRWPHVVLAAPPKDASVVNPASPQ" FT CDS 342786..343559 FT /transl_table=11 FT /locus_tag="RBRH_01921" FT /product="D-alanine-activating enzyme (EC 6.3.2.-)" FT /function="D-alanine-activating enzyme (EC 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="D-alanine-activating enzyme (EC 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_01921" FT /db_xref="EnsemblGenomes-Tr:CBW76754" FT /db_xref="GOA:E5AUI0" FT /db_xref="InterPro:IPR000873" FT /db_xref="UniProtKB/TrEMBL:E5AUI0" FT /protein_id="CBW76754.1" FT /translation="MWRTNSTSSSGSATRGRVSPRFVRLRAMWMKNHRKSKNDDRHCAA FT GTTVRAIGRLGEILRRHDSATARQPSARALVDSDGSALSYAELSAAADRIAVFLYHKGV FT VAGDRVGLFMHKSAQTLAAIFGILRLGAAYVPTDVSSSGTRAATLFDDCDVRVIFTDPE FT SARHLTQHAPQLKPRVVVMQPHHEEKNDPREDWQTLDMLHGEKHDYPRSPPDANRLAYI FT LYTSGSSEAPKGVAISQRNAVSFVEWASAAFNVTA" FT CDS 343663..344511 FT /transl_table=11 FT /locus_tag="RBRH_01922" FT /product="D-alanine-activating enzyme (EC 6.3.2.-)" FT /function="D-alanine-activating enzyme (EC 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="D-alanine-activating enzyme (EC 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_01922" FT /db_xref="EnsemblGenomes-Tr:CBW76755" FT /db_xref="GOA:E5AUI1" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUI1" FT /protein_id="CBW76755.1" FT /translation="MLQAPRHLATFLSARAITVWYSAPAILGMLAEQHKARSPAPNRLR FT LVLFAGEVFPIAKLRRLLQLWPQPAYYNLYGPTETNVCTAYRVPTPIPAERVEPLPIGH FT PCDHCDTIVVDEHQQPVPDGEPGLLCVAGPSVATGYWNAPEKTAQRFFQRNGQRWYNTG FT DIVRASPKGYLFLGRLDRMIKRHGYRIELDEIESCLAAHPELTACAVVSSGSDGNTTIT FT AFVVARDAPLCPTDLSRFCYNRLARYMVPDQFRYLPDLPRTSTGKTHYQLLERQCDAKQ FT A" FT CDS 344495..345640 FT /transl_table=11 FT /locus_tag="RBRH_01923" FT /product="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /function="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /EC_number="1.3.99.10" FT /note="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /note="COG: Acyl-CoA dehydrogenases" FT /note="Pfam: Acyl-CoA dehydrogenase, C-terminal FT domain::PF00441
Acyl-CoA dehydrogenase, C-terminal FT domain::PF08028
Acyl-CoA dehydrogenase, middle FT domain::PF02770
Acyl-CoA dehydrogenase, N-terminal FT domain::PF02771" FT /db_xref="EnsemblGenomes-Gn:RBRH_01923" FT /db_xref="EnsemblGenomes-Tr:CBW76756" FT /db_xref="GOA:E5AUI2" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR013786" FT /db_xref="UniProtKB/TrEMBL:E5AUI2" FT /protein_id="CBW76756.1" FT /translation="MPNKLDERRIALREQAARFARDQLSTDIAASDRLSVFHRDGWHRC FT AEFGLFSMAIPEDRGGAGATLSELLAVMEGLGYGSEDLGLLFSLNAHLWTVALPLAIHG FT TPTQRSRFLPGLMDGSLIGANASTEDEAGSDVFSMRTQAIRDGDGYVLNGSKTYITNAP FT IADLCVVYATIDPTLGPLGVTAFLVETTNPGLDLSPPLEKMGLRTAQMGRITLKDCRVP FT ADAILGREGRGVKVFESAMEYERGCILATTLGAMRRHLEACITHARTRRQFGQPIGKHQ FT AVSHRLADMKVNLDAACELVYRVGRLKDAGKDATLEAACAKLFVSEAYTKFSIDALRIY FT GAQGYLAQTPTERGLRDAIASLLYSGTSDIQRNIIATELGL" FT CDS 345884..346216 FT /transl_table=11 FT /locus_tag="RBRH_01924" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Permeases of the major facilitator superfamily" FT /db_xref="EnsemblGenomes-Gn:RBRH_01924" FT /db_xref="EnsemblGenomes-Tr:CBW76757" FT /db_xref="InterPro:IPR006842" FT /db_xref="InterPro:IPR010106" FT /db_xref="UniProtKB/TrEMBL:E5AUI3" FT /protein_id="CBW76757.1" FT /translation="MKRSSTMTPHDALFKQFLTHPETARDFLSLHLPTQWLAQCDLDTL FT RLESGSFVEEDLRAYYSDVLWSLQTRQGDGYVYALIEHQSRPERHMASANALRDSRHAA FT PFRGRT" FT CDS 346167..346808 FT /transl_table=11 FT /locus_tag="RBRH_01925" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: Putative transposase, YhgA-like::PF04754" FT /db_xref="EnsemblGenomes-Gn:RBRH_01925" FT /db_xref="EnsemblGenomes-Tr:CBW76758" FT /db_xref="InterPro:IPR006842" FT /db_xref="InterPro:IPR010106" FT /db_xref="UniProtKB/TrEMBL:E5AUI4" FT /protein_id="CBW76758.1" FT /translation="MRYAIAAMQRHLEAGHDQLPLVIPMLFYHGQVSPYPYSMRWLDSF FT EVPELASQLYAGGFPLVDVTVIPDDEIITHRRMAMLELLQKHIRQRDLATLVEQLASLL FT LAGYTTHEQLVSLMHYMLQWGDTTDPERFIRELAIRSPQHEEVLMTIAQKLEQKGEQKG FT LERGRMLGREEGHKEAALKIARTLLENGLEHETVKRMTGLPEADMKQICH" FT CDS 346980..347624 FT /transl_table=11 FT /locus_tag="RBRH_01926" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01926" FT /db_xref="EnsemblGenomes-Tr:CBW76759" FT /db_xref="UniProtKB/TrEMBL:E5AUI5" FT /protein_id="CBW76759.1" FT /translation="MRTTRAAAIICSVSKRFCRVLFSYAYLAQAVSCHVHCSNTQIMSL FT APFTSVQPVKAFALLQHLDGRNGTHRGTRESASDSCSGPSCNWVNRCRRSRPRIYSGST FT RSWPTRSPRAAGCRPPGASTLAAMPALFNGPLSAASQRQARVILNGLFTWLVDAGYLRG FT NPMALLCQRGRRPAARITRDLSLSLWDKVKRFVEQLPQQKAAQQAYYAHCR" FT CDS 347486..347821 FT /transl_table=11 FT /locus_tag="RBRH_01927" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01927" FT /db_xref="EnsemblGenomes-Tr:CBW76760" FT /db_xref="GOA:E5AUI6" FT /db_xref="InterPro:IPR011010" FT /db_xref="UniProtKB/TrEMBL:E5AUI6" FT /protein_id="CBW76760.1" FT /translation="MSTRPTASGSHHARPITLAVGQSQTLRRATAPAESGAASILCALP FT LADNASLLARPGISEVASTTMDDFSRRLSAQGHNQWWLEIVGKGKRARIVPASPELIAE FT LARYRQT" FT CDS complement(348245..348463) FT /transl_table=11 FT /locus_tag="RBRH_01928" FT /product="Transcriptional regulator, Cro/CI family" FT /function="Transcriptional regulator, Cro/CI family" FT /note="Transcriptional regulator, Cro/CI family" FT /db_xref="EnsemblGenomes-Gn:RBRH_01928" FT /db_xref="EnsemblGenomes-Tr:CBW76761" FT /db_xref="UniProtKB/TrEMBL:E5AUI7" FT /protein_id="CBW76761.1" FT /translation="MAQLAQLLDWRLVDLVAEGGTGALDRAMRMHRKLARLSLTQQKAL FT EHLLDEAIVMVTATLAAARRRGRKAES" FT CDS 348563..348829 FT /transl_table=11 FT /locus_tag="RBRH_01929" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase::PF01527" FT /db_xref="EnsemblGenomes-Gn:RBRH_01929" FT /db_xref="EnsemblGenomes-Tr:CBW76762" FT /db_xref="GOA:E5AKQ2" FT /db_xref="InterPro:IPR002514" FT /db_xref="InterPro:IPR009057" FT /db_xref="UniProtKB/TrEMBL:E5AKQ2" FT /protein_id="CBW76762.1" FT /translation="MKKSRYTEEQITFALKQAELGTPAAEVCRKMGISDATFYNWRQKY FT GGLGPSELRRLKQLEEENTKLKRLVAELSLDKSMLQDVLSKKL" FT CDS 348826..349704 FT /transl_table=11 FT /locus_tag="RBRH_01684" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Integrase core domain::PF00665" FT /db_xref="EnsemblGenomes-Gn:RBRH_01684" FT /db_xref="EnsemblGenomes-Tr:CBW76763" FT /db_xref="GOA:E5AKQ1" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR012337" FT /db_xref="InterPro:IPR025948" FT /db_xref="UniProtKB/TrEMBL:E5AKQ1" FT /protein_id="CBW76763.1" FT /translation="MKPSRLRELTTDLMQRFGVSQRQACRVLKLSRSVYSYQSIARDSN FT AIALRIKQITQTRVHYGYRRVHVMLRREGWRDNHKRVYRLYREQGLSLRHKRPRRNKAA FT RLRQPKQLVTAINEIWSMDFVADALFDGRRLRTLTIVDNYTRECLAIEVGATLRGEDVV FT AALDRIAVSRPLPRFIKADNGSEFISKVLDKWAYERGVEIDFSRPGKPTDNAKNESFNG FT RLREECLNEHWFLSLEDAKRKIEAWRQYYNEARPHSALQWMTPAEFACQCRPRADSAHP FT EEPEISTLERH" FT CDS 349991..350116 FT /transl_table=11 FT /locus_tag="RBRH_01685" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01685" FT /db_xref="EnsemblGenomes-Tr:CBW76764" FT /db_xref="UniProtKB/TrEMBL:E5AUJ0" FT /protein_id="CBW76764.1" FT /translation="MVDGKLKPWRAAQRLELASRQIRRLVERLREHGPQGTGRTF" FT CDS complement(350125..350499) FT /transl_table=11 FT /locus_tag="RBRH_01686" FT /db_xref="EnsemblGenomes-Gn:RBRH_01686" FT /db_xref="EnsemblGenomes-Tr:CBW76765" FT /db_xref="UniProtKB/TrEMBL:E5AUJ1" FT /protein_id="CBW76765.1" FT /translation="MAPFLQMPAGFLRAGASRRMGLAFGRQRLGQVRMVDSYSRALAQV FT LPEGEVSGVRRRAWLTRAACLGASLRLGEGGLEVALAYDILDEMVRVLPRLPRVGMTPV FT QIRDLADSFMLLANVVEIGW" FT CDS complement(350594..352000) FT /transl_table=11 FT /locus_tag="RBRH_01687" FT /product="ADP,ATP carrier protein" FT /function="ADP,ATP carrier protein" FT /note="ADP,ATP carrier protein" FT /note="COG: ATP/ADP translocase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01687" FT /db_xref="EnsemblGenomes-Tr:CBW76766" FT /db_xref="GOA:E5AUJ2" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="UniProtKB/TrEMBL:E5AUJ2" FT /protein_id="CBW76766.1" FT /translation="MTRTAVRRNYFKLMSMINASRKQWGMQFKLRPGEGRPLLWSALGL FT FWLSLAYYLIRPIRDTMGAVSGVQKLTWLFSATLLCMLLISFLFSKLLNRISLRRAVSI FT SYRVCIAILIMFAILMRSNAPEQAFWIGDVFFVWVSAYSVFSMTMYWMMTIDKFSKEQG FT ERLFGIVSAGANLGALAGSGMSTALSGLLGLGWTLAIAAILLELAARSTLQLTSTSTEL FT DKKHRRIAYQGKRTHAGSMTSGVQQKGNINLNGLAKLFHITPALRASHVASLCVYVVLL FT SLTSTALYFHQAILIQGLDIDNKERIRLFSLIDLAVNAVTIVIQLFLTSRVIRSLGVPI FT ALAMAPVTSAIGFSMLAWKQTVEILIAFRVISRIVNFSITKPVQETLFAAIDEKIRYKI FT KSFIDTVAYRSGDQLGAWTYAGMGMLGLSISAISFAMVPLSIFWLLNGVRLGRQYARLA FT AAQSDPDSSS" FT CDS complement(352013..352228) FT /transl_table=11 FT /locus_tag="RBRH_01688" FT /db_xref="EnsemblGenomes-Gn:RBRH_01688" FT /db_xref="EnsemblGenomes-Tr:CBW76767" FT /db_xref="UniProtKB/TrEMBL:E5AUJ3" FT /protein_id="CBW76767.1" FT /translation="MSPQGEATALAAETPPSRRNNKGFDYARIVSAMLFKLPISPHAKL FT FIETAATRCKWRTSRHDECCAAATRR" FT CDS 352271..352504 FT /transl_table=11 FT /locus_tag="RBRH_04256" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_04256" FT /db_xref="EnsemblGenomes-Tr:CBW76768" FT /db_xref="UniProtKB/TrEMBL:E5AUJ4" FT /protein_id="CBW76768.1" FT /translation="MLALHQMRQQLVRMRVMQVNQLRGLLYEFGVVLPQGRRLSIQAAQ FT AAIAMLADQFPAMLIDSLREFRGDTDVYRALR" FT CDS 352510..352839 FT /transl_table=11 FT /locus_tag="RBRH_01690" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01690" FT /db_xref="EnsemblGenomes-Tr:CBW76769" FT /db_xref="UniProtKB/TrEMBL:E5AUJ5" FT /protein_id="CBW76769.1" FT /translation="MRSTATKQASSATLRWVKQAVVTPFGRAMYEPNIDTFCANSSSAK FT RRVERAHLTLKDRLARKALIVSDVATFKGRRRAACSSTRWNYILGVFCATCLKPSISTA FT FLEIR" FT CDS complement(352858..353331) FT /transl_table=11 FT /locus_tag="RBRH_01691" FT /product="Plasmid stability protein stbB" FT /function="Plasmid stability protein stbB" FT /note="Plasmid stability protein stbB" FT /note="COG: Predicted nucleic acid-binding protein, FT contains PIN domain" FT /note="Pfam: PIN domain::PF01850" FT /db_xref="EnsemblGenomes-Gn:RBRH_01691" FT /db_xref="EnsemblGenomes-Tr:CBW76770" FT /db_xref="InterPro:IPR002716" FT /db_xref="UniProtKB/TrEMBL:E5AUJ6" FT /protein_id="CBW76770.1" FT /translation="MVTLICHNVDGRSVAPLLLYKTTVFLLDTNIVSELRKLRPHGAVV FT SWLESVPDHELYLSAVTLGEIQAGIEITREQDADKASTIEAWADQVSATYNVLPMDAAT FT FRLWSKLMHRQSNTVYEDAMIAASALMHKLIVATRNVRDFERFDVPVFNPFGK" FT CDS complement(353270..353548) FT /transl_table=11 FT /locus_tag="RBRH_01692" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="Pfam: Phd_YefM::PF02604" FT /db_xref="EnsemblGenomes-Gn:RBRH_01692" FT /db_xref="EnsemblGenomes-Tr:CBW76771" FT /db_xref="InterPro:IPR006442" FT /db_xref="UniProtKB/TrEMBL:E5AUJ7" FT /protein_id="CBW76771.1" FT /translation="MSSHYGSAMHAWPVQDAKARFSELLDACVSEGPQLVTRRGAETAV FT LVPITEWKRLNAAARPSLKALLLSNFSRGDLDLPQRGRAQRRTALAL" FT CDS 353562..353690 FT /transl_table=11 FT /locus_tag="RBRH_04257" FT /db_xref="EnsemblGenomes-Gn:RBRH_04257" FT /db_xref="EnsemblGenomes-Tr:CBW76772" FT /db_xref="UniProtKB/TrEMBL:E5AUJ8" FT /protein_id="CBW76772.1" FT /translation="MCHHRNARVHQLTLIHNRTSSRSMLYTLIVSGAAALKGRRHA" FT CDS complement(353733..354407) FT /transl_table=11 FT /locus_tag="RBRH_01693" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_01693" FT /db_xref="EnsemblGenomes-Tr:CBW76773" FT /db_xref="UniProtKB/TrEMBL:E5AUJ9" FT /protein_id="CBW76773.1" FT /translation="MPTRSTQHGCLTSNAAQMAADNVVNRPVRSRAAGRLEPCAGKLAC FT TVLRGARAGNGACLPDGKPRKPYEFDVKVSITTTHKEGWVVGARSMPGNPYDGHTLAQA FT LEQAAILSEVQPQIAIVDRGYKGVAIDGVKVYHPGLRRGITRGLRAMIRRRSAIEPVIG FT HMKADGKLDRNWLKGALGDAIHAVLCGAGHNLRMILRKLRLFYTLIRVVLLNRQAYMVS FT AA" FT CDS complement(354346..355818) FT /transl_table=11 FT /locus_tag="RBRH_04258" FT /product="Reverse transcriptase (EC 2.7.7.49)" FT /function="Reverse transcriptase (EC 2.7.7.49)" FT /EC_number="2.7.7.49" FT /note="Reverse transcriptase (EC 2.7.7.49)" FT /note="COG: Retron-type reverse transcriptase" FT /note="Pfam: Group II intron, maturase-specific FT domain::PF08388
Reverse transcriptase (RNA-dependent DNA FT polymerase)::PF00078" FT /db_xref="EnsemblGenomes-Gn:RBRH_04258" FT /db_xref="EnsemblGenomes-Tr:CBW76774" FT /db_xref="GOA:E5ANB8" FT /db_xref="InterPro:IPR000477" FT /db_xref="InterPro:IPR013597" FT /db_xref="InterPro:IPR025960" FT /db_xref="UniProtKB/TrEMBL:E5ANB8" FT /protein_id="CBW76774.1" FT /translation="MTEPAQTVKAVAGTGAPPAYGQAWNQINWDNVTAKVTRLQVRIAK FT ATRDGRWNKVQALQHLLTHSFHGKLLAVKRVTQNAGKRTAGVDGRIWATPMSKLKAAQS FT LTHRGYQALPLRRVYIPKSNGKERALGIPTMRDRAMQALWLTALLPIAETTADPNSYGF FT RPKRSTADAVEQCFKALAKRNSAQWVLEGDIRGCFDNFSHDWLLANIPMNKAVLRKWLQ FT AGFVDKGVLFPTDAGTPQGAIASPVLANMALDGLEEAVRSVLGPSKTARQPAKAHVVRY FT ADDFIATGASRELLEKQVKPAIEAFLSARGLQLASEKTLVTHIARGFDLLGQNVRKYGD FT KLLIKPARKSVQALLNKVSEVLGKNKAATQSQVIMQLNPILRGWAMYHRHVVAAATFAR FT IDHLVWTKLWRWAKRRHPRKNALWIKRRYFERRGLRDWIFACHVQPLDLAFRPTLFRLT FT GVTITRHTKVRSDANPFDPAWMPYFQRRANGC" FT CDS complement(356147..357112) FT /transl_table=11 FT /locus_tag="RBRH_03021" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_03021" FT /db_xref="EnsemblGenomes-Tr:CBW76775" FT /db_xref="UniProtKB/TrEMBL:E5AUK1" FT /protein_id="CBW76775.1" FT /translation="MPGQIADLPSITRGGSRMPELGTFGSKRGVSGNGYSYRNQVFTGE FT TYLQTKPPIDASSLTRWRKRLGEAGVEELLAETIEAAKRANVIKTSSLKRVIVDTTLME FT KAIAHPTDSRLLERCREHLVKAAARHGLKLRQNTNREAPRLASQVGRYAHAKQYKRMNK FT ALRSLRSRVGRVMRDLERQLNGVAQQSRSALDELISCTKRILTQKQKDKNKLYALHAPQ FT VECLAKVRREVANIIVSPAHKVGDETGRSVGRSLPVHALPATATCEATGTTCRAFWPRR FT LPRGRDVICEHQCGWDPRLSGMVNRCELPQASLGTTSQRC" FT CDS complement(357033..358547) FT /transl_table=11 FT /locus_tag="RBRH_03022" FT /product="Reverse transcriptase (EC 2.7.7.49)" FT /function="Reverse transcriptase (EC 2.7.7.49)" FT /EC_number="2.7.7.49" FT /note="Reverse transcriptase (EC 2.7.7.49)" FT /note="COG: Retron-type reverse transcriptase" FT /note="Pfam: Reverse transcriptase (RNA-dependent DNA FT polymerase)::PF00078" FT /db_xref="EnsemblGenomes-Gn:RBRH_03022" FT /db_xref="EnsemblGenomes-Tr:CBW76776" FT /db_xref="GOA:E5AUK2" FT /db_xref="InterPro:IPR000477" FT /db_xref="UniProtKB/TrEMBL:E5AUK2" FT /protein_id="CBW76776.1" FT /translation="MMHGREKSDSAVVAKKPANKVGKPAAQWVEPRAGTEGNANQNHTC FT RAQNRASVSQGLDRVRQLARQHKKMRFTTLLHHVTVERLSAALYALKRKATPGVDGVTW FT QSYEVGLGSNLRDLHRRVHTGSYRALPVLRRYIPKADAGLRPLGVAALEDKLVQSVMVE FT VLNAIYEEDFLGFSYGFRPGRNQHDALDALAAAIQWRPVNWILDADIRSFFDTVNRQWL FT IRFVKHRVADPRVIRLIGKWLDAGVLDNGRLMSVQAGTPQGSVICPLLANIYLHYVFDL FT WIERWRRQRARGTVVVSRYADDTVVGCQHEADALRLMKELRQRMEEFDLTLHPEKTRVL FT EFGRYAAERRRRKGMGKPQTFAYLGFTHISGTSRNGSFQLKRKSRKDRLRAKLKQVKEQ FT MRLRMHEPIASQGRWLAQIVRGYFAYHAVPTNIRALRAFRHGMMNIWRRTLRRRSQKDT FT MTWQRIERLADAWLPQPQILHAWPDRRFAVNHPRWEPNARIGHVRI" FT CDS complement(358606..358881) FT /transl_table=11 FT /locus_tag="RBRH_03023" FT /db_xref="EnsemblGenomes-Gn:RBRH_03023" FT /db_xref="EnsemblGenomes-Tr:CBW76777" FT /db_xref="UniProtKB/TrEMBL:E5AUK3" FT /protein_id="CBW76777.1" FT /translation="MVRVHYDEGIASHIAPEPCAGIREEVSEASAGERAGQPWSHEMAD FT IPDADALQYVEGNMSGRDIASACRSGVVVELAYTQAPCTGGGRSHV" FT CDS complement(358882..359172) FT /transl_table=11 FT /locus_tag="RBRH_03024" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_03024" FT /db_xref="EnsemblGenomes-Tr:CBW76778" FT /db_xref="InterPro:IPR008490" FT /db_xref="UniProtKB/TrEMBL:E5AUK4" FT /protein_id="CBW76778.1" FT /translation="MGPKTPVPEGDLFRQPLREQINLKHPLVRLADLIDWDRLNTAMSA FT SFVSQRGRPATSPRLIAGLLYLQHAFDLSDEDVRWQWLENPYWVRRETGKV" FT CDS complement(359617..360651) FT /transl_table=11 FT /locus_tag="RBRH_03025" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase IS116/IS110/IS902 family::PF02371" FT /db_xref="EnsemblGenomes-Gn:RBRH_03025" FT /db_xref="EnsemblGenomes-Tr:CBW76779" FT /db_xref="GOA:E5AUK5" FT /db_xref="InterPro:IPR002525" FT /db_xref="InterPro:IPR003346" FT /db_xref="UniProtKB/TrEMBL:E5AUK5" FT /protein_id="CBW76779.1" FT /translation="MHTVRGAQAAMRVQALLEVIERYKQKWSLPQEVRVVVSYEAGQDG FT FWIYRALRLRGMECYVIDAASIPVERHRRRAKTDRLDAIKLVTNLRAWLHGERDRMRVV FT RVPSLQDEASRQLIRDRGQLHKEVLQHRERMRKLLITMGCWDGFDHRTFAKRLASGKLV FT CHDGTPLPSELHERLLRETARLALAEEQLAALERTLQERLPAPVRKRIAYLRHLKGVGH FT IGASRLVLELFWREFDNRRQLGACVGLVPQPYDSGQSRIDQGISKQGNRRARTQLIEMA FT WCWLRYQPSSALAQWFNKRTQGTEANRRARRIAIVAFARRLVIALWRYLKDGVIPQSAQ FT LKGA" FT CDS 361141..362493 FT /transl_table=11 FT /locus_tag="RBRH_03026" FT /db_xref="EnsemblGenomes-Gn:RBRH_03026" FT /db_xref="EnsemblGenomes-Tr:CBW76780" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUK6" FT /protein_id="CBW76780.1" FT /translation="MDFDXNAALNYPASYVCAGQTGQRPAASTPPRPRCDDALTCSSST FT RPTTYDDLPPELIARIGDYVPIQDVTSFATVDRRTYHAMQARRLVHRYWQRANQAVSLA FT SVNQLLDEMGGALSNPAQHIEPIDALSQRLRALPEAERVEAFKCVFAAAERIPQDGVRI FT QKALLRTFLDFPLSRRVELFDFAYAMAQRRAPGQDNIWAELADSLQCLSLRSSFAEQRY FT QALLARLASLRVSEQAELIPALSSLLLYFNKTDPRVPERYALLRGHALQLPPSHQGASV FT GMLARVVEILPKAEQFAQYTQMRDWALSLPDEQWGIALRYLPEGLEALSREQRAQELTL FT LEGHLARVPMSQRVPAAFGLLKCLPFLNDVQAKRTWRQSLNLLNGASETALWDLLSQLR FT ADWVLSELSNFGWEMAVGEITRFMAATQFSEPAQARFQANVNWLRSEPDNI" FT CDS complement(362808..363158) FT /transl_table=11 FT /locus_tag="RBRH_03028" FT /db_xref="EnsemblGenomes-Gn:RBRH_03028" FT /db_xref="EnsemblGenomes-Tr:CBW76781" FT /db_xref="UniProtKB/TrEMBL:E5AUK7" FT /protein_id="CBW76781.1" FT /translation="MPAVDNPAKLDLSPISFPLSPRLIKCPLIYRSTLRGRYMPPMACF FT LGKGRVVRMCSRGCRQGRWSRRERSACPACRPSSAVAMIKRPACLRAYTRLTCLTCQWA FT CLSAGRSCWALW" FT CDS complement(363085..364413) FT /transl_table=11 FT /locus_tag="RBRH_03029" FT /db_xref="EnsemblGenomes-Gn:RBRH_03029" FT /db_xref="EnsemblGenomes-Tr:CBW76782" FT /db_xref="UniProtKB/TrEMBL:E5AUK8" FT /protein_id="CBW76782.1" FT /translation="MLIANGFILSSRFQTNLPRNQAGDFKLRLTITSNQTEFEAQNTNT FT QTSPTRAPSSSERASPKPTRSLSKTDEFDAIRNKLENNPNAAKALSRFAARAQGYLVRE FT KSVKVQSHGAGIVQVTIKGGPGGVRPPGTPLAKIRDMLTPPPKTQSEKQSDSVGDGIAT FT YNMLIVKGGTKSGKVIGTKEGEPPQPPQALAAQAPKRSAIINGGYFVHKSGLKIMQGGS FT EGKATKSDYGRPVGPTATRSDHVDVAPPWQNDYGQLLQDGKVGITSGPVLALNGQRARL FT ENNDGRLQYRNAEGEDNPLNKFAGALTHANERNERAAVSVRPELSVDPTDGTHRLSDKP FT GDLVMHTLTTTDGKRDLGVPIKGRQPEEGGWQEITEMGADPTGRYKDADKGIGVSSFNL FT DGGGSTFLGVQDENGVVKKLAGSGQPGETRPVANIISAQPTLD" FT CDS 365000..365131 FT /transl_table=11 FT /locus_tag="RBRH_03030" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_03030" FT /db_xref="EnsemblGenomes-Tr:CBW76783" FT /db_xref="UniProtKB/TrEMBL:E5AUK9" FT /protein_id="CBW76783.1" FT /translation="MHSLLMPKSNEQMPIAHGSGCYAKLLAQWAKIEILVFLHSIIA" FT CDS 365180..366724 FT /transl_table=11 FT /locus_tag="RBRH_03031" FT /product="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit I (EC 1.10.3.-)" FT /function="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit I (EC 1.10.3.-)" FT /EC_number="1.10.3.-" FT /note="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit I (EC 1.10.3.-)" FT /note="COG: Cytochrome bd-type quinol oxidase, subunit 1" FT /note="Pfam: Bacterial Cytochrome Ubiquinol FT Oxidase::PF01654" FT /db_xref="EnsemblGenomes-Gn:RBRH_03031" FT /db_xref="EnsemblGenomes-Tr:CBW76784" FT /db_xref="GOA:E5AUL0" FT /db_xref="InterPro:IPR002585" FT /db_xref="UniProtKB/TrEMBL:E5AUL0" FT /protein_id="CBW76784.1" FT /translation="MRAPRAYHAPGARARGLLRNGASSNCGRRCRDGGTRMLGLSALDL FT ARFQFAFTIAFHILFPAITIGLASYLAVLEGCWLRTRNVVYRDLYQFWIKIFAVNFGMG FT VVSGIVMAYQFGTNWAGFSRFAGGVTGPLLAYEVLTAFFLEAGFLGVMLFGWNKVGPGL FT HFLSTIMVAVGTLISTTWILASNSWMHTPQGYQIIDGRVVPVHWLQVIFNPSFPYRLVH FT MSLAAFLATALFVAASAAWHLLRGHDNAAIRKMLSMAMGMILVVAPIQAVVGDAHGLNT FT LEHQPAKLAAIEGHWENRENEAVPLIVFGWPDMQREQTRYALEIPYLGSLILTHSWNKQ FT FQGLKAFPPDERPNSTVVFWTFRAMVGLGLLMIALGAWSLFLRRRARLYHCRAFLHCTL FT VMGPAGLAAVLAGWLTTEIGRQPWVVYGLLRTTDAVTPHSAPEILLSVVLFVVSYFFVF FT GAGLAYILRLIRQGPRPQPDATPPMGGPGQPHTPARPLSAAHEDEHRTAKTDDAGR" FT CDS 366730..367737 FT /transl_table=11 FT /locus_tag="RBRH_03032" FT /product="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit II (EC 1.10.3.-)" FT /function="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit II (EC 1.10.3.-)" FT /EC_number="1.10.3.-" FT /note="Cyanide-insensitive cytochrome bd-type quinol FT oxidase subunit II (EC 1.10.3.-)" FT /note="COG: Cytochrome bd-type quinol oxidase, subunit 2" FT /note="Pfam: Cytochrome oxidase subunit II::PF02322" FT /db_xref="EnsemblGenomes-Gn:RBRH_03032" FT /db_xref="EnsemblGenomes-Tr:CBW76785" FT /db_xref="GOA:E5AUL1" FT /db_xref="InterPro:IPR003317" FT /db_xref="UniProtKB/TrEMBL:E5AUL1" FT /protein_id="CBW76785.1" FT /translation="MGFDISLVWAVIIFAGVMMYVVTDGFDLGIGLLFPFVSNRTERDL FT MMNSVAPVWDGNETWLVLGGAGLLAAFPRAYAILLSALYLPLIFMLLGLIFRGVAFEFR FT FKANDRERPIWDIAFMAGSLLASFFQGVALGAYIDGVKVNGDAFAGGALDWVKPFALFC FT GLGVVVIYALLGATWLIMKTEHTLQHTMIGVARRLTWLVLAAIAIVSIWTPIAHPHIAQ FT RWFTLPNLLWFCPVPLLVLLCVYALQRSLSHAPHAGPFLCALALMFLGYTGLAISIWPN FT IVPPSLSIWDAAGPLQSQGFTLLGTLFIIPFILGYTMWSYYVFRGKVRPGEHYH" FT CDS 368005..368172 FT /transl_table=11 FT /locus_tag="RBRH_03033" FT /db_xref="EnsemblGenomes-Gn:RBRH_03033" FT /db_xref="EnsemblGenomes-Tr:CBW76786" FT /db_xref="UniProtKB/TrEMBL:E5AUL2" FT /protein_id="CBW76786.1" FT /translation="MSACFSASCQPARVADSTVHYAKFTGRVRCRDAALAAALVGVVHW FT RGGQRRAQAA" FT CDS complement(368186..368731) FT /transl_table=11 FT /locus_tag="RBRH_03034" FT /product="Bacterioferritin" FT /function="Bacterioferritin" FT /note="Bacterioferritin" FT /note="COG: Bacterioferritin (cytochrome b1)" FT /note="Pfam: Ferritin-like domain::PF00210" FT /db_xref="EnsemblGenomes-Gn:RBRH_03034" FT /db_xref="EnsemblGenomes-Tr:CBW76787" FT /db_xref="GOA:E5AUL3" FT /db_xref="InterPro:IPR008331" FT /db_xref="InterPro:IPR009040" FT /db_xref="InterPro:IPR009078" FT /db_xref="InterPro:IPR012347" FT /db_xref="InterPro:IPR014490" FT /db_xref="UniProtKB/TrEMBL:E5AUL3" FT /protein_id="CBW76787.1" FT /translation="MEVAMTDTFRLDLETIRERARQHMDEGPVTSTYSADRDTILKLLN FT DALATELVCTLRYKRHYFMAKGINSEAVADEFAQHAAEEQQHADQLAQRIVQLGGAPDF FT APAGLASRSHSEYVEGETLTEMIRENLVAERIAIDTYREIVKYIGDKDPTTRRIFEEIL FT AVEEEHADDMADLLAERA" FT CDS complement(368703..368891) FT /transl_table=11 FT /locus_tag="RBRH_03035" FT /db_xref="EnsemblGenomes-Gn:RBRH_03035" FT /db_xref="EnsemblGenomes-Tr:CBW76788" FT /db_xref="UniProtKB/TrEMBL:E5AUL5" FT /protein_id="CBW76788.1" FT /translation="MFFLLVATVMVRASKLTGLATRGAQTARNFILRFRCHVCRQLADR FT RDEDMTVTHGGCNDRHL" FT CDS complement(368960..369160) FT /transl_table=11 FT /locus_tag="RBRH_03036" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="Pfam: Protein of unknown function FT (DUF1328)::PF07043" FT /db_xref="EnsemblGenomes-Gn:RBRH_03036" FT /db_xref="EnsemblGenomes-Tr:CBW76789" FT /db_xref="GOA:E5AUL4" FT /db_xref="InterPro:IPR009760" FT /db_xref="UniProtKB/TrEMBL:E5AUL4" FT /protein_id="CBW76789.1" FT /translation="MALAMEVAIMLRWALFFAIVAIIAGLLGFSGIATGAAAIAKFLFF FT VFLVLCVVFLLFGIFVAKKVT" FT CDS complement(369407..369547) FT /transl_table=11 FT /locus_tag="RBRH_03037" FT /db_xref="EnsemblGenomes-Gn:RBRH_03037" FT /db_xref="EnsemblGenomes-Tr:CBW76790" FT /db_xref="UniProtKB/TrEMBL:E5AUL6" FT /protein_id="CBW76790.1" FT /translation="MTLTPLSETCVKRLAHPAHDFDSQANAILDGSTPAIGAAVSAWTQ FT K" FT CDS 369776..371707 FT /transl_table=11 FT /locus_tag="RBRH_03038" FT /product="Thiamine biosynthesis protein thiC" FT /function="Thiamine biosynthesis protein thiC" FT /note="Thiamine biosynthesis protein thiC" FT /note="COG: Thiamine biosynthesis protein ThiC" FT /note="Pfam: ThiC family::PF01964" FT /db_xref="EnsemblGenomes-Gn:RBRH_03038" FT /db_xref="EnsemblGenomes-Tr:CBW76791" FT /db_xref="GOA:E5AUL7" FT /db_xref="InterPro:IPR002817" FT /db_xref="InterPro:IPR025747" FT /db_xref="UniProtKB/TrEMBL:E5AUL7" FT /protein_id="CBW76791.1" FT /translation="MVANPKFLSESARVDDAAIAPLPNSRKIYVTGSRSDLRVPMREIS FT QADTPTGFGGEKNPPITVYDTSGPYTDPDVRIDIRAGLPALREAWIEERGDTERLEGLS FT SQYGQARAADADTAHLRFPGLHRAPRRAKAGANVTQMHYARRGIITPEMEFIAIRENQR FT RHEYLESLRASGPQGAKLAELIGRQHRGNAFGAAAFSGTQAREITPEFVRDEVARGRAI FT IPANINHPESEPMIIGRNFLVKVNANIGNSAVTSSIGEEVDKMTWAIRWGGDTVMDLST FT GKNIHETREWIIRNSPVPIGTVPIYQALEKVHGKAEELTWEIFRDTLIEQAEQGVDYFT FT IHAGVLLRYVPMTASRMTGIVSRGGSIMAKWCLAHHRESFLYEHFEDICEIMKAYDVSF FT SLGDGLRPGSIYDANDEAQLAELKTLGELTQIAWKHDVQTMIEGPGHVPMQLIKENMDL FT QLEWCNEAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPNKD FT DVKEGIITYKLAAHAADLAKGHPGAQIRDNALSKARFEFRWEDQFNLGLDPDKAREFHD FT ETLPKDSAKVAHFCSMCGPHFCSMKITQDVREFAEKQGVGEVEALRKGMEVKAIEFKQS FT GAEIYQKQ" FT CDS 371823..372035 FT /transl_table=11 FT /locus_tag="RBRH_03039" FT /product="Osmotically inducible lipoprotein B" FT /function="Osmotically inducible lipoprotein B" FT /note="Osmotically inducible lipoprotein B" FT /db_xref="EnsemblGenomes-Gn:RBRH_03039" FT /db_xref="EnsemblGenomes-Tr:CBW76792" FT /db_xref="GOA:E5AUL8" FT /db_xref="InterPro:IPR008816" FT /db_xref="UniProtKB/TrEMBL:E5AUL8" FT /protein_id="CBW76792.1" FT /translation="MNSVKRIGAAALSAALLTSLAACDGMTTRQRNTAIGAGVGGVAGA FT AVGGNALSTLGGAAVGGIIGNQVGK" FT CDS 372479..373414 FT /transl_table=11 FT /locus_tag="RBRH_03040" FT /product="Transporter, drug/metabolite exporter family" FT /function="Transporter, drug/metabolite exporter family" FT /note="Transporter, drug/metabolite exporter family" FT /note="COG: Permeases of the drug/metabolite transporter FT (DMT) superfamily" FT /note="Pfam: Integral membrane protein DUF6::PF00892" FT /db_xref="EnsemblGenomes-Gn:RBRH_03040" FT /db_xref="EnsemblGenomes-Tr:CBW76793" FT /db_xref="GOA:E5AUL9" FT /db_xref="InterPro:IPR000620" FT /db_xref="UniProtKB/TrEMBL:E5AUL9" FT /protein_id="CBW76793.1" FT /translation="MLILPMTARNLLYLLVLAALWGASFLFIRIGVAEFGVTPLMALRV FT SIGAVFLATLLVAQKGLAGAWHSARRQWWPLFVVGVLNSAVPFCLFAYAELTLSAGLTS FT VINATTPLWGALVAFVWLGDRLSSMRTAGLALGFAGVVLLVWDQITAPVGASGTPVPAT FT TTALAAGAALGATALYGVAANYTKQYLSGVDPLTVACGSMVGASIALLPLAAWCWPTAQ FT VSTHAWLAVLALGVACTGIAYRLYFHLLATAGPARAMTVTFVVPVFGILWGALFLAESV FT SMRMIEGCGVVLIGTALAAGFIKRLRAQAS" FT CDS 373822..374223 FT /transl_table=11 FT /locus_tag="RBRH_03042" FT /product="Peptidyl-tRNA hydrolase family protein" FT /function="Peptidyl-tRNA hydrolase family protein" FT /note="Peptidyl-tRNA hydrolase family protein" FT /note="COG: Protein chain release factor B" FT /note="Pfam: Peptidyl-tRNA hydrolase domain::PF00472" FT /db_xref="EnsemblGenomes-Gn:RBRH_03042" FT /db_xref="EnsemblGenomes-Tr:CBW76794" FT /db_xref="GOA:E5AUM0" FT /db_xref="InterPro:IPR000352" FT /db_xref="UniProtKB/TrEMBL:E5AUM0" FT /protein_id="CBW76794.1" FT /translation="MHKLAIPDQEITMTAVRAQGAGGQNVNKVSSAIHLRFSIRSSSLP FT EVVKMRLLALNDNRITRDGVIVIKAQSYRTQELNRAEALARLHELIERANTPRRPRRAT FT QPTLASRRRRLDTKTRRGEVKAGRRPVTD" FT CDS complement(374251..376326) FT /transl_table=11 FT /locus_tag="RBRH_03043" FT /product="Exodeoxyribonuclease V alpha chain (EC 3.1.11.5)" FT /function="Exodeoxyribonuclease V alpha chain (EC FT 3.1.11.5)" FT /EC_number="3.1.11.5" FT /note="Exodeoxyribonuclease V alpha chain (EC 3.1.11.5)" FT /note="COG: ATP-dependent exoDNAse (exonuclease V), alpha FT subunit - helicase superfamily I member" FT /db_xref="EnsemblGenomes-Gn:RBRH_03043" FT /db_xref="EnsemblGenomes-Tr:CBW76795" FT /db_xref="GOA:E5AUM1" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR027417" FT /db_xref="InterPro:IPR027785" FT /db_xref="UniProtKB/TrEMBL:E5AUM1" FT /protein_id="CBW76795.1" FT /translation="MMTDIMLAQGFSRRIGALAQSLGAAAGDARVAAAAAAMVSAATAN FT GHVCIELAALARQLGQPSDTVRASLLASGVATRIDDDEPAPRLPLVIDLDDRLYLARYY FT EFERGLANALSARARAEFDDASFDDAQRWRNVLTRYFGEASGSDLDWQRVAAAVALSGQ FT LTIVSGGPGTGKTTTVVGVLACLLDAKPDLRIALAAPTGKAAQRMLEALASRADRLAHD FT IAAKLPTASYTLHRLLGSTSDRGFRHHRRNSLPYDVIVVDEASMIDVALASRLVDAVAP FT RARLILLGDKDQLAAVDAGAVFAELSAHPCYVGQRAERIAQALGCTVDTLRNALAAHVR FT GGLPQLQPATLGQAATPTRLTASAPPAAPAPPSASAQRDLFADDNPAVGADIVEPAPND FT TARAADGAQPAALANCVVWLQTNYRFGLDSPIGQLSSAIRDGSPADALGVLDAADDRAP FT AHFIDDGGPAIGHAARDYIARGFARYANLLAGMLQRCESQAAALFDALNAFRVLCAVRA FT GPHGVDALNEWISAELRRVARLPLAPAARWFAGRPVIVTRNDYALGLFNGDIGIALPAG FT DGTLRVVFEQGAGQRRSVSPAMLPSHETAFALTVHKSQGSEFERAALVLPPTFSRALSR FT ELIYTAVTRARAQITIIGTRAVLAQAIGTPTRRDTGLSARLRYAEARARRETASSR" FT CDS complement(376368..380105) FT /transl_table=11 FT /locus_tag="RBRH_03044" FT /product="Exodeoxyribonuclease V beta chain (EC 3.1.11.5)" FT /function="Exodeoxyribonuclease V beta chain (EC 3.1.11.5)" FT /EC_number="3.1.11.5" FT /note="Exodeoxyribonuclease V beta chain (EC 3.1.11.5)" FT /note="COG: ATP-dependent exoDNAse (exonuclease V) beta FT subunit (contains helicase and exonuclease domains)" FT /note="Pfam: UvrD/REP helicase::PF00580" FT /db_xref="EnsemblGenomes-Gn:RBRH_03044" FT /db_xref="EnsemblGenomes-Tr:CBW76796" FT /db_xref="GOA:E5AUM2" FT /db_xref="InterPro:IPR000212" FT /db_xref="InterPro:IPR004586" FT /db_xref="InterPro:IPR011335" FT /db_xref="InterPro:IPR011604" FT /db_xref="InterPro:IPR014016" FT /db_xref="InterPro:IPR014017" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUM2" FT /protein_id="CBW76796.1" FT /translation="MMTSDVLELDVFACALDGVTQIEASAGTGKTWNICALYLRLLLEK FT DLQADQILVVTFTKAATAELHERIRARLMQLEQALAHGVALDDPFVTGLIGRLVDGDAP FT ETATQRALKRIRRALHGFDQAAIHTIHAFCQRALQEAPFAAAMPFALETEADDTTLRFD FT VAAQFWRERVEPEAARTPGFAHWLVAHGAGPTVLQALLAQRLKKPLAELVWTDPACDET FT VDTAIDHFGRAKNLWRDEREQIAQRLADCATQLHQRTHKPSQVQAALAAWERFFVRGDR FT YAPVPKDALKLTSSSLTAATKVQCQPPTHPFFDCADALVAALREEQAMHLRRWFALVRE FT WLRVGPSSVAERKRTARIMSFDDLLANLHHALHVHPWLADALRERYPAALIDEFQDTDP FT LQFAIFNQIFAPKGPLFLVGDPKQAIYSFRAADLHTYLDARAHASARYTLAVNQRSDPA FT LIAACNRLFGANPRAFVLDGLDYHPVRAAMRSRPAFVDRHDPLGASDGSGAALRVWWLP FT DHAPLSKRDAERAAAEACAAEIARLMRDARAGDATIGTEPLAPANIAVLVQAHRQGMLM FT KRVLRGWGIGSVELAQASVFASIDAEQFERLLLAIDTPGDLRRLRAALATDWIGLDAAA FT LWAIEQGEPAAAAAGRCEPVPSELDSASWVERFAGYRLLWHERGFAPMWRIVMRELRIA FT QRLASADDGERRLTDVNHLAELIQARDSEHPGIAPTLCWLSAQRADPDVGDETQLRLES FT DRDLVQIVTIHKSKGLEYPVVFCPFLTNGALRAGPSCAALPVAREYHREDGLAVLHFGC FT DGDEAQRIDRGVRREQAAERARLIYVALTRAVYRCYLVAGIYTSGAHASTKEARQSVLN FT WLVAGGSTHFDAWLDGPPETAALAACWRALPGDDEGVVVVPLPTVARRDPLPPPDASHV FT DVHARVPARRLFDAWRIASFSSLASTRQRPLPDIDDVLHARPDHDDDVAQADTQAIKAD FT LEPMPTNASPGLRDDDILRFPRGPAAGDCLHRLMELADLRDPSSWPTAIVRALTEQPVS FT SRELSTEQLSAMMTRLLRDLAHTPLEADFMLGELDPSRRLTELEFVFPVASLDMRRFAT FT MLEEHGIAGMALDDGVLHGYLKGFIDAVIEFRGRFWIIDWKSNYLGNSPHAYRAAELSA FT AMDAHAYRLQALIYTIALHRYLRARLPDYDYDTHFGASLYLFLRGVRPDWPGAGIERFR FT PTRAAVDAFDALFSTGGGHA" FT CDS complement(380102..383857) FT /transl_table=11 FT /locus_tag="RBRH_00335" FT /product="Exodeoxyribonuclease V gamma chain (EC 3.1.11.5)" FT /function="Exodeoxyribonuclease V gamma chain (EC FT 3.1.11.5)" FT /EC_number="3.1.11.5" FT /note="Exodeoxyribonuclease V gamma chain (EC 3.1.11.5)" FT /note="COG: Exonuclease V gamma subunit" FT /note="Pfam: Exodeoxyribonuclease V, gamma FT subunit::PF04257" FT /db_xref="EnsemblGenomes-Gn:RBRH_00335" FT /db_xref="EnsemblGenomes-Tr:CBW76797" FT /db_xref="GOA:E5AUM3" FT /db_xref="InterPro:IPR006697" FT /db_xref="InterPro:IPR011335" FT /db_xref="InterPro:IPR013986" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUM3" FT /protein_id="CBW76797.1" FT /translation="MISIEYRIDAWVGTQCCESSALHRCFLHPPEVMLVYTITSGGMSS FT GTSRVLPSAGEERVFDPQPNNVPGQRNATGLSRTIGRTAGFACGRRFVMLGSFTNDGAP FT LWPSRVAIFIRRFMLELFYSNRYETLASALLGDLARIGGDLWRPQPIIVPNTAVRRRLE FT LDYADRFGLCANVEFCYLAQWLWAQIARVDVIDVPRESPFAPERLAWRLYRRLAQRDTV FT RDGDDQVSSTRLDAYLSAADPAMTFDLARRIACVFDHYLTYRPHWLAQWLAGESIFAPR FT RQPGGAPRLADATPIQRADEAWQAQLWRDVLGELAGGHDAGADALERMSPPAYRFLSIA FT SQLDLDDIARADWPAQVSVFALPTMPPLHVQLLRELSRWIDVRIYALNPCREYWFDIVT FT QRHADALDAAGQLDYQTVGHPLLAEWGRQTQAQLALLHEHTEGAVAGESSEFVEAPACS FT WLAVVQNAILSLEHPVSPSPPPARNGIEVYVCHSLARQFEVLHDRLLAEFDADPSLTPA FT DVLIAVPDLIAAAPIVDAVFGAVPPSDPRRIPYRVTGLPPSQANPLARTLLDWLALAER FT DVNASALVEWLRVDAVAARYDIDPVALDTVQGWLANAGARRSFAPREQRDLDAPRARHT FT FADALTRLFLGYAMPDDALPIGDWLPVAASTGADAMLLGRLAQFVDELDAFALACATPH FT TVAQWRNVLLAALEQFFDARGPNADSLSELRDALDALFVQIEAGAPHTPLPAAVLRTAL FT LSVLDDPARGGVPSGAVTVSPLSSLRGVPFRVVCMAGIDDGVLPTRARADEFDLMAAFA FT QPGDRQRRDDERNLFLDLMLAARDTLLLSYTGRNIRDNAELPPSALVAELLDHLASLKA FT GEGASLDEIALARRSFVTEHPLQPFALSYFSMQGPLLTYDADRAQVAAALADPTRRMEA FT DAMPPFFGVALPADMRETIGLDELARFWRHPQRALLRERLGIVLHRAQAPLPDTEPYEF FT DYAGRDALAGRLLPLLVESSAYAERAHEIARAIPELPGGATGRAIHEREVVALSKLAEY FT IRGQVGTGLEPVEFSIHVAPRWPERLESVSTLLDRVPAWRGTVLLPTVLTGVLDGVTRN FT ELVLYRYARPTARDYLDAWLRHLCWCAASPQASRQTLWIGDDERFVLTTPRDPHAYLGE FT LLALYRAGLRAPLRFFPKSAWSLVSQSESAARNAWSNERTGGELDDPAIQLALRGTPMT FT LDDTFVAIARTVFEPLLAHLQPAEDA" FT CDS 383817..386249 FT /transl_table=11 FT /locus_tag="RBRH_00334" FT /product="Integral membrane protein" FT /function="Integral membrane protein" FT /note="Integral membrane protein" FT /note="COG: Predicted membrane protein" FT /note="Pfam: Bacterial membrane protein of unknown function FT (DUF893)::PF05976" FT /db_xref="EnsemblGenomes-Gn:RBRH_00334" FT /db_xref="EnsemblGenomes-Tr:CBW76798" FT /db_xref="UniProtKB/TrEMBL:E5AUM4" FT /protein_id="CBW76798.1" FT /translation="MPTQASMRYSIEIKKFLYSQYFYGGLRIATGISLPAVVLLVVFHN FT RELGFTISTGALGACVVDMPGPLKYKHNEMLACSVIGFFSALATGIATAHPLSLWLTVV FT PLTFVLSLIVVYGNKWPQISFATLFMMVVTLEERFTPLQALANAGWILAGGIWYTYWST FT FVSRWQIHRIEQQAIAESVFACADYLRARARFYDPTHDLDECNRQLVDKQVLAVDRQEA FT ARDIVLRNLPKLRSGQLDAHRTMLFNLFINTVDLHELFVGAHVDHPMIRATFGGSDLMV FT FFRDLIEKAATDLEDVGLAVLQDRPSAQRINAKAELRAIEYEIELMRKKALPTTNPEAY FT SAIVSAFRRVWSAQRLIERMHRNTRVDISAQETEMRIDQALSRFLSSRRVPWMQIFSNL FT TMSSPSFRHALRVTAAVAIGLWLGRLLPLTNAYWIVMTTIIILKPGYSLTKQRNTQRII FT GTTIGCAASIALILSVKEPPLLLAVMFASMVMSYSLLLFNYTASVVFTSSYVLLMFHML FT APGSLRIIGERAIDTVLGCAIAIAASHLFPYWEYRLMGKLVNGLLSATRQYLEICWYAG FT KSRTAAGGATEQVKPPPSDPAAPADKKGKEASALVSSATAQPTPAASAAASAIDSDIRY FT RLARKNVHIAFANVGQALQRMLLEPKSAQRYVAELNDLLVRVHALTAQITASAPLMMTL FT SQSPARTAGIVGAAGWGTQPVPVVDAQALAPLRKALGIVHDNLVQAEAGVAPPPEQTSI FT VKQLNRELDQMVVDAERTRSESSDVAHELKGLAYQCKQMVGASFIIRKDASIIKLPT" FT CDS complement(386350..388407) FT /transl_table=11 FT /locus_tag="RBRH_00333" FT /product="Sensory transduction protein kinase (EC 2.7.3.-)" FT /function="Sensory transduction protein kinase (EC FT 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Sensory transduction protein kinase (EC 2.7.3.-)" FT /note="COG: Signal transduction histidine kinase" FT /note="Pfam: Histidine kinase-, DNA gyrase B-, and FT HSP90-like ATPase::PF02518
His Kinase A FT (phosphoacceptor) domain::PF00512
PAS FT fold::PF08447
PAS fold::PF08448
Response regulator FT receiver domain::PF00072" FT /db_xref="EnsemblGenomes-Gn:RBRH_00333" FT /db_xref="EnsemblGenomes-Tr:CBW76799" FT /db_xref="GOA:E5AUM5" FT /db_xref="InterPro:IPR000014" FT /db_xref="InterPro:IPR000700" FT /db_xref="InterPro:IPR001610" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR013655" FT /db_xref="UniProtKB/TrEMBL:E5AUM5" FT /protein_id="CBW76799.1" FT /translation="MTLASHRIDSSPGALGADGPLAACALIIDDDEGLLSLARRALARA FT GFDVVTLTSTQAARAWLDGRGQERWPDVLVVDYVLGTAETGLDFLRSLRMQGTMLPAIL FT CTGFADETRVIEALRSGVADVVPKTSDYLDYLPQAIERVLAQKRAQREIAEAELVRARE FT LHYRTLAEAIPQLVWTALPDGRIDFASKQLLSYTGMDAPSLLGHVWPDALVHPEDLERT FT VQRWSDALRDSSDYDVEHRLRAADGAWRWFKTRAAPLLDGAGRVSKWFGTSTDIDDQKL FT AAQEREHLLANERQARSEAERASRLKDEFVATLSHELRTPLNAIVGWAQLLLRDASDPA FT RVEKGLQVIHRNARLQSQMIDDLLDMSRIMAGKVRLNVQRVELVDVITDVIATVQLAAD FT AKELRVMPVLGAPAVVNGDPARLQQIIWNLLTNAIKFTPRRGRVAVTLTSGDGEARLVV FT SDTGCGIREAFLPHVFERFRQEDASTTRQFGGLGLGLSIVKELVEMHGGHITAASDGEQ FT RGATFTVTLPTVTTGADTRRGAVAPISAQPDTALPRLDGVHVLVVEDEADARELVHRVL FT EERGAQVSAVASVRDALQVLDDGTPDVVISDLGMPEEDGFAFIAQLREREAARGGMTPA FT AALSGRVRGDDRRRALMAGFQTHLAKPVDPADLLLAIASLVGRAPPAVRA" FT CDS complement(388404..390320) FT /transl_table=11 FT /locus_tag="RBRH_00332" FT /product="Sensory transduction protein kinase (EC 2.7.3.-)" FT /function="Sensory transduction protein kinase (EC FT 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Sensory transduction protein kinase (EC 2.7.3.-)" FT /note="COG: Bacteriophytochrome (light-regulated signal FT transduction histidine kinase)" FT /note="Pfam: Histidine kinase-, DNA gyrase B-, and FT HSP90-like ATPase::PF02518
CHASE3 FT domain::PF05227
HAMP domain::PF00672" FT /db_xref="EnsemblGenomes-Gn:RBRH_00332" FT /db_xref="EnsemblGenomes-Tr:CBW76800" FT /db_xref="GOA:E5AUM6" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003660" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR007891" FT /db_xref="InterPro:IPR009082" FT /db_xref="UniProtKB/TrEMBL:E5AUM6" FT /protein_id="CBW76800.1" FT /translation="MPQHGLLSFRLNDAIMAPWPIRRHAAPPRACHAAFRACVGSDIAV FT RIVSPTPERCMRLITKGLLLIAIPSLVELGLLVGVMRTQAEALEAEQWAVRSKEVLSQA FT TAVLDPVLVDAVRMRGAVIDGYGQVWTPPSQWGEIDRRINRLIELVADNPLQVERAVQI FT RQSAQAYRQWSERSQELLRHGQQAGVVARFREFKGHDIVDYFRAQVAALQQEEMRLDSV FT RTERIAEARRMQQVLLVSAVIASIITGAIAVYVFTSSVRRRLRRLADNTKQLANNAPLA FT PMLEGDDEIAELDLALHQTSRRLLEAERIESRYRSDLAHQAEELGTMNEHLRERTQENE FT MFIYSVSHDLRAPLVNLQGFSQELSLACDSVREILARSTLTDTQRRRLSRIVDDDIAEA FT LRFLQTAVMRSASIIDALLRLSRAGRVEYRPQQVDVQAVMSRVVDAMRDSIKSRGVTVK FT IHPLPSAWGDPTAVEQVFANLVSNAVNYLDPSRPGEIEIGTRPNPVGVHSLRIYYVRDN FT GYGIPASALPKLFTAFQRLHGGAVKGEGIGLALVRRVVERHGGNVWAESSEGIGSTFYL FT SLPESCSAHEALRAATLSALARVNAGPRAARSGRLRPGSGLEPGADASAQDRPSPTYST FT FPV" FT CDS complement(390397..391191) FT /transl_table=11 FT /locus_tag="RBRH_00331" FT /product="Putative competence-damage protein" FT /function="Putative competence-damage protein" FT /note="Putative competence-damage protein" FT /note="COG: Predicted nucleotide-utilizing enzyme related FT to molybdopterin-biosynthesis enzyme MoeA" FT /note="Pfam: Probable molybdopterin binding FT domain::PF00994" FT /db_xref="EnsemblGenomes-Gn:RBRH_00331" FT /db_xref="EnsemblGenomes-Tr:CBW76801" FT /db_xref="GOA:E5AUM7" FT /db_xref="InterPro:IPR001453" FT /db_xref="UniProtKB/TrEMBL:E5AUM7" FT /protein_id="CBW76801.1" FT /translation="MGFGIIIIGDEILSGRRVDKHLPKAIELLRARGLALAWAEYVGDE FT RRRITATLKRTFASDDIVFVTGGIGATPDDHTRQCAAAALGVPLELHPQARQLIAERIS FT ETAPPGRADLDAPDNLHRFNMGVFPQGASIIPNSYNKIPGFSVRHHYFMPGFPVMAWPM FT MEWVLDTHYAHLHHGTPRDERSFLVFELPESALTPLMERIERDFAGVRVFSLPSVGDAK FT RGGIYARRHIDLGVKGDPEAVAAAYGVLHEGVHALGGEIFES" FT CDS complement(391226..392077) FT /transl_table=11 FT /locus_tag="RBRH_00330" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Sterol desaturase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00330" FT /db_xref="EnsemblGenomes-Tr:CBW76802" FT /db_xref="UniProtKB/TrEMBL:E5AUM8" FT /protein_id="CBW76802.1" FT /translation="MSMNELFSSLGRALLGMLHPRMLWLTALPFLLTALGWGAVLWFGW FT EGWVSAAHGWLSHWGWTASLNSLFAGIGFGHVQMVLAPLVVVAIAVPLIVLTVLLMIAA FT ISMPAVIRHLGARQFADLEPRRGGTLLGSLLHSIVATCICVVLLVVTVPLWLVPPLFAV FT IPPLLWGWLTYRVMTYDALAWHASLDERRMIFRMHRMPLLAIGVMCGMLGAVPTLLWAS FT SVLMIVLFPFVAIVSIWLYVYIFVFSALWFAHYCLRALRQLRARHHGADRQAPQARPPG FT SA" FT CDS complement(392257..396414) FT /transl_table=11 FT /locus_tag="RBRH_00329" FT /product="ATP-dependent helicase hrpA" FT /function="ATP-dependent helicase hrpA" FT /note="ATP-dependent helicase hrpA" FT /note="COG: HrpA-like helicases" FT /note="Pfam: Domain of unknown function FT (DUF1605)::PF07717
Helicase associated domain FT (HA2)::PF04408
Helicase conserved C-terminal FT domain::PF00271" FT /db_xref="EnsemblGenomes-Gn:RBRH_00329" FT /db_xref="EnsemblGenomes-Tr:CBW76803" FT /db_xref="GOA:E5AUM9" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR007502" FT /db_xref="InterPro:IPR010222" FT /db_xref="InterPro:IPR011709" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR024590" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUM9" FT /protein_id="CBW76803.1" FT /translation="MSNVAKNRAADASPADRADPARHRTPPAARRAEARRASSAPNPVP FT SVTFPPALPVSGRRDEIAAAIAHHQVVIVSGETGSGKTTQLPKICLALGRGLGAGGTGL FT IGHTQPRRIAASATARRIAEELGTPFGDVVGYKVRFTDNLSPGASVKLMTDGILLAETQ FT TDPLLRAYDTIIIDEAHERSLNIDFLLGYLKQILPRRADLKLIVTSATIDAQRFARHFG FT SDEQPAPVIEVSGRLYPVEIRYRPVVGDDGRATLARRGAAPGAGPIGSLGSPPGAVGSV FT TAARQAERDLHDAIVDAVDELCREGPGDVLVFLPGEREIRDAAEALRKHHPPHTEILPL FT FARLSAAEQERVFRPGNARRIVLATNVAETSLTVPGIRYVVDTGLARVKRYSYRNKVEQ FT LQIEPASQAAANQRAGRCGRVADGVCIRLYDERDFQARPRFTDPEILRASLASVILRMK FT SLHLGEIDAFPFVEPPPGRAIADGYQLLAELGAVDDDNALTPVGRELARLPLDPRVARM FT IVAAREQHALREMLIIASALSVQDPRERPLDAQEQADQAHRRFADERSEFITWLKIWAW FT FEQAVAHKKSNRQLAEACRAQFLSHLRLREWRDVHSQLLTVVREHGWRLNESEATFEQI FT HQALLAGLLGNIGLKADDDPHYLGARGIRFFIWPGSTLAKKAGRWVMAAELVETTRLYA FT RTVARIEPEWIERVGGHLIKRSVAEPHWEKKAAQVVAFERGTLYGLPVYQRRRIAFGAQ FT NPARARELFIRSALVDGEFDTRLPFFAHNRRLVAQIEQLEHKSRRQDVLVDDELIYAYY FT DAAVPAQIHTGAAFERWYRDEARRRGDDGDKLLFLSREDLMRHEAAGVTTDLFPKRLAM FT AGVDMALSYHFEPGAARDGVTLTVPLYALNQVDARRTEWLVPGMLKDKVQSLLKSLPQK FT LRRHCVPLPEYAAGFVERAHFAGQSLIDALIADLREHKQAMVKSTDFKIETLPAHLFMN FT FKVVDEHGRQLAMARNLAQLRGELGAQAQQQFQRIVWAAAGAAGTNGRPPSGHARAAAI FT SAGLPSRTPGEAPASRAARVADQPLSGAARNGLANAGGPGHAEAPDTARPAGTALYENL FT TTWNFGTLPELLEIQRGGQTLFGYPALVDRGGHCDVEVFDSPVQAEHIHRAGLRRLFAL FT QLREPIRYLEKNLPGLREMSMQYMALGTQEELRDQLIEAALDRACLQPPLPHDDASFAA FT RRDEGRARLSLLAQELARLTGQILAEYAALVKKLVQAKGFGAAHADMQQQLAALMTRRF FT VMDTPYAQLAHFPRYLKGMLLRIDKLKVDPARDQRLMAEFVPLMQPYQRALSQRGGAVD FT ARLVEFRWLLEELRISLFAQELRTPMPVSAKRLRKVWESMQR" FT CDS 396290..397846 FT /transl_table=11 FT /locus_tag="RBRH_00328" FT /product="Amino-acid acetyltransferase (EC 2.3.1.1)" FT /function="Amino-acid acetyltransferase (EC 2.3.1.1)" FT /EC_number="2.3.1.1" FT /note="Amino-acid acetyltransferase (EC 2.3.1.1)" FT /note="COG: Acetylglutamate kinase" FT /note="Pfam: Amino acid kinase FT family::PF00696
Acetyltransferase (GNAT) FT family::PF00583" FT /db_xref="EnsemblGenomes-Gn:RBRH_00328" FT /db_xref="EnsemblGenomes-Tr:CBW76804" FT /db_xref="GOA:E5AUN0" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR001048" FT /db_xref="InterPro:IPR010167" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUN0" FT /protein_id="CBW76804.1" FT /translation="MGAEDARRASARRAAGGVRWRAGSARSAGEASAARFLATLDMGAH FT YNPAMTAQNDLARRDTRASDLAMAGSQTSAAIGYTANHAQFVEWLRSVAPYIHAFRNRM FT FVVAFGGELVQAGALNALVQDVALLHAMGIQIVLVHGSRPQVEEQLNLHQVESLFAGGM FT RITDARALEAAKEASGEVRLDIEAAISQGLPNTPMAHAHISVVSGNFVTARPVGILEGV FT DFQHTGVVRKIDAESIRHSLESNKIVLLSPLGFSPTGEAFNLSMEDVASSAAIALRADK FT LIFITETPGVIDGDGELTRELSLDDAQRIYEAHTGELDRADADFYLKHAIRACRGGVPR FT SHIIPYALDGSILLELFLHDGVGTMISYENLESLREAVPDDVGSILQLIEPLETDGTLV FT RRGRHQIERDIDQFSVIEHDGVLFGCAALYPYPQERIGEMACLTVAPEAQGTGDGERLL FT KRIEQRARARGLTRIFVLTTRTEHWFLKRGFVKATVNDLPEDRRRLYNWQRKSLVLIKQ FT L" FT CDS 397909..398184 FT /transl_table=11 FT /locus_tag="RBRH_00327" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Fe-S cluster protector protein" FT /note="Pfam: Bacterial Fe(2+) trafficking::PF04362" FT /db_xref="EnsemblGenomes-Gn:RBRH_00327" FT /db_xref="EnsemblGenomes-Tr:CBW76805" FT /db_xref="GOA:E5AUN1" FT /db_xref="InterPro:IPR007457" FT /db_xref="UniProtKB/TrEMBL:E5AUN1" FT /protein_id="CBW76805.1" FT /translation="MARMVHCAKLGKEAEGLDFPPLPGELGKRIFESISKEAWQAWLKQ FT QTMLINENRLNMADPRARQYLLKQTEKFFFGEGADVASGYVPPANG" FT CDS complement(398367..399788) FT /transl_table=11 FT /locus_tag="RBRH_00326" FT /db_xref="EnsemblGenomes-Gn:RBRH_00326" FT /db_xref="EnsemblGenomes-Tr:CBW76806" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUN2" FT /protein_id="CBW76806.1" FT /translation="MAAELTFYRLLSLPMDFDLNAALNYPASYVCAGQTGQLPAASAPP FT RPPSDNPLTRPLPTQPTTYDDLPSELIARIGDYVPIQDVMLFATVDRRTYHAMQTRRLV FT HRYWQQANQAVSLASVNQLLDEIGGALSNPAQHAEPIDALSQRLRALPKAERVEAFKRV FT FAAAERIPQDGVRIQKALLRAFFIFPPSRRDELFDFAYAMAERRAPGQDNIWAELADSL FT RFFSFDSPFVEQRYQALLDRLASLRISEQAKLIPVLSNLLLYFNKTDPRVPERYALLRG FT HALQLPPSHQGASVGILASCVQILSKAEQFAQYTQMRDWALSLPDEQWGIALQYLLEGL FT KELSDEQRAQELTLLEGHLARVPMSQRVSAAFGLLKCQLFLDDVQIKRVWRQGLNLLNG FT AGEAALWDLLSQLRADWVLSEFSNFRWEMAVEEITRFMEASQFSEPARARFQANVDWLR FT SEPIIFSETEPSMLR" FT CDS complement(399936..401321) FT /transl_table=11 FT /locus_tag="RBRH_00325" FT /product="DNA repair protein RadA" FT /function="DNA repair protein RadA" FT /note="DNA repair protein RadA" FT /note="COG: Predicted ATP-dependent serine protease" FT /db_xref="EnsemblGenomes-Gn:RBRH_00325" FT /db_xref="EnsemblGenomes-Tr:CBW76807" FT /db_xref="GOA:E5AUN3" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004504" FT /db_xref="InterPro:IPR014721" FT /db_xref="InterPro:IPR020568" FT /db_xref="InterPro:IPR020588" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUN3" FT /protein_id="CBW76807.1" FT /translation="MTKTKTVYVCNDCGAQSPKWQGQCPSCHHWNTLVESVESTAAPNR FT RYQALAKSQPVRKLAEIEASDVPRYSTGIGEFDRVLGGGLVAGGVVLIGGDPGIGKSTL FT LLQALAEIARERRALYISGEESGAQIALRAQRLGLLDAHASRAGELQLLAEIQLEKLQA FT TIDAVKPNIAVIDSIQTIYSDALSSAPGSVAQVRECAAQLTRIAKQSGVTIIMVGHVTK FT EGALAGPRVLEHIVDTVLYFEGDTHSSFRLVRAFKNRFGAVNELGVFAMTERGLRGVAN FT PSALFLSQHEHTVPGSCVLVTQEGSRPLLVEVQALVDTAQVPNPRRLAVGLEQNRLAML FT LAVLHRHAGVACFDQDVFLNAVGGVKIAEPAADLAVLLAIHSSMRNKPLPKGLIVFGEV FT GLAGEIRPCPRGQERLKEAAKLGFSSALIPKANAPKQPIDGLQVIAVERIEQAIDRVRT FT LQQ" FT CDS complement(401337..402407) FT /transl_table=11 FT /locus_tag="RBRH_00324" FT /product="Alanine racemase (EC 5.1.1.1)" FT /function="Alanine racemase (EC 5.1.1.1)" FT /EC_number="5.1.1.1" FT /note="Alanine racemase (EC 5.1.1.1)" FT /note="COG: Alanine racemase" FT /note="Pfam: Alanine racemase, C-terminal FT domain::PF00842
Alanine racemase, N-terminal FT domain::PF01168" FT /db_xref="EnsemblGenomes-Gn:RBRH_00324" FT /db_xref="EnsemblGenomes-Tr:CBW76808" FT /db_xref="GOA:E5AUN4" FT /db_xref="InterPro:IPR000821" FT /db_xref="InterPro:IPR001608" FT /db_xref="InterPro:IPR009006" FT /db_xref="InterPro:IPR011079" FT /db_xref="InterPro:IPR020622" FT /db_xref="UniProtKB/TrEMBL:E5AUN4" FT /protein_id="CBW76808.1" FT /translation="MPRPLLATIHTAALANNLAVARRHASKSKLWAVVKANAYGHGLAR FT VFPGLRSTDGFGLLDLEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTTVHCDE FT QLRMLEMARLSKPVNIQLKMNSGMNRLGYVAGKYRAAWERARACPSVGQITLMTHFSDA FT DGEMGIRHQLEVFEHGAEGIAGSRSLANSAATLWHPYAHFDWVRPGIILYGASPSGVSA FT AIEGLGLQPAMTLSSELIAVQTVEPGDSVGYGSAFKARERMRIGVVACGYADGYPRCAP FT EGTPVQVGGVRTRVVGRVSMDMLTVDLSSCPNAVIGSPVQLWGADVPIDDVAAACGTVG FT YELMCAVAQRVSVRAE" FT CDS complement(402515..402709) FT /transl_table=11 FT /locus_tag="RBRH_04259" FT /db_xref="EnsemblGenomes-Gn:RBRH_04259" FT /db_xref="EnsemblGenomes-Tr:CBW76809" FT /db_xref="UniProtKB/TrEMBL:E5AUN5" FT /protein_id="CBW76809.1" FT /translation="MKVFQEGYGSDQKRTVGERRKELRRHDGVKTFLHLMLSLIPLSAA FT AVGLTRSMSRSKWVVCTAL" FT CDS 402608..403912 FT /transl_table=11 FT /locus_tag="RBRH_00323" FT /product="Lysophospholipid transporter family protein" FT /function="Lysophospholipid transporter family protein" FT /note="Lysophospholipid transporter family protein" FT /note="COG: Permeases of the major facilitator superfamily" FT /db_xref="EnsemblGenomes-Gn:RBRH_00323" FT /db_xref="EnsemblGenomes-Tr:CBW76810" FT /db_xref="GOA:E5AUN6" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="UniProtKB/TrEMBL:E5AUN6" FT /protein_id="CBW76810.1" FT /translation="MKKGFYTIMAAQFFSSLADSALLIAAIALLKDLHAPNWMTPLLKL FT FFVLSYVVLAAFVGAFADSQPKGRVMFVTNTIKMVGCVTMLTDAHPLLAYGIVGFGAAA FT YSPAKYGILTELLPPERLVVANGWIEGTTVASIILGTVMGGALISPHIAQPLLRHLSFA FT HTAAESAIVVIMSVYALAAVFNLWIPDTGARYPKQQHRPIRLIRDFAECFGALWRDKLG FT QISLAVTTLFWGAGATLQFIVLKWAEVSLGMTLSESAVLQAVVAVGVAGGAMLAATRVP FT LKRSLTVLPVGIVMGLLVMTMSLYTRELFPSDWAWHIGHIRVPAYLICAYAFLIVVGGL FT SGFFVVPMNALLQHRGHVLLSAGHSIAVQNFNENLSVLVMLCLYAVLVWFNVPIQLVIV FT LFGTFVCLTMWCVMRRHAANQRAFDSVALIGEQRH" FT CDS 403956..404786 FT /transl_table=11 FT /locus_tag="RBRH_00322" FT /product="Phosphomethylpyrimidine kinase (EC 2.7.4.7) / FT Hydroxymethylpyrimidine kinase (EC 2.7.1.49)" FT /function="Phosphomethylpyrimidine kinase (EC 2.7.4.7) / FT Hydroxymethylpyrimidine kinase (EC 2.7.1.49)" FT /EC_number="2.7.4.7" FT /note="Phosphomethylpyrimidine kinase (EC 2.7.4.7) / FT Hydroxymethylpyrimidine kinase (EC 2.7.1.49)" FT /note="COG: Hydroxymethylpyrimidine/phosphomethylpyrimidine FT kinase" FT /note="Pfam: Phosphomethylpyrimidine kinase::PF08543" FT /db_xref="EnsemblGenomes-Gn:RBRH_00322" FT /db_xref="EnsemblGenomes-Tr:CBW76811" FT /db_xref="GOA:E5AUN7" FT /db_xref="InterPro:IPR004399" FT /db_xref="InterPro:IPR013749" FT /db_xref="UniProtKB/TrEMBL:E5AUN7" FT /protein_id="CBW76811.1" FT /translation="MVFRALFAMEHKIPNVLTIAGSDPSGGAGIQADLKTFSALGAYGA FT AAITALTVQNTRGVTAVHPVSADVVAAQLDAVLSDLRIDAVKIGMLANAAIVRAVATAL FT ERYRPAHVVLDTVMLSSSGCPLLEPDALGALRERLLPLASIITPNLHEAAALLDQPVAT FT DEAQMARQGDALHALGARAVLIKGGHLPGEFSPDWLIEANHHTRLAGARVNVTGTHGTG FT CTLSAAIAALRPQRLDLANAVSDAKTYLTQALIQSTRLSVGQGTGPLHHCHAWW" FT CDS complement(404941..406140) FT /transl_table=11 FT /locus_tag="RBRH_00321" FT /product="Hypothetical membrane spanning protein" FT /function="Hypothetical membrane spanning protein" FT /note="Hypothetical membrane spanning protein" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: Domain of unknown function (DUF1853)::PF08907" FT /db_xref="EnsemblGenomes-Gn:RBRH_00321" FT /db_xref="EnsemblGenomes-Tr:CBW76812" FT /db_xref="InterPro:IPR015003" FT /db_xref="UniProtKB/TrEMBL:E5AUN8" FT /protein_id="CBW76812.1" FT /translation="MERPMSGSRDSSQAHRCALSRHDRDAGAAADEGGGTRQPEGSAAF FT AAAARAHADHRMPAHASRPCVDLLHAYRDVAVRDLAWLLLSPSLLDARYFGPRLAHMLA FT QSQQRQQTLAWLTRLDADPRALHVALDARPQSRLGLYAEQLLGFFLQHGPATRLIAANR FT PVRVDGHTLGECDFLFEDDGARAWHWELTVKCYLDAGGPPGSLARYVGPNLADRFDRKL FT TRLLTHQLTLSQHPQIAALAADGHWQAAMIVRGWLFRRWDLSDVSDSDHVSVNHTPRGN FT VAPGPIAPDHLRGWWACAAQWPVFDAPAWTIVPRLGWMAPLRLSADDPRVYRDSTAVLV FT RCIDYWRDRPDQPLMVAALDNVRVSQGVGNPADELCELARGFIVPDDWPKRAAAYTTIS FT " FT CDS complement(406083..407237) FT /transl_table=11 FT /locus_tag="RBRH_00320" FT /product="Uracil DNA glycosylase superfamily protein" FT /function="Uracil DNA glycosylase superfamily protein" FT /note="Uracil DNA glycosylase superfamily protein" FT /note="COG: Uracil-DNA glycosylase" FT /note="Pfam: Uracil DNA glycosylase superfamily::PF03167" FT /db_xref="EnsemblGenomes-Gn:RBRH_00320" FT /db_xref="EnsemblGenomes-Tr:CBW76813" FT /db_xref="InterPro:IPR005122" FT /db_xref="InterPro:IPR005273" FT /db_xref="UniProtKB/TrEMBL:E5AUN9" FT /protein_id="CBW76813.1" FT /translation="MTQLDAILEELGIAPLWVRRGAGHAHRLGDAEGDGLSPARDVMRE FT AGIVLPSQALQATQVTVQACDAQERAAHASAQASHTPVEAARSRVEATEAQGAATGPAG FT DGVKAAEGVKALEGVKVVEGVKAAERVEAPEGDGAVVEVPNARRALAAPVSPAETVPTG FT LGDARSLQAEPMGGQGEAAAPALGVAADAQPVPMLDWEALKARVAGCTLCRLCERRTNT FT VFGVGDETADWMLVGEAPGENEDKQGEPFVGQAGKLLDNMLRALQMRRGDNVYIANVLK FT CRPPGNRNPQPDEVMRCEPYLKRQVALVKPNVIVALGRFAAQSLLKTDASIASLRGRVH FT EYEGVPVIVTYHPAYLLRSLHDKHKAWSDLCLARAIHRKRTVAH" FT CDS complement(407224..407874) FT /transl_table=11 FT /locus_tag="RBRH_00319" FT /product="Ribosomal-protein-S18-alanine acetyltransferase FT (EC 2.3.1.128)" FT /function="Ribosomal-protein-S18-alanine acetyltransferase FT (EC 2.3.1.128)" FT /EC_number="2.3.1.128" FT /note="Ribosomal-protein-S18-alanine acetyltransferase (EC FT 2.3.1.128)" FT /note="COG: Acetyltransferases" FT /note="Pfam: Acetyltransferase (GNAT) family::PF00583" FT /db_xref="EnsemblGenomes-Gn:RBRH_00319" FT /db_xref="EnsemblGenomes-Tr:CBW76814" FT /db_xref="GOA:E5AUP0" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR006464" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUP0" FT /protein_id="CBW76814.1" FT /translation="MSGVLMTERYLTPMTESDLDEVAAVERDAYEFPWTRGNFEDSLRN FT GYFGVCLRHVTGVLVGYCILMPVVDEMHLLNLCVAPAAQGHGAGLALLREAVRITRARQ FT LGSVLLEVRPSNQRAMRLYERFGFIVIGRRNNYYPARHRTREDAIVMRYGLHAEVSVAP FT AAAARHADAQGRHAPQQAASPQGAPSSHEQPMPGARRVGAPLEAEREQADDAA" FT CDS complement(407871..409043) FT /transl_table=11 FT /locus_tag="RBRH_00318" FT /product="Glycoprotease family protein" FT /function="Glycoprotease family protein" FT /note="Glycoprotease family protein" FT /note="COG: Inactive homolog of metal-dependent proteases, FT putative molecular chaperone" FT /note="Pfam: Glycoprotease family::PF00814" FT /db_xref="EnsemblGenomes-Gn:RBRH_00318" FT /db_xref="EnsemblGenomes-Tr:CBW76815" FT /db_xref="GOA:E5AUP1" FT /db_xref="InterPro:IPR000905" FT /db_xref="InterPro:IPR022496" FT /db_xref="UniProtKB/TrEMBL:E5AUP1" FT /protein_id="CBW76815.1" FT /translation="MPAGAGARHHDAVPFFNDSTNSAYWCLAVSCDVPFSAAQASYLYL FT PTISAKPGLSPCTSPLVACLNSAYKRSNVRLLGRSDNCLTSPCACANRASISRIVTSSI FT LSIHPELLSVVGTCRYALEQVLQTAELMWAGITIAVMTPHALLALDTSTEFCSVAVFHL FT PHAAGSPRVVSRHEHTGPASSARVLPAVREVLEEATLTLADCAAVAFGAGPGSFTGLRT FT AAGVAQGLAFGLGVPVVPVGTLLACAERARASDPDARRVLVALDARMGEVYWADFAWDD FT TLADWRVCHPAALAVPARVPVPDEPFTLAGNASSVFGDALCAATQARVIDPGAMPHAHA FT LALAGWRAFMAGRALPAHLAMPEYVRDKVAQTTDERAAARALKDPAKEAR" FT CDS 409299..411191 FT /transl_table=11 FT /locus_tag="RBRH_00317" FT /product="ATP-dependent RNA helicase" FT /function="ATP-dependent RNA helicase" FT /note="ATP-dependent RNA helicase" FT /note="COG: Superfamily II DNA and RNA helicases" FT /note="Pfam: DEAD/DEAH box helicase::PF00270
Helicase FT conserved C-terminal domain::PF00271" FT /db_xref="EnsemblGenomes-Gn:RBRH_00317" FT /db_xref="EnsemblGenomes-Tr:CBW76816" FT /db_xref="GOA:E5AUP2" FT /db_xref="InterPro:IPR000629" FT /db_xref="InterPro:IPR001650" FT /db_xref="InterPro:IPR011545" FT /db_xref="InterPro:IPR014001" FT /db_xref="InterPro:IPR014014" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUP2" FT /protein_id="CBW76816.1" FT /translation="MPVFRSDEQISFIASDDRGCRLAPLAFFRTGSRRRRETHRIVMTS FT NSPSSLGALARELFGNDAPVSHGDAPAVPTPAAEAAPATTVHAVAATPAPDAMATSIAA FT QPGSTASAAVDAAQPADTANSDTPHGDGFIALGLSPEIVSALTAAGYQAPTPVQQRAIP FT AALAGRDLLVSSPTGSGKTAAFMLPAIERFAQMQKAGTLGQRANQPVHQAQRGDRGERR FT HRREQPVARPALLVLTPTRELAMQVTTAATTYGKHLRRLRTVSILGGVAYGQQLMLLAK FT NPEILVATPGRLIDHLERGRIDLSQLQMLVLDEADRMLDMGFIEDIEAIIDRTPATRQT FT LLFSATLDGKVGSLAQRFLSDAERIEIRREPESRANIAQSVHYVDDRAHKDRLLTHLLA FT DGALDQAIVFTATKNDADVIAARLAEDGFASAALHGDLPQGARNRTIRALRERRVRVLV FT ATDVAARGIDIPGITHVFNYDLPKFAEDYVHRIGRTGRAGRSGIAVSLVHHAEVGTLKR FT IERFVRTPLPVNVIAGFEPKRAPSTRAPARRGAPPRGNGRGAGGYQGRGTGNGYGNARH FT GAGSSREGGGRDAGYRGGFSDARASNDRGRGGFADSRGPARRRDDDRRTSRYDD" FT CDS 411596..412903 FT /transl_table=11 FT /locus_tag="RBRH_00316" FT /product="Isocitrate lyase (EC 4.1.3.1)" FT /function="Isocitrate lyase (EC 4.1.3.1)" FT /EC_number="4.1.3.1" FT /note="Isocitrate lyase (EC 4.1.3.1)" FT /note="COG: Isocitrate lyase" FT /note="Pfam: Isocitrate lyase family::PF00463" FT /db_xref="EnsemblGenomes-Gn:RBRH_00316" FT /db_xref="EnsemblGenomes-Tr:CBW76817" FT /db_xref="GOA:E5AUP3" FT /db_xref="InterPro:IPR006254" FT /db_xref="InterPro:IPR015813" FT /db_xref="InterPro:IPR018523" FT /db_xref="UniProtKB/TrEMBL:E5AUP3" FT /protein_id="CBW76817.1" FT /translation="MSRQQEAQKLQVQWETNPRWKGIKRGYTAEDVIRLRGSVPVEHTL FT ARRGAEKLWMLINEEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYP FT DQSLYPANSVPLVVKRINNTLARADQIQWSEGKNPGDESYIDFFAPIVADAEAGFGGVL FT NAFELMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVSTREAVAKLISARLAADVSGT FT PTVLVARTDAEAADLITSDIDDNDKLFLTGERTVEGFFRTRPGLEQAISRGLAYAPYAD FT LIWCETGKPDLEYAKKFAEAIHKAFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAM FT GYKFQFITLAGFHSLNYSMFNLAYGYARNQMSAFVELQQAEFAAAEKGFTAVKHQREVG FT TGYFDAVTQTIEREASTTALHGSTEDEQFFDNKKVA" FT CDS complement(412981..413334) FT /transl_table=11 FT /locus_tag="RBRH_00315" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /db_xref="EnsemblGenomes-Gn:RBRH_00315" FT /db_xref="EnsemblGenomes-Tr:CBW76818" FT /db_xref="InterPro:IPR005119" FT /db_xref="UniProtKB/TrEMBL:E5AUP5" FT /protein_id="CBW76818.1" FT /translation="MNVIMSLHAGSGIGRLDAESLGRSARAVENAEASVSAGSVKASGH FT LRVSAPAGFGRKHIAPLIPAFSAAHPGVTVSLDLTDRLVERRIHCTHFVPCARRSGRKK FT APATQGCGARSPA" FT CDS 413398..414993 FT /transl_table=11 FT /locus_tag="RBRH_00314" FT /product="Malate synthase (EC 2.3.3.9)" FT /function="Malate synthase (EC 2.3.3.9)" FT /EC_number="2.3.3.9" FT /note="Malate synthase (EC 2.3.3.9)" FT /note="COG: Malate synthase" FT /note="Pfam: Malate synthase::PF01274" FT /db_xref="EnsemblGenomes-Gn:RBRH_00314" FT /db_xref="EnsemblGenomes-Tr:CBW76819" FT /db_xref="GOA:E5AUP4" FT /db_xref="InterPro:IPR001465" FT /db_xref="InterPro:IPR006252" FT /db_xref="InterPro:IPR011076" FT /db_xref="InterPro:IPR019830" FT /db_xref="UniProtKB/TrEMBL:E5AUP4" FT /protein_id="CBW76819.1" FT /translation="MAHPTPSLPEGVQIHAPLKPGFEAILTHDALALVAQLHRQFEARR FT QTLLAARVERAKRLDAGERPDFLPQTQAIREGSWTVAPLPADLQCRRVEITGPVERKMV FT INALNSGADSYMTDFEDSNAPNWDNQIQGQINLKDAVRRTISLEQNGKSYRLNDKIATL FT LVRPRGWHLDEKHVTVDGQRVSGALFDFALFLFHNAKEQLSRDTGPYFYLSKMESHLEA FT RLWNDVFVAAQQAIGIPRGTIRATVLVETILAAFEMDEILYELREHSAGLNAGRWDYIF FT SAIKKFKTDNDFCLADRAQVTMTAPFMRAYALLLVKTCHRRNAPAIGGMSALIPIKNDP FT ATNDKALAGVRSDKARDAGDGYDGGWVAHPGLVPIAMEEFVKVLGDKANQISKQRDDVQ FT VTAKDLLDFRPQAPITEAGLRNNINVGIHYLGSWLAGNGCVPIHNLMKDAATAEISRSQ FT VWQWIRSPKGKLDDGRKVSAELVRALGVEELAKVKAVVGGDTAPYDRAAQIFEQMSTSD FT TFIDFLTLPLYEAI" FT CDS complement(415354..416004) FT /transl_table=11 FT /locus_tag="RBRH_00313" FT /db_xref="EnsemblGenomes-Gn:RBRH_00313" FT /db_xref="EnsemblGenomes-Tr:CBW76820" FT /db_xref="UniProtKB/TrEMBL:E5AUP6" FT /protein_id="CBW76820.1" FT /translation="MLPIVLALAQFAPQIAHWIGGSRAEQVAQKVVDIAQTVTGTSTPE FT QALAAIQANPDLAYRFQESIVESQIDLQRIAADVEKTRITADVETAKTNAADRANARQM FT ALTEHDHTPRNLAYLYTVGLFLVIGAHFWLLFARIPVNPIAFGVLGNIEGVLIAMVLGA FT KEFFFGSSSTATKQAAVITSFATDPDTHVTTQTMNGAPTSAQATLPTTANEKS" FT CDS complement(416007..416351) FT /transl_table=11 FT /locus_tag="RBRH_00312" FT /product="SECRETION ACTIVATOR PROTEIN" FT /function="SECRETION ACTIVATOR PROTEIN" FT /note="SECRETION ACTIVATOR PROTEIN" FT /note="COG: Putative secretion activating protein" FT /note="Pfam: Predicted Peptidoglycan domain::PF09374" FT /db_xref="EnsemblGenomes-Gn:RBRH_00312" FT /db_xref="EnsemblGenomes-Tr:CBW76821" FT /db_xref="InterPro:IPR008565" FT /db_xref="InterPro:IPR018537" FT /db_xref="InterPro:IPR023346" FT /db_xref="UniProtKB/TrEMBL:E5AUP7" FT /protein_id="CBW76821.1" FT /translation="MRELPRETAKQIAKALYWDPLHCDRYDARVAFQIFDANYNGGHVV FT IWMQQASGAFADGKLGPKTIAAVQAVDPELFIMRFIAARLTYLTALQTWPSFGRGWARR FT IATNLRVAGA" FT CDS complement(416909..417052) FT /transl_table=11 FT /locus_tag="RBRH_00311" FT /db_xref="EnsemblGenomes-Gn:RBRH_00311" FT /db_xref="EnsemblGenomes-Tr:CBW76822" FT /db_xref="UniProtKB/TrEMBL:E5AUP8" FT /protein_id="CBW76822.1" FT /translation="MRYAPVKLVMHRRCELFKVLEVVNLLEAVNCALHLDDVSGYANSV FT MT" FT CDS complement(418100..419185) FT /transl_table=11 FT /locus_tag="RBRH_00310" FT /product="Rieske [2Fe-2S] domain protein" FT /function="Rieske [2Fe-2S] domain protein" FT /note="Rieske [2Fe-2S] domain protein" FT /note="COG: Phenylpropionate dioxygenase and related FT ring-hydroxylating dioxygenases, large terminal subunit" FT /note="Pfam: Rieske [2Fe-2S] domain::PF00355" FT /db_xref="EnsemblGenomes-Gn:RBRH_00310" FT /db_xref="EnsemblGenomes-Tr:CBW76823" FT /db_xref="GOA:E5AUP9" FT /db_xref="InterPro:IPR017941" FT /db_xref="UniProtKB/TrEMBL:E5AUP9" FT /protein_id="CBW76823.1" FT /translation="MHALPLPDTGAIDLPASASVRDLRRVPIHPDHWYPLAWSHEVKRS FT KALGVQFAGDPIVLARTASGKPHRQVPLHAGVVEGESIRCGYHGWAYDCGGHCIDVPYF FT GRERLPNGVRAYPCREVHGLIFVFPGEPALADVRPLPMLSSVGDSAYKTRRFGREVKCH FT YSFMHENLMDMNHQFLHRRQMGQMRARCVGRSHGEDWAEVNYTFARMAGSQPMGEALVF FT GASKNAGGQADKSVMAVRTCYPYQTLQIRSGDGTLVMDLWIVYVPLDAAQRTNRTFGLL FT SIRKPKIPFALDLAWPLLIWFTERIFKEDRWVVEQEQEAHDRQGADWNHEVFPVINELR FT DLLRHCGGHTEIPIREVGNRA" FT CDS complement(419266..419412) FT /transl_table=11 FT /locus_tag="RBRH_00309" FT /db_xref="EnsemblGenomes-Gn:RBRH_00309" FT /db_xref="EnsemblGenomes-Tr:CBW76824" FT /db_xref="UniProtKB/TrEMBL:E5AUQ0" FT /protein_id="CBW76824.1" FT /translation="MQACRWTMCNVRPASLHGLAATLLREQHALRDDAATKERQGAVSA FT GLA" FT CDS complement(419504..419800) FT /transl_table=11 FT /locus_tag="RBRH_00308" FT /db_xref="EnsemblGenomes-Gn:RBRH_00308" FT /db_xref="EnsemblGenomes-Tr:CBW76825" FT /db_xref="UniProtKB/TrEMBL:E5AUQ1" FT /protein_id="CBW76825.1" FT /translation="MRVKRKVVKAGERPSCRTFLRAAMALSSHGTEAASRVVTIRCNAS FT STPWSVAALGASPIICMTKVRLACRAGSGMSRMPSRIFSVRLACQRLCGRRGS" FT CDS 419822..420877 FT /transl_table=11 FT /locus_tag="RBRH_00307" FT /product="Albicidin resistance protein" FT /function="Albicidin resistance protein" FT /note="Albicidin resistance protein" FT /note="COG: Predicted transcriptional regulators" FT /note="Pfam: Albicidin resistance domain::PF05583
MerR FT family regulatory protein::PF00376
MerR, DNA FT binding::PF09278" FT /db_xref="EnsemblGenomes-Gn:RBRH_00307" FT /db_xref="EnsemblGenomes-Tr:CBW76826" FT /db_xref="GOA:E5AUQ2" FT /db_xref="InterPro:IPR000551" FT /db_xref="InterPro:IPR009061" FT /db_xref="InterPro:IPR012925" FT /db_xref="UniProtKB/TrEMBL:E5AUQ2" FT /protein_id="CBW76826.1" FT /translation="MKRWKRRQRQMRLTVGELAKRSGLTVRTLHHYDAIGLLKPSARSE FT AGYRLYSRDDVARLYQIHALRRFGMSLADIGACLDRPDHSLVTIVQRQIGTLDAQLTQA FT RLLREQLARLHEQLLVGTDPDQSDWLITLEMITVYEKYFSDDELNRLPLYRLDEARENE FT WREVVAQARVLITQGVPPQSDDARALAKRWMAMVQRDTGGDPRLLAKLNRMYEAEPTMQ FT SKTGISPDLLQYVLQASWETKMALYEKYLLPDEVRYMRAHYSKRAHEWPELIGALRTQI FT EQGAEPSAPAVRRLAQRWLELFRSYAGDDPATQARFRLAHEQEPELLEDAWADAPMLDF FT LKRAVAAASPA" FT CDS complement(420954..421478) FT /transl_table=11 FT /locus_tag="RBRH_00306" FT /product="Methylisocitrate lyase (EC 4.1.3.30)" FT /function="Methylisocitrate lyase (EC 4.1.3.30)" FT /EC_number="4.1.3.30" FT /note="Methylisocitrate lyase (EC 4.1.3.30)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00306" FT /db_xref="EnsemblGenomes-Tr:CBW76827" FT /db_xref="GOA:E5AUQ3" FT /db_xref="InterPro:IPR015813" FT /db_xref="UniProtKB/TrEMBL:E5AUQ3" FT /protein_id="CBW76827.1" FT /translation="MYAGVLRDTHYDGAAIGARLIREGGGSKANIEPPARDVQWSLIDV FT AGPRRAIGSMCAGLRHPFADRDEMSRTAAFRQLHQSGCVVLPNASAVGSIRYLQLLGFG FT AIATTSSDFAWSRARMGDIVCRGVVLGHLREIVAVTDLLVNRGLQRRRDCTAVSAGCRR FT ATLAGGMARDR" FT CDS complement(421895..422080) FT /transl_table=11 FT /locus_tag="RBRH_00305" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00305" FT /db_xref="EnsemblGenomes-Tr:CBW76828" FT /db_xref="UniProtKB/TrEMBL:E5AUQ4" FT /protein_id="CBW76828.1" FT /translation="MLLLGSELPLPDDAQVLEEARFVAVTDRILALLAACHDFPKSTTG FT AVNAVVRYSKLDGGVS" FT CDS complement(422406..422924) FT /transl_table=11 FT /locus_tag="RBRH_00304" FT /db_xref="EnsemblGenomes-Gn:RBRH_00304" FT /db_xref="EnsemblGenomes-Tr:CBW76829" FT /db_xref="UniProtKB/TrEMBL:E5AUQ5" FT /protein_id="CBW76829.1" FT /translation="MVVFCTMITPTLYYSLVCLAIYRGRHVVGGAAAVCCVALGLAVRM FT FGSWRECASRRDGLYCVSSCPAKHACQHRRRGRRCPVVFDRSVCQDTAQCGCIDRRGDL FT RRHGFHGGKDRHVEPVDPRRLHKLNRVAHDVCFLLKLGKRSRSEDIDHRVGDEQRLRID FT RHVHHEDMT" FT CDS 423073..424080 FT /transl_table=11 FT /locus_tag="RBRH_00303" FT /product="Transporter, drug/metabolite exporter family" FT /function="Transporter, drug/metabolite exporter family" FT /note="Transporter, drug/metabolite exporter family" FT /note="COG: Permeases of the drug/metabolite transporter FT (DMT) superfamily" FT /note="Pfam: Integral membrane protein DUF6::PF00892" FT /db_xref="EnsemblGenomes-Gn:RBRH_00303" FT /db_xref="EnsemblGenomes-Tr:CBW76830" FT /db_xref="GOA:E5AUQ6" FT /db_xref="InterPro:IPR000620" FT /db_xref="UniProtKB/TrEMBL:E5AUQ6" FT /protein_id="CBW76830.1" FT /translation="MTSCPCSIRTCRCVQRAMPVTRRRLRMISRAVFDLTNLLALAALW FT STSFLFVRIGVAEFGVVPMVALRVSIGATFLIALLIVRKGVKGKWRDSQRKLWPLFVLG FT VLNAAMPFCLFAYAVPALSVGLACVINATAPLWGALVAFLWLGDRPSIMRIAGIVLCFA FT GVTLMVGSQISATGSFAGAAPCARTTALAAGAGLTATALLGIAANYTKRYLSDIDPLMI FT AAGSLVGASIVLLPLAAWAWPATPVSMRAWLAALALGVACTGVAYVLYFRLLNAGGPAQ FT AMTATFVIPVFGILWDSLFLSLSISIWMIECCAIVLVGTVLATGLIERLRPQLS" FT CDS 424237..424524 FT /transl_table=11 FT /locus_tag="RBRH_04260" FT /db_xref="EnsemblGenomes-Gn:RBRH_04260" FT /db_xref="EnsemblGenomes-Tr:CBW76831" FT /db_xref="UniProtKB/TrEMBL:E5AUQ7" FT /protein_id="CBW76831.1" FT /translation="MDNQAPLERAAKCLPIASTRWPRFVSGKLTVETNTPPRLSTNHEA FT ASAGGLAPPMLPAKRTPPASISSVRKPGKNGGVASGSALSAAERLAGLCY" FT CDS complement(424546..425502) FT /transl_table=11 FT /locus_tag="RBRH_00301" FT /product="Arylesterase (EC 3.1.1.2)" FT /function="Arylesterase (EC 3.1.1.2)" FT /EC_number="3.1.1.2" FT /note="Arylesterase (EC 3.1.1.2)" FT /note="COG: Predicted hydrolases or acyltransferases FT (alpha/beta hydrolase superfamily)" FT /note="Pfam: alpha/beta hydrolase fold::PF00561" FT /db_xref="EnsemblGenomes-Gn:RBRH_00301" FT /db_xref="EnsemblGenomes-Tr:CBW76832" FT /db_xref="GOA:E5AUQ8" FT /db_xref="InterPro:IPR000073" FT /db_xref="InterPro:IPR006311" FT /db_xref="UniProtKB/TrEMBL:E5AUQ8" FT /protein_id="CBW76832.1" FT /translation="MSHSRRTFLAGAAALAASVAYAAPRGATASVDKPGAFSDMAVPSR FT EPFVVRSADGVMLAGEAQGDSQAPEILFIHGLRQSRLSWEKQFADPALRHFRMVGFDLR FT GHGDSDKPVSLEAYSEADRWADDVAAVIAGAKLRRPVLVGWSLGGFVAGAYLRKYGGAA FT IAGVNLVDAVTNLSPDLLTAEAAAFTSTTTSHDFAVRTAATAEFLAACFHRPPTEVEMQ FT RMLVVNGMTARAVNEGFIKTQTPDFEPVFKAYSGPILLTHGLHDRLVRLAMSERIKSIH FT ANSRLSLFFESGHSPFYEEPVRYGQELAGFVTAANQG" FT CDS 425494..426192 FT /transl_table=11 FT /locus_tag="RBRH_00300" FT /product="Transcriptional regulator, TetR family" FT /function="Transcriptional regulator, TetR family" FT /note="Transcriptional regulator, TetR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory proteins, tetR FT family::PF00440" FT /db_xref="EnsemblGenomes-Gn:RBRH_00300" FT /db_xref="EnsemblGenomes-Tr:CBW76833" FT /db_xref="GOA:E5AUQ9" FT /db_xref="InterPro:IPR001647" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011075" FT /db_xref="InterPro:IPR015893" FT /db_xref="InterPro:IPR023772" FT /db_xref="UniProtKB/TrEMBL:E5AUQ9" FT /protein_id="CBW76833.1" FT /translation="MAHECRSMLFSDRYLTRLDFSCQGLFSVAMERDSKSRGGRPWSFD FT REKAVDTAMRLFWRHGYEGVSIGDLTKEIGIAPPSLYAAFGSKAQLYREAVSRYEATLG FT RLDVASINSAASLAQAVRVLLEGAVSAVTHPQLERGCLISSGMIACHPEHALLARDAAA FT RREAMRERIAQALQPFAGVHEVQRLARYLAAVMQGMSVQARDGSTPTQLQEIVEEVVAG FT VAARLSEESS" FT CDS 426189..426443 FT /transl_table=11 FT /locus_tag="RBRH_00299" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Integrase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00299" FT /db_xref="EnsemblGenomes-Tr:CBW76834" FT /db_xref="GOA:E5AUR0" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="UniProtKB/TrEMBL:E5AUR0" FT /protein_id="CBW76834.1" FT /translation="MMRRFFRQATDIIGTDHPVLAEKLRCPSPARIRHTQGTHALARDA FT ELTTMRDSLRHASIATISIDLRSDEVKRSRHTDGPFAAP" FT CDS 426447..426575 FT /transl_table=11 FT /locus_tag="RBRH_00298" FT /db_xref="EnsemblGenomes-Gn:RBRH_00298" FT /db_xref="EnsemblGenomes-Tr:CBW76835" FT /db_xref="UniProtKB/TrEMBL:E5AUR1" FT /protein_id="CBW76835.1" FT /translation="MLIPTTRCRLNVLYFSFSKAILDSERRRQPIVDWIKTRPHRQ" FT CDS 427089..428372 FT /transl_table=11 FT /locus_tag="RBRH_00297" FT /db_xref="EnsemblGenomes-Gn:RBRH_00297" FT /db_xref="EnsemblGenomes-Tr:CBW76836" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUR3" FT /protein_id="CBW76836.1" FT /translation="MPTEDVTASAYRHCTIHQEHGVHSSSLCSASRFRLACCVASLRIA FT PFFYRLPNLPMDFDLHAALNDYPAYVCALESCPQPAASASPPTLKPASGGLVNPSASRP FT TTYHNLPSELIQQIGDYVPVQDVGNFSAVDRRTYHAMHSRRVVYRYWQRANQVVSLASV FT NQLLNEMDGTLAHPAQHIEPLEALRQHLDALPYHEQGEAFKRIYAAAQRIPKDGVQIQK FT ALLLYSLPGFNWNHRDELFDFAYAMAQRRAPQEDNVWTELANCLIFLLAGSAEFVERYQ FT ALVARLGSLRVSEQAELIPVLCRQMLGFGRRDDRLPGLYAVLREHALQLPRSVQGASIG FT MLASAIWVLPHAERLAQYTQLRDVALSLPDEQLEIALCFLSKGWAELPREHHAYGLQLL FT EPALLRLLPAQRAQSVLSQLEDVMKLYE" FT CDS complement(428411..428518) FT /transl_table=11 FT /locus_tag="RBRH_00296" FT /db_xref="EnsemblGenomes-Gn:RBRH_00296" FT /db_xref="EnsemblGenomes-Tr:CBW76837" FT /db_xref="UniProtKB/TrEMBL:E5AUR2" FT /protein_id="CBW76837.1" FT /translation="MAAALALDIVTAMITRVGRAAAGAEIHIPFSLAYY" FT CDS complement(428523..429443) FT /transl_table=11 FT /locus_tag="RBRH_00295" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory helix-turn-helix protein, FT lysR family::PF00126
LysR substrate binding FT domain::PF03466" FT /db_xref="EnsemblGenomes-Gn:RBRH_00295" FT /db_xref="EnsemblGenomes-Tr:CBW76838" FT /db_xref="GOA:E5AUR4" FT /db_xref="InterPro:IPR000847" FT /db_xref="InterPro:IPR005119" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AUR4" FT /protein_id="CBW76838.1" FT /translation="MSMPRPMVSLSERRLHYFHAALTAGSMRAAAERLGVEASVISRQI FT QLLEKELNVTLIERRGRGVAPTDAGRLVLQAYEERRLVEETLRLRLDELRGLERGELTI FT VTGEGFVRELMSKVMAAFCARYPGINVQMETVRAEEAVAHVVEDRAHLGWTLCPPAHPA FT VRIVHERPQPLCAIMAAAHPLAGPAARVSLAAVAQYPLALAPAGTGLRALTHQAEVADG FT IRLNAVFSANSIDALMHYVGAGLGVTFLSVYPVERELAAGVLVARRTTNAVLERAKAQL FT FVRRGRRYSAAVQAFFAQMRQSGLF" FT CDS complement(429644..432319) FT /transl_table=11 FT /locus_tag="RBRH_00294" FT /product="Sensory transduction protein kinase (EC 2.7.3.-)" FT /function="Sensory transduction protein kinase (EC FT 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Sensory transduction protein kinase (EC 2.7.3.-)" FT /note="COG: Signal transduction histidine kinase" FT /note="Pfam: PAS fold::PF08447
Histidine kinase-, DNA FT gyrase B-, and HSP90-like ATPase::PF02518
Response FT regulator receiver domain::PF00072" FT /db_xref="EnsemblGenomes-Gn:RBRH_00294" FT /db_xref="EnsemblGenomes-Tr:CBW76839" FT /db_xref="GOA:E5AUR5" FT /db_xref="InterPro:IPR000014" FT /db_xref="InterPro:IPR000700" FT /db_xref="InterPro:IPR001610" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR013655" FT /db_xref="InterPro:IPR013656" FT /db_xref="UniProtKB/TrEMBL:E5AUR5" FT /protein_id="CBW76839.1" FT /translation="MRAIFAGGAMSVLDESRRHVGGDGEMAQRIRAFDWSVTELGSIER FT WPQSLVSVMQVVLASPVPMVVLWGADGYMLYNDAYAIFAGGRHPYLLGCPVEQGWPEVA FT AFNRRVLETCLAGGTLTYRDKELVLLRDGKPEDVWMDLYYSPVAGDDDVPAGVIAVVVE FT TTERVQTEQSRQRAEVALRLANERLQLALNTGAVLGTWVWDVGFGTVSGDERFTRTFGD FT VSQRQVRGIGDLLSIQQVDPDDVAQVQAQMLASLCSRTPFRAEYRITRANGEFLWVQSS FT GQWELDAHGGPRRLPGVLIDIHERKVAEAALVQLTATLEQRVKDAVSARAAVEAQLRQA FT QKMEALGSLTGGVAHDFNNVLQVINGNLQMLSAELANHPVAQRRIATAAEAVRRGARLA FT SHLLAFARRQPLSPSVVCPRQLLEGMDEMIHRSLGETVNIDTIVPDDLWNVLVDRNQLE FT NALLNLAINGRDAMRGEGTLTIAARNVVLDGKPDNGHGGGGDTEVRPGEYVCFSVSDTG FT VGMSAEVLEHAFEPFYTTKPEGHGTGLGLSMVFGFVKQSGGHMEIDSVVGRGTTVELFF FT PRSLETPCIDSPVTPGGVPRGNETVLIVEDDADVRLTAVDMIAQLGYQVLTASTGDEAK FT AILLDDARIDLLFTDVVMPGDVKSPELARLAAQRVPPVPVVFTSGYTRDEIFHHGRLDP FT GVTLLAKPYRRDELAHKLRSALEGQFRGRMTPQSALPPGENESPSPSILPAESASPSPL FT PSLAATQSAALGPCDEEGQLPYHVLLVEDDAPSREAMRDLIEVMGLRCCAAGSAEEALT FT RAAAQRYDVLLSDLTLPGMAGDQLALALRRTQPHVHVFLMSGYGQCADVDPLLNDVPVL FT QKPLDVVALGRQIAACCKSA" FT CDS complement(432457..432795) FT /transl_table=11 FT /locus_tag="RBRH_00293" FT /product="Transcriptional regulator, TetR family" FT /function="Transcriptional regulator, TetR family" FT /note="Transcriptional regulator, TetR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory proteins, tetR FT family::PF00440" FT /db_xref="EnsemblGenomes-Gn:RBRH_00293" FT /db_xref="EnsemblGenomes-Tr:CBW76840" FT /db_xref="GOA:E5AUR6" FT /db_xref="InterPro:IPR001647" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR015893" FT /db_xref="UniProtKB/TrEMBL:E5AUR6" FT /protein_id="CBW76840.1" FT /translation="MKNSAPSKGWHTIHPADMRRKELMNVGARLFVRNGIDKATTDDIV FT IEAVNLKSTFYHYFKSRNELVDAWRERFSTHIREQTQVAREAMSDGDWNGKPRAWVSTP FT IPVPSVMA" FT CDS 432894..432989 FT /transl_table=11 FT /locus_tag="RBRH_00292" FT /db_xref="EnsemblGenomes-Gn:RBRH_00292" FT /db_xref="EnsemblGenomes-Tr:CBW76841" FT /db_xref="UniProtKB/TrEMBL:E5AUR7" FT /protein_id="CBW76841.1" FT /translation="MNGTDAQPAPLHSKQAAPLLLMKQAIKFIGL" FT CDS complement(433503..434948) FT /transl_table=11 FT /locus_tag="RBRH_00291" FT /product="6-oxohexanoate dehydrogenase (EC 1.2.1.63)" FT /function="6-oxohexanoate dehydrogenase (EC 1.2.1.63)" FT /EC_number="1.2.1.63" FT /note="6-oxohexanoate dehydrogenase (EC 1.2.1.63)" FT /note="COG: NAD-dependent aldehyde dehydrogenases" FT /note="Pfam: Aldehyde dehydrogenase family::PF00171" FT /db_xref="EnsemblGenomes-Gn:RBRH_00291" FT /db_xref="EnsemblGenomes-Tr:CBW76842" FT /db_xref="GOA:E5AUR8" FT /db_xref="InterPro:IPR015590" FT /db_xref="InterPro:IPR016161" FT /db_xref="InterPro:IPR016162" FT /db_xref="InterPro:IPR016163" FT /db_xref="UniProtKB/TrEMBL:E5AUR8" FT /protein_id="CBW76842.1" FT /translation="MVTSSYTDTRLLIDGQWCDAASGKTLDVVNPATGQVIGRVAHAGI FT ADLDRALAAAQRGFDTWRKVPVHERAATMRKAATLVRERAEGIARLMTQEQGKPFAEAR FT IEVLSAADIIEWFADEGRRVYGRIVPSRNLAVQQSVLKEPIGPVAAFTPWNFPVNQVVR FT KLSAALACGCSFLVKAPEETPASPAGLLQAFVDAGVPAGTIGLVFGDPAAISSYLIAHP FT VIRKVTFTGSTPVGKQLAALAGAHMKRATMELGGHAPVIVAEDADIALAIKAAGGAKFR FT NAGQVCISPTRFLVHNSIREAFEAALVKHAQGLKLGDGLAQGTTLGPLANARRLTAMTR FT IVENARATGATVATGGERVGSAGNFFAPTVLTNVPRDADVFNQEPFGPVAAVRGFDRLE FT DAIAEANRLPYGLAGYAFTRSVRNVHLLSHQLEVGMLWINQPATPWPEMPFGGVKDSGY FT GSEGGPEAMEAYLVTKAVSVAAV" FT CDS complement(435017..436375) FT /transl_table=11 FT /locus_tag="RBRH_00290" FT /product="Argininosuccinate synthase (EC 6.3.4.5)" FT /function="Argininosuccinate synthase (EC 6.3.4.5)" FT /EC_number="6.3.4.5" FT /note="Argininosuccinate synthase (EC 6.3.4.5)" FT /note="COG: Argininosuccinate synthase" FT /note="Pfam: Arginosuccinate synthase::PF00764" FT /db_xref="EnsemblGenomes-Gn:RBRH_00290" FT /db_xref="EnsemblGenomes-Tr:CBW76843" FT /db_xref="GOA:E5AUR9" FT /db_xref="InterPro:IPR001518" FT /db_xref="InterPro:IPR014729" FT /db_xref="InterPro:IPR018223" FT /db_xref="InterPro:IPR023437" FT /db_xref="InterPro:IPR024073" FT /db_xref="InterPro:IPR024074" FT /db_xref="UniProtKB/TrEMBL:E5AUR9" FT /protein_id="CBW76843.1" FT /translation="MATILQQLPRGQKVGIAFSGGLDTSAALHWMRIKGAIPYAYTANL FT GQPDETDYDDIPRRAKQYGAENARLIDCRAQLVAEGFAALQCGAFHISTAGVTYFNTTP FT LGRAVTGTMLVAAMKEDGVNIWGDGSTFKGNDIERFYRYGLLVNPGLRIYKPWLDQAFI FT DELGGRAEMSEFMRQAGFDYRMSADKAYSTDSNILGATHEAKDLEQLDSSVRIVAPIMG FT VASWRDDVQIAREDVTVRFEQGLPVAINGVEFDSGVELLLEANRIGGRHGLGVSDQIEN FT RIIEAKSRGIYEAPGLALLYIAYERLVTGIHNEDTIDQYRDNGRRLGRLLYQGRWFDPQ FT AIMLREASQRWVARAITGEVTIELRRGNDYSIVNTQSPHLTYQPERLTMEKGESTFSPL FT DRIGQLTMRNLDIADTRDKLQLYAKTGVLGAQGGISLPQLEQGEGRRGDDAGQ" FT CDS complement(436710..436802) FT /transl_table=11 FT /locus_tag="RBRH_00289" FT /db_xref="EnsemblGenomes-Gn:RBRH_00289" FT /db_xref="EnsemblGenomes-Tr:CBW76844" FT /db_xref="UniProtKB/TrEMBL:E5AUS0" FT /protein_id="CBW76844.1" FT /translation="MHRGAWAFNALVVQFTTMGKIKSTEVQNES" FT CDS 436881..437543 FT /transl_table=11 FT /locus_tag="RBRH_00288" FT /db_xref="EnsemblGenomes-Gn:RBRH_00288" FT /db_xref="EnsemblGenomes-Tr:CBW76845" FT /db_xref="UniProtKB/TrEMBL:E5AUS2" FT /protein_id="CBW76845.1" FT /translation="MDFDPNLASINAQVAMCAMQSQQNQHATAAAPPGSLRQMAPENTC FT TLKEPMICATENQAKEPVNGSTIVRKNRPTTYRDLPLEIIQQVADCLPFDLIGDLSTVD FT RRTYHVLRERRLRYLCYARALHLKESNFDLASALQLLAEIERIRAHSALRAEPLRRLAW FT LILDLPGAQKSTAFALIFEAADRMHWIIILIDNRHQCRAKMRSSISLALIMMGQLQL" FT CDS complement(437601..439532) FT /transl_table=11 FT /locus_tag="RBRH_00287" FT /db_xref="EnsemblGenomes-Gn:RBRH_00287" FT /db_xref="EnsemblGenomes-Tr:CBW76846" FT /db_xref="UniProtKB/TrEMBL:E5AUS3" FT /protein_id="CBW76846.1" FT /translation="MFSKICSGLSTGESSRNAVCFLMNPFNVFSHAHSSPAANFQQPDG FT VTQTGVDATSRQVQPRVHSSSRALQGAIMTWSSDPSIRTLANSSSTRNFQQPDDVAQTG FT ADATSRQVQPRVRSSRRAPQEAMMTWSSDPARMTLANSSQLRQDGGQQFSVIKPVDFAE FT LDDALDDDIRRPFASENHTRLDDTNVWTRGRTRSGSPIRSQTRPTRRDEPDMVEERSLP FT RPPVNVPWLSNVFRRLRSPSASTQQQLLTEQHAGTSVDASGTTIQPYLAALNSSAPAGA FT SIRPNFILSQEDKQLLFNIDRRFAALGEACPKFRYKKSEEGNLVRILIYFAGWLNVKHE FT GSLVAYLRSQPVTDPSNIYNPTNVFSLFKNDDSFKLSSGYRSKIDRAVNKLKYLLEWEK FT GRQLSQITGYDSLFVENSAASDLASDARNIVSLRLKMSQPKEKDADILHALRNSRHCDT FT LLRIKFFIEKEFGVDESLSIIKSEIDREFTDALETLFKADGSMKPTYKKDFKPSIDILR FT GKKRSSIAKNYDRFLSEKDKKTSDNIYNYCKANGIGLGYNEDKIKSLKIFSRWLSGKGL FT YICLADVLTGIHSRGQVDALMDQYVVDEEVDWRFRSVIKEFVERIRGDKNLMDVLDNDV FT GAHNSANA" FT CDS complement(439868..440602) FT /transl_table=11 FT /locus_tag="RBRH_00286" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Activator of osmoprotectant transporter ProP" FT /note="Pfam: ProQ activator of osmoprotectant transporter FT ProP::PF04352" FT /db_xref="EnsemblGenomes-Gn:RBRH_00286" FT /db_xref="EnsemblGenomes-Tr:CBW76847" FT /db_xref="InterPro:IPR016103" FT /db_xref="UniProtKB/TrEMBL:E5AUS1" FT /protein_id="CBW76847.1" FT /translation="MGFEQLAALKQQLAAQARQQRAEQVKQRTEQGEPQHAEQGKQQGK FT QHSAAYHAKRARTGQGGQQRPVAQSHKPVDPVVEAIWRLQKHFPKSFPKKPEPKLPLKL FT GIHIDAMQHAKKLGLTEAQIKDAIATWCQGSRYWNCLVEHAARVDLQGNPVGEVSAPQA FT ARARWLASRRSHPHGGVKRQRAEAKTGTACLSNEARIAKTSPQPAQQPSAHASVDAQQM FT ECRDPQSAQAHRTAQDPKTNLE" FT CDS complement(440673..440915) FT /transl_table=11 FT /locus_tag="RBRH_00284" FT /product="FMN reductase (EC 1.5.1.29)" FT /function="FMN reductase (EC 1.5.1.29)" FT /EC_number="1.5.1.29" FT /note="FMN reductase (EC 1.5.1.29)" FT /db_xref="EnsemblGenomes-Gn:RBRH_00284" FT /db_xref="EnsemblGenomes-Tr:CBW76848" FT /db_xref="GOA:E5AUS4" FT /db_xref="UniProtKB/TrEMBL:E5AUS4" FT /protein_id="CBW76848.1" FT /translation="MRCSSHAAKHAPAPRPTTAVACSITRSHARRCASCRLRQIPWNEL FT RDDAVVSMLERYVIERSEDLLSANSGTLQPPHAAS" FT CDS complement(440960..442420) FT /transl_table=11 FT /locus_tag="RBRH_00283" FT /product="Endopeptidase degP (EC 3.4.21.-)" FT /function="Endopeptidase degP (EC 3.4.21.-)" FT /EC_number="3.4.21.-" FT /note="Endopeptidase degP (EC 3.4.21.-)" FT /note="COG: Trypsin-like serine proteases, typically FT periplasmic, contain C-terminal PDZ domain" FT /note="Pfam: PDZ domain (Also known as DHR or FT GLGF)::PF00595
Trypsin::PF00089" FT /db_xref="EnsemblGenomes-Gn:RBRH_00283" FT /db_xref="EnsemblGenomes-Tr:CBW76849" FT /db_xref="GOA:E5AUS5" FT /db_xref="InterPro:IPR001478" FT /db_xref="InterPro:IPR001940" FT /db_xref="InterPro:IPR009003" FT /db_xref="InterPro:IPR011782" FT /db_xref="UniProtKB/TrEMBL:E5AUS5" FT /protein_id="CBW76849.1" FT /translation="MKTKILSRSAVAVAVAAALSAGYFAGHKDIEPVQSAHAVPMMPAE FT AAAKTGVPDFSGLVETYGPAVVNISAKHIVRQAAQRGLPLPLDPSDPFFQFFRRFYGFG FT GNFGPQQEVPSSSLGSGFIISKDGYILTNAHVIDGANVVSVRLTDKREFRAKVVGSDKQ FT SDVAVLKIDASNLPVVKIGDPKQSKVGQWVVAIGSPYGFDNTVTSGIISAKSRALPDEN FT YTQFIQTDVPVNPGNSGGPLFNLQGDVIGINSMIYSQTGGFQGLSFAIPIDEAIRVKDQ FT LVKTGHVSRGRLGVSVQGVNQALANSFGLKQPQGALISSVEPGGPAAKAGLKAGDVILQ FT VNGAPVLSSSELPAQIAAMQPGTTAKLQVWRDRSTKDVNVTLGAFTNGKLESNDAQGAT FT QGRLGVAVRVLTPQERRAVQAQGLLVQDVAGPAAAAGVQPGDVILAVNGQPVTTPAQLA FT SSLSRAGSSVALLVQRDNAQIFIPVDLG" FT CDS complement(442835..443143) FT /transl_table=11 FT /locus_tag="RBRH_00282" FT /db_xref="EnsemblGenomes-Gn:RBRH_00282" FT /db_xref="EnsemblGenomes-Tr:CBW76850" FT /db_xref="UniProtKB/TrEMBL:E5AUS6" FT /protein_id="CBW76850.1" FT /translation="MDDRILEQGNGMGEESSHGGRPSSPGARGERPDVDHLDAALNHVD FT TQLSSGHIAAGAAKGILYSLIETLGALVGDPDLPDHARSGYEGLLETARALRARLGK" FT CDS complement(443410..444378) FT /transl_table=11 FT /locus_tag="RBRH_00281" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory helix-turn-helix protein, FT lysR family::PF00126
LysR substrate binding FT domain::PF03466" FT /db_xref="EnsemblGenomes-Gn:RBRH_00281" FT /db_xref="EnsemblGenomes-Tr:CBW76851" FT /db_xref="GOA:E5AUS7" FT /db_xref="InterPro:IPR000847" FT /db_xref="InterPro:IPR005119" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AUS7" FT /protein_id="CBW76851.1" FT /translation="MPRGTRYHPRVGLINRKGSVDKFTSIRVFREVAEAGSFVKAAERL FT NISTAMTSKHIASLERELHVRLLNRTTRQMSLTEAGSVYYEQCCEALDILQAAEAALGA FT QNSQPQGVLKVSAPGWFATRRFADLVAAYQHRFPHVLIDLRLENRFVDLTQEGYDMVLR FT ATSEPSPSLIVRPLCEVPFLLVGAPDYLARHRMPREPLDIEAHRIVLPNYTNLDRVELS FT GPRGRFTVRNRAVLKTNDTSMALQCVKAGLGLAYLPEWIVTTEVRDGALLKLLPDYVLF FT SPRVYVVYTSRKYMTPKVRTFIDFLSEALGSGAMPASDVAR" FT CDS 444355..444525 FT /transl_table=11 FT /locus_tag="RBRH_00280" FT /db_xref="EnsemblGenomes-Gn:RBRH_00280" FT /db_xref="EnsemblGenomes-Tr:CBW76852" FT /db_xref="UniProtKB/TrEMBL:E5AUS8" FT /protein_id="CBW76852.1" FT /translation="MIAGSARHRRRLAEWGTCHEITGAGVQDDSPAFTDAASNSMEHGA FT LNAQLTAYREG" FT CDS complement(444532..444645) FT /transl_table=11 FT /locus_tag="RBRH_00279" FT /db_xref="EnsemblGenomes-Gn:RBRH_00279" FT /db_xref="EnsemblGenomes-Tr:CBW76853" FT /db_xref="UniProtKB/TrEMBL:E5AUS9" FT /protein_id="CBW76853.1" FT /translation="MSPSRWLPEPDNQSFPEASGAGGRRIVVRVSAIVIEH" FT CDS complement(444831..445265) FT /transl_table=11 FT /locus_tag="RBRH_00278" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_00278" FT /db_xref="EnsemblGenomes-Tr:CBW76854" FT /db_xref="UniProtKB/TrEMBL:E5AUT0" FT /protein_id="CBW76854.1" FT /translation="MDFSFNACCPLPAWMFLEGNGRVQTMLRLLKGHGDEPCAATPQPP FT IMGIVDGLFKRGSCYATLLTDLQKRRLLDLLPPRGATTAANWLSRHCAVQFVSRGRAGA FT YAEGISRGDSHGHAKSRVELMLAHGTNFTQSVEKPFLACC" FT CDS complement(446221..446334) FT /transl_table=11 FT /locus_tag="RBRH_00275" FT /db_xref="EnsemblGenomes-Gn:RBRH_00275" FT /db_xref="EnsemblGenomes-Tr:CBW76855" FT /db_xref="UniProtKB/TrEMBL:E5AUT1" FT /protein_id="CBW76855.1" FT /translation="MIIHINFALVQYKGMALPLSIQFALRYCGARASDTNA" FT CDS 446323..453936 FT /transl_table=11 FT /locus_tag="RBRH_00274" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Formyl FT transferase::PF00551
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00274" FT /db_xref="EnsemblGenomes-Tr:CBW76856" FT /db_xref="GOA:E5AUT2" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR002376" FT /db_xref="InterPro:IPR005793" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR011034" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUT2" FT /protein_id="CBW76856.1" FT /translation="MNNQIAKLETSGPTEVVHSSSLGAQSPALQTKEHSAPSRRCAIVG FT GTTLAVHCAQQLVASGYVVQVVLATDAVLKAWANHEGILCVDTVDSLNNNIRQHPVDWL FT FSVVNPFILPASLIENIRNGAFNYHDAPLPRYAGTHATSWALLAHESHYAITWHYLTAA FT VDAGHIAVQRPIVIDADETALTLNLKCYQAARESFNELLSGLSQCSLVVRSQDPTQRSF FT YAKHRRPPAGAYLRWISPARDLSALVRALTFGELYFNPLGCPKLLLQQGTVQVARVTRL FT DQRSSAVAGTVISIKPHAWQISTGSEDVLVSGFSTLEGEPLPAQDLAIQSGISQGDRLP FT ELTQKQADSITEIHERLAPHEAFWQQRLACLQPLQLPFGQREHSTEPEWVASAWCPPLQ FT EKDASNQTATALLTVFSIYLARLTAQTKFQIGWHVNEAYNSLNTLACLASVVPMDIVAE FT LNEPFARNLANIQAEYARLEKHRTFVRDLASRSPVLRDLPALRAKHPWPVAVSVLPNET FT QSYLISSTDAVGTLITLQINSLGAFRWVYDANRLDAVQVQRISEHIRELGHASLNADHA FT DKPAKTLNLLPSAERELLLNTWNATQRDYPAHSCVHQLFEAQVARLPEATALVHEGQKL FT SYIELNAQANRLAHQLIELGVKPDARVAICVERSPAIVVGLLAILKAGGAYVPLDPAYP FT RERLAHILQDAVPQIVLADTSGRAALGDAALANRIVLDPNTVLDQPDTNPRVPGLSPSH FT LAYVIYTSGSTGTPKGVMAHHQGVVRLIQETDYVQVEPEAVFAFASNVAFDAATFEIWA FT PLLNGARIEIIDRESLLSPSALARKLKQRGVTVLFLTTALFNQIAKEQADAFSDLHYLL FT FGGEAADPQCVSRVLQEAKPRHLLHVYGPTETVTYASWYEVRSVTPSRSIPIGRPIANT FT SIYLLDTYGQPVPLGAVGELYIGGAGVSRGYLNRPDLTAERFVPDRFSATPNARMYKTG FT DLARYLPDGNLEFIGRNDHQVKIRGFRIELGEIEACLAQHAQVREAVVLALGDDSKKRL FT VAYVVAEANDALSGTLRAHVSASLPEYMVPSAFVRLNTLPLTPNGKLDRRALPAPDAEA FT FAHQAYEAPQGKLETTLAQIWSELLGVERVGRHDSFFALGGHSLLAVQMIERLRRLDLT FT VSVRTLFNTPTLSKLAQSLGQHCEVAVPPNLITLETTTLTPQLLPLVNLNQADIDRIVE FT QVPGGVANIQDIYALSPMQDGILFHHLLSTDGDPYLLIAQMAFDDRAMLDRYLNAVQQV FT INRHDILRTAFFWEGLSTPAQVVWRHAPLSITELALDPEEGQITEQLAQRFDPRQHCLD FT LTQAPLLRFVITQNNDGRWLLVQLLHHLVHDHSTLEVMHAEVKAFIEGRDDTLPPAQPF FT RNLVAQAYLGISQVEHERFFTEMLADVEEPTLPFGLADVHHDGTQITEAHQRLPQALND FT RLRAQAKRLDVSLASLCHLAWAQVLARASGQQRVVFGTVLFGRMHAGDGADSAMGLFVN FT TLPLRVDLDSDNVADSVRNTQARLAALLEHEHASLTLAQRCSSVLAGTPLFSALLNYRH FT NAIQTVESETSPGIEFLSFEERTNYPLILSVDDFGTALGLTAQIAQPFDPAHVCSYMQQ FT ALESLVEGLEYTPDMPVCQLEILSSEERKHLLKTWNATTKPYPKHMCIHQLFEAQVEHT FT PQATALVCENQTLNYAQLNAQANHLAHRLIELGVQPDVRVAICVERSLAMVVGLLAILK FT AGGAYVPLDPGHPSERLAYCLKDAAPAILLADAAGRAALGETILHSLTVLDPAVLPESS FT SINPNVSELTPSHLAYVIYTSGSTGAPKGVMIEHAQIVRLFETEPSTENQALKSTQLAY FT SLTPTDRVLQKTPFSFDVSLWEIFWTLMNGATLVVAPPDAHKDPFALVDLIIRQRVTTV FT HFVPSMLRIFLNSGSIQHCTSLKQLICSGEALSSADIQICRALLPQVQLHNLYGPTETS FT IGTTVWTCPVKWTAKNVLIGRPIANTRVYLLDARGQPVPLGAVGELYIGGEGVARGYLN FT RPQLTAECFVHDPFSDQPDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEI FT EACLARHAQVRDAVVLATGEDQDKRLVAYVIADADEQLANTLRIHLAASLPEYMVPSAF FT VQLNAFPLTPSGKLDRRALPVPDTGALALQKYEAPQGQLETTLADVWGELLGVERVGRQ FT DSFFALGGHSLLAIRMIERIRITLGIEITILSLFETPTIAGLVQRLVQKTGIRDDAFAV FT LLPIQPTGTRPPLFCVHPVSGLSWLYRNLINYLDTDQPVYGLQARGLNGASPLAETIDE FT MAADYIKQIRRIQPNGPYHLLGWSFGGNVVHSMASQLEQQGESVSLLALLDSYPDYAQR FT VDDPDKIQKEFYIELLSRYGDDSIPNVGDYLWGKTRDVIKNNHRLLKEASIPIYCGDAL FT FFYATIADDESIPLASPDLWKPYILKNIEICNIHCKHRDMGGPGPATEIGQILAQRLSS FT LYVSANSSAPGVSG" FT CDS complement(454278..460205) FT /transl_table=11 FT /locus_tag="RBRH_00273" FT /product="Excinuclease ABC subunit A" FT /function="Excinuclease ABC subunit A" FT /note="Excinuclease ABC subunit A" FT /note="COG: Excinuclease ATPase subunit" FT /note="Pfam: ABC transporter::PF00005" FT /db_xref="EnsemblGenomes-Gn:RBRH_00273" FT /db_xref="EnsemblGenomes-Tr:CBW76857" FT /db_xref="GOA:E5AUT4" FT /db_xref="InterPro:IPR001841" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004602" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AUT4" FT /protein_id="CBW76857.1" FT /translation="MSSSNSIRIRGARQHNLKNLDLDLYPGEMTVVTGPSGSGKSSLVF FT DTLYAEGQRRYVETFSAYARQFLDRMDRPQVDRVDGVPPAIAIDQTNPVRSSRSTVGTM FT TELNDHLKLLYARAAELFDRQTAQRVRHDTPETIYAELVERTRERDPRVIVTFPIELPD FT TATEAEVEQWLSASGYTRVHAQRVVAAASGSRKLLDVVADRFRVHGADKARVVEAIETA FT LKRGGGRVDVQVPEHGDVPAQTWRFSTGLHCPDSDLRYAQPQPALFSFNSPYGACDKCR FT GFGRVIGVDLGLVIPDERKSLRDGAVKPMQTPAWKECQDDLIRYAARAGIPRDTPWAQL FT FAQHRDWVINGSPDWDGDWQRQWYGVRRFFDYLESKAYKMHIRVLLSKYRSYTPCDTCG FT GARLKTDALLWRLGTQANADVVLPREQRFMPRGVDWTRAQLEALPGLTIHDLMLMPIER FT ICRFFDELTLPSLLLDDALKLLLAEVRTRLRYLCDVGLGYLTLDRQSRTLSGGEVQRIN FT LTTALGTSLVNTLFVLDEPSIGLHPRDLGRIIEAMQRLRDAGNTLVVVEHDPLVMLAAD FT RLIDMGPGPGERGGTIVYDGTPVDVRDAATLTGAYLGGRKRVADASEWLRRPVDAQTRR FT LVLEGATEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPALARHFGKPTDAPGA FT YRALRGADALGEVVFVDQSPIGKTARSNPASYVGAFDEIRKLFAKAPLALQRGYTAGTF FT SFNAGDGRCPTCGGSGFEHVEMQFLSDVYLRCPDCDGKRYRAEVLDVTIERTAPGGATR FT RLAITDVLELTVSEATALFASDGEVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRLKL FT AGFLAETTPGRGAGTVPTRLFMFDEPTTGLHFDDIAKLMRAFGKLLERGHSLIVIEHNL FT DVIRAADWLIDLGPDGGDAGGKLVCSGTPEEVKRCAQSHTGQALLQYDRALQAGDVRAT FT LPGAHGVNEPLVPYLAGEAAAAGVALQTALTAGRVRHASPEHAVRIVNAREHNLKSLDV FT DIPHGKFNVVTGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYG FT IPPTVAIEQRLSRGGRKSTVATTSEVWHFLRLLYVKLGVQHCVHDGTPVTSQSIESIAA FT QLLRDYKGQHIGLLAPLVVNRKGVYTDLAKWAKARGNTHLRVDGAFVGVDPWPKLDRFR FT EHTIELPVADLVVSADHEGELRRLLADTLEVGKGVMHVLAPLDGLLDGMTRGGSGANIG FT AIKVFSTKRACPVCGTSYPELDPRMFSYNSKHGWCTTCVGTGLKLTREQRAAFDDTVVG FT GDERGREQTLPSEEQEPEGVGDTPCPDCGGTRLNDVSRAITFAGQPIVAVAQWTVSDTR FT HWISQLQMGGREAEIARDVVSEIQSRLEFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAA FT QLGSNLQGVCYVLDEPTIGLHPRDNRILLDALRKLGDKGNTLVVVEHDEDTIRRADHII FT DIGPGAGKRGGTLVASGRVADIAADPRSLTGRYLAQPIVHPLQPRRAVDAASRMAPSRW FT LTVQRASLHNLRDVTVDIPLARLVAITGVSGSGKSTLARDVLMANLLDAVGRSVLSSPA FT QRRARKAAQGDADNVSARARRASVLARTDARPRVSVRHLWRGCESITGWDGIDRVLEVD FT QTPIGKTPRSCPATYIGIWDAIRKLFAQTLEARARGYQVSRFSYNTGDGRCPACEGQGV FT RTIGMSFLPDVKVPCDVCHGQRFNPETLAVTWRGRSIGDVLTMEIDEAVEFFGAISSIA FT HPLQLMKDVGLGYLTLGQPSPTLSGGEAQRIKLITELSKVRDDVARRGQRAPHTLYVLD FT EPTVGLHMADVAKLIHVLHRLVDAGHSVVVIEHDLDVIAEADWIIDLGPEGGAGGGTVV FT AAAAPEGLVKVRHSHTGAALASVLARERVPGHDASYGDLRAG" FT CDS 460452..460772 FT /transl_table=11 FT /locus_tag="RBRH_00272" FT /db_xref="EnsemblGenomes-Gn:RBRH_00272" FT /db_xref="EnsemblGenomes-Tr:CBW76858" FT /db_xref="UniProtKB/TrEMBL:E5AUT3" FT /protein_id="CBW76858.1" FT /translation="MGCGCRFTATNQIFTHRFFGEWTMQDSRLENVVSDLSVLKYSIRH FT GGGKGRKRQQTLHRRLRVRRWLDALALTGVVIATATIVAGHPTLGLGFYLASTLPLVFH FT GR" FT CDS complement(460827..461330) FT /transl_table=11 FT /locus_tag="RBRH_00271" FT /note="Pfam: Acetyltransferase (GNAT) family::PF00583" FT /db_xref="EnsemblGenomes-Gn:RBRH_00271" FT /db_xref="EnsemblGenomes-Tr:CBW76859" FT /db_xref="GOA:E5AUT5" FT /db_xref="InterPro:IPR000182" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUT5" FT /protein_id="CBW76859.1" FT /translation="MAFAGLGAMGLNCTCVDQPVISTMQRARAGDCFVAAYGSAPIGTM FT TLYARDVDSACDYYRLRDVATLRQFGIDPAWQGRGLGTMLLAFAEHWAATRGYAALALD FT TPYPASHLIAFYRSQGFRLVDVMRFADKRYDSAILSKPPVAARMLGQWDRRLMPARRTL FT ARAA" FT CDS complement(461825..462268) FT /transl_table=11 FT /locus_tag="RBRH_04261" FT /db_xref="EnsemblGenomes-Gn:RBRH_04261" FT /db_xref="EnsemblGenomes-Tr:CBW76860" FT /db_xref="UniProtKB/TrEMBL:E5AUT6" FT /protein_id="CBW76860.1" FT /translation="MLDAQVFAQLLDIVQQLSDAVADVKHAFDTVCFLRPLAWVVHVVI FT RQGRQCIRKHDRLDEFCIWHCVTVAPHAKLFWHVTAMPRYRATSRTSHAMENVGAQETS FT DAAGHDDPCVRASMRGRGAGHHAARKRRLAHAHQRQRERAGAS" FT CDS 463063..463611 FT /transl_table=11 FT /locus_tag="RBRH_00269" FT /product="Peroxiredoxin (EC 1.11.1.15)" FT /function="Peroxiredoxin (EC 1.11.1.15)" FT /EC_number="1.11.1.15" FT /note="Peroxiredoxin (EC 1.11.1.15)" FT /note="COG: Peroxiredoxin" FT /note="Pfam: AhpC/TSA family::PF00578" FT /db_xref="EnsemblGenomes-Gn:RBRH_00269" FT /db_xref="EnsemblGenomes-Tr:CBW76861" FT /db_xref="GOA:E5AUT7" FT /db_xref="InterPro:IPR000866" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR024706" FT /db_xref="UniProtKB/TrEMBL:E5AUT7" FT /protein_id="CBW76861.1" FT /translation="MSIINSRIKPFNATAYRNGQFVPVSNQTLKDKWSVIVFYPADFTF FT VCPTELGDLADRYAEFQQLGVEIYSVSTDTHSTHKAWHDTSDTIGKIAYPMIGDPTQAI FT SRHFDVLVEEEGMALRAHSSSIRQARSSYAKSMTTASAATPVSCCARCKRPSMSLRIQA FT KSALRNGPPARKRSSRRWT" FT CDS 463703..465304 FT /transl_table=11 FT /locus_tag="RBRH_00268" FT /product="Peroxiredoxin reductase (NAD(P)H) (EC 1.8.1.-) / FT NADH oxidase H2O2-forming (EC 1.6.3.-)" FT /function="Peroxiredoxin reductase (NAD(P)H) (EC 1.8.1.-) / FT NADH oxidase H2O2-forming (EC 1.6.3.-)" FT /EC_number="1.8.1.-" FT /note="Peroxiredoxin reductase (NAD(P)H) (EC 1.8.1.-) / FT NADH oxidase H2O2-forming (EC 1.6.3.-)" FT /note="COG: Alkyl hydroperoxide reductase, large subunit" FT /note="Pfam: Pyridine nucleotide-disulphide FT oxidoreductase::PF00070
Pyridine nucleotide-disulphide FT oxidoreductase::PF07992" FT /db_xref="EnsemblGenomes-Gn:RBRH_00268" FT /db_xref="EnsemblGenomes-Tr:CBW76862" FT /db_xref="GOA:E5AUT8" FT /db_xref="InterPro:IPR000103" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR002109" FT /db_xref="InterPro:IPR008255" FT /db_xref="InterPro:IPR012081" FT /db_xref="InterPro:IPR012336" FT /db_xref="InterPro:IPR013027" FT /db_xref="InterPro:IPR023753" FT /db_xref="UniProtKB/TrEMBL:E5AUT8" FT /protein_id="CBW76862.1" FT /translation="MLDTTLKHQLKAYLEKVSRPIDIVASVDDSDKSRELLALLDDIAS FT LSDHIRVNVRRDEEPRKPSFSIGEPGKPNGIRFAGVPLGHEFTSLVLALLQTGGHPLKL FT DDSLIQQIRELDGDYRFETYFSLSCQNCPEVVQALNLMALINPRIHHVAIDGALFQDEV FT QARQIMAVPTIFLNGERFGQGRSGIKDILAKLDSGASARAAQALQDKPVFDVLVVGGGP FT AGAAAAIYAARKGIATGVVAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVTQYD FT VDIMDTQRAEALIPGPIHQVRLASGAVLEAKAVILATGARWREIDVPGEREYRNRGVAY FT CPHCDGPLFKGKRVAVVGGGNSGVEAAIDLAGIVSHVTLLEYGPRLRADAVLQRKLHSL FT PNVTVITQAQTARITGDGSKVDGLTYRDLRTGESQHIELAGVFVQIGLVPNTEWLKGTV FT ELSTHGEIVVDAKGGTSIPGVFAAGDVTTVPFKQIVIAIGEGAKASLGAFDHLIRHADP FT VVTEPVTVQPIRGGTA" FT CDS 465346..465837 FT /transl_table=11 FT /locus_tag="RBRH_00267" FT /db_xref="EnsemblGenomes-Gn:RBRH_00267" FT /db_xref="EnsemblGenomes-Tr:CBW76863" FT /db_xref="UniProtKB/TrEMBL:E5AUT9" FT /protein_id="CBW76863.1" FT /translation="MRAVPLQARRRHRGAATTRAEWRIDMISIPDSTLPQFDRPFRLFA FT TEKRVLAQNAVGKLIDIGAIEHLHDGHCAIHLDVDAINTGPQPNPQSALRTLVPKLNFD FT YLDGLFTAEANARFDGRPDMTDVTDTSLGSRLAVPDVGVSQGAPKAFRHAEHVAPTRPA FT " FT CDS 465740..465862 FT /transl_table=11 FT /locus_tag="RBRH_00266" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00266" FT /db_xref="EnsemblGenomes-Tr:CBW76864" FT /db_xref="UniProtKB/TrEMBL:E5AUU0" FT /protein_id="CBW76864.1" FT /translation="MDQGWQYQMSVYRKALQKHSVMQNMSRRRDRHNATEHVVE" FT CDS 465863..466162 FT /transl_table=11 FT /locus_tag="RBRH_00265" FT /db_xref="EnsemblGenomes-Gn:RBRH_00265" FT /db_xref="EnsemblGenomes-Tr:CBW76865" FT /db_xref="UniProtKB/TrEMBL:E5AUU1" FT /protein_id="CBW76865.1" FT /translation="MCGVCLKQRRCLGEIDHRERCFGIGMRTTRLRPIACKKRGWVLRD FT QLLKPHEFAAVHVEPMQYIVQLACCAVIIRQTNHGHYRLARSNPRLRILSISAP" FT CDS complement(466166..476461) FT /transl_table=11 FT /locus_tag="RBRH_00260" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_00260" FT /db_xref="EnsemblGenomes-Tr:CBW76866" FT /db_xref="GOA:E5AUU2" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUU2" FT /protein_id="CBW76866.1" FT /translation="MNRSCVMDVSVMLTTYALSAAQTEIWLAQQLHPDSPVYNIAQYTV FT IEGAVEPAVFEAALRQVIDEADTLRLQFIDSDDGLRQRIGAPAWSMPVLDLTAQTDPQA FT AAQAWMRADYQQPVNLMQGPLFCYALLKVAPAQWMWYQRYHHIMMDGYGQSLIAQRVAH FT VYSALCAGEAPTACNFGSIRQLLESDAQYQASAQRAQDEAYWLQHCAHWPEPVTLASRA FT APALQQRLRQTTYLATQWVDDYVLDAGRLAQFLSAALAAYLHRMSGAQDVVLGLPMTAR FT LGADQHIPGMVANTVPLRFSVEPEMNLLSLMRQAAQEIQSALPYQRYPSEALQRQLGLA FT PGQRLFGTTVNVMPFDYALSFGGHASTNHNLLAGPVDDLMLGVYWTPHSRQLRIDFDAN FT PACYTTEALNAHQRRFIRFMQVLAADATQPIDRIDLLDADERHRLLVEWNATQRAYPSH FT LCIHQLFEAQVERTPEAPALVFEDQTFSYAQLNAQANRLAHQLIEWGVKPDARVAICVE FT RSPAMVAGLLAILKAGGTYVPLDPAYPPERLAYMMADSAPVALLSVGTPPAAVTQCLGA FT GVPVLDLQADVAQWTRQSARNPELTLTAQSLAYVIYTSGSTGQPKGVMIQHRSAVNLVT FT SMTQKLGVTAHDRVLQCSSLSFDASVGEIFVTLTQGAALVLRTDAWLAGAQQFWALCKA FT NRVSVTDLPTQFWSQLAQEKVPVPDNVRVVMISGEALSVSAQSAWFAGAGYRPRLFNVY FT GPTETTVTATVHEVIDEENNWRTIGRPIDNTRLYILDAHKKPVPLGAVGELYIGGVGVA FT RGYLNRPELTAERFVRDPFSDKPDARLYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRI FT ELGEIEACLAQHAQVREAVVLAMGEGSTKRLVAYVVAEPDDALAGTLRTHVAAALPEYM FT VPSAFVRLDALPLTPNGKLDRRALPAPDDEALAHQAYEAPQGELETTLATIWAELLSVE FT RVGRHDSFFALGGHSLLAVRLMNRVRRLGADVPLATLFATPTLAAFAAALEAHLQQGTD FT ALSEITPVSRKGSLPLSFAQQRLWFLAQLDGVSESYHTPLALHVRGPLDRAAWQQALDA FT LFARHEALRSTFVSVEGQPQVRLLPADTGVPLRWHDLRGVPHAQAQLARLSHEAVHAPF FT DLAQGPLMRACGIQVADEEHVVLITQHHIVSDGWSIGVLARELSALYAASVGAQADPLP FT PLAVQYPDYAAWQRQWLTGERLQAQSDYWRATLADAPVLLELPTDRPRPAQQSFAGAQA FT PVRIDAATTQALKRLSAEHGTTLFMTMLAAWSTVLARLSGQHDMVIGTPSANRNHPQIE FT PLIGFFVNTLALRMDLSGEPDTAELLARVRRPTLDAQAHQDLPFEQVVEIVQPPRRLNH FT TPLFQVMLAWQNNAPGEWRLPGLAATPAELEYDAVKFDLELNLSEAGEEVVGSLGYATA FT LFDRSTIERHVGYLQTMLRAMVARPQQPVATLELLSPAERQLLLDTWNATQRDYPSHLC FT IHQLFETQVERTPEAPALVYEAQTLSYAQLNAQANRLAHQLIKLGVKPDAQVAICAERS FT PAMVVGLLAILKAGGAYVPLDPSYPGERLAHILADAAPSIVLADAAGRAALGEAVIAEC FT TVLDPTTLPAWPDTNPSVAELTARHLAYVIYTSGSTGTPKGVMVPHHAIARLVINNDYV FT DICTGDRVAFAANPAFDASTFEVWAPLLNGATVVVIDHDTVLMPAAFAHTLREQHISIL FT WLTVGLFNQMAAQVDTAFSQLKVLIVGGDVLGARLVARVMRESPPEQLINGYGPTESTT FT FATTYKITSVSETNASIPIGRPVANTRVYLLDAHGQPVPLGAVGELYIGGAGVARGYLN FT RPKLTAERFVRDPFVGEPGARLYKTGDLARYLPDGNLEFVGRNDDQVKIRGFRIEPGEI FT EACLTAHPQVRDAVVLATGEGTAKRLVAYVQAEANEPLASTLRAHVSARLPEYMVPSAF FT VRLDAFPLTPNGKLDRRALPAPDDAALAHQAYEAPQGELETTLAAIWAELLGVERVGRH FT DSFFALGGHSLLAVRLIERLRRRGVGLSVRALFDTPVLSALAQTLGEHCDVAVPANAIT FT PDTSAITPSMLLLIELTQADIDKIVEQVSGGVANIQDIYALSPLQDGLLFHHLLASTGD FT PYLLMVQLAFDSRERLDQYLHALQQVIDRHDILRTAFVWEGVSMPAQVVWRHARLPVTE FT LTLDAADGPIAEQLARRFDPRHTRLDLTQAPLLHCAIAQDSRGRWLLMQRLHHLISDHS FT TLDVMHAEVRAFIEGRGDALPPAQPFRYLVAQARLGVSQAEHEHFFTELLADVEPTLPF FT GLAQVQRDGSEVSESHRMLPSALNNRLRAHARRLGVSLASLCHLAWAQVLARASGQPRV FT VFGTVLFGRMQAGEGADRAMGLFINTLPLCVDLEGSVQAAVHATHARLAALLEHEHASL FT ALAQRCSGVPAGTPLFSALLNYRHNAMGSDERSGLPGVELLSAQERTNYPIGLSVEDFG FT QSLGLTAQSVPPLEPERVCAYMQQALQSLADALEATPDIAVQQLQVLPEAERELLLDTW FT NATQRDYPSHLCIHQLFEAQVERTPEAPALVYEAQTLSYAQLNAQANRLAHQLIELGVK FT PDTCVAICVQRSAALVVGLLAILKAGGAYVPLDPSYPGERLAHILADAAPNIVLADAAG FT RAALGEAALVECTVLDPTTLPALPDTNPSIAELTARYLAYVIYTSGSTGTPKGVMVEHR FT GVVNLALAQIACFGVQPASRILQFVSFSFDVSTSDIFTALGCGASLYLSPETARHDRNG FT LWNYLTRHQITHVALPPALLQNGEGLPNLHTPLTLILGGETPSATLIRNLADQGTVFNA FT YGPTEATVCATAWRGTRDFSGEVPIGRPIANVRVYLLDAHGQPVPLGAVGELYIGGVGV FT ARGYLNRPALTAERFVHDPFSEDAGARLYKTGDLARYLPDGNLEFVGRNDEQVKIRGFR FT IEPGEIEACLTAHPQVRDAVVLATGEGSNKRLVAYVQAEADEPLASTLRAHVSASLPEY FT MVPSAFVRLDAFPLTPNGKLDRRALPAPDDQALAHQAYEAPQGELETTLAAIWAELLGV FT ERVGRHDSFFALGGHSLLAMCLINRVRTALGVDLAIRTLFEAPTLAGLARHLVKRDGIQ FT ENSFSVLLPLKPTGSRPALFCIHPGLGLSWSYMGLSNYLHTDQPLYGVQARGLDGTSPL FT ASTLDEMVSDYLEHIRRVQPKGPYCLLGWSFGGIVAHSMAVRLEHQGEKVALLVLLDST FT PLVGSNAFAEKENQLDKAMVRDVFAHHYGNELVSAMDEHLLEKTEEIVKNNSRIIKDYS FT PSQYGGNALLFRATVVEAEDETLVSPDAWNPYVCGNIEVCNVHCSHGEMFKPESTALIG FT PILARKLNELENQQAQGQTNAVR" FT CDS complement(477000..477128) FT /transl_table=11 FT /locus_tag="RBRH_04262" FT /db_xref="EnsemblGenomes-Gn:RBRH_04262" FT /db_xref="EnsemblGenomes-Tr:CBW76867" FT /db_xref="UniProtKB/TrEMBL:E5AUU3" FT /protein_id="CBW76867.1" FT /translation="MANRNGLPSAFVCEFQLYRFIHSRTVVLRKDNGLECIMAGAL" FT CDS 477319..477633 FT /transl_table=11 FT /locus_tag="RBRH_04263" FT /product="Tetracycline resistance protein" FT /function="Tetracycline resistance protein" FT /note="Tetracycline resistance protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_04263" FT /db_xref="EnsemblGenomes-Tr:CBW76868" FT /db_xref="InterPro:IPR016196" FT /db_xref="UniProtKB/TrEMBL:E5AUU4" FT /protein_id="CBW76868.1" FT /translation="MGAATSSVSVQRSVMSVSPWHYLADHDTWGYRYHLSDSAQPAARA FT QHHRANLHILLDAYALAQLLCSSVLGAPSDHFERRPVLLASLIGGAAINSAVMAIAPTL FT " FT CDS 477749..477910 FT /transl_table=11 FT /locus_tag="RBRH_00257" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_00257" FT /db_xref="EnsemblGenomes-Tr:CBW76869" FT /db_xref="GOA:E5AUU5" FT /db_xref="InterPro:IPR010921" FT /db_xref="UniProtKB/TrEMBL:E5AUU5" FT /protein_id="CBW76869.1" FT /translation="MSGQSGLKTAAKRHDVDISAVRSWVAAYREHGCVGLMKKQRVDYS FT AEFELAAL" FT CDS 477870..478262 FT /transl_table=11 FT /locus_tag="RBRH_04264" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_04264" FT /db_xref="EnsemblGenomes-Tr:CBW76870" FT /db_xref="UniProtKB/TrEMBL:E5AUU6" FT /protein_id="CBW76870.1" FT /translation="MLTTVPNSSWRPFNGPLFAASHRQARVILNGLFTWLVDAGYLRGN FT PMALLRQRAKRSAPRAPTSMPCWHGAVNCLTSTRTTLRKCCAKRSGTTGSAGNCAAVQR FT QRQKVARSPLCGNCSAMAAPGTCVAG" FT CDS complement(478289..478435) FT /transl_table=11 FT /locus_tag="RBRH_00254" FT /db_xref="EnsemblGenomes-Gn:RBRH_00254" FT /db_xref="EnsemblGenomes-Tr:CBW76871" FT /db_xref="UniProtKB/TrEMBL:E5AUU7" FT /protein_id="CBW76871.1" FT /translation="MLLTCDAGALERIGVRLLRVLRDSDARVERRQADDRCGAIRFSAI FT RIR" FT CDS complement(478590..478949) FT /transl_table=11 FT /locus_tag="RBRH_00253" FT /db_xref="EnsemblGenomes-Gn:RBRH_00253" FT /db_xref="EnsemblGenomes-Tr:CBW76872" FT /db_xref="UniProtKB/TrEMBL:E5AUU8" FT /protein_id="CBW76872.1" FT /translation="MVCYLSVRVKPPREEVAHAQALYARMHDGALRLHRLHEAERSFVD FT EAGRSFAIVASEIRNFAQRHGVCARRITAGSPGASVAAPAISAYLTTRRLDLSRCPYRC FT PAQPIGQRCRRCPGG" FT CDS complement(478922..479065) FT /transl_table=11 FT /locus_tag="RBRH_00252" FT /db_xref="EnsemblGenomes-Gn:RBRH_00252" FT /db_xref="EnsemblGenomes-Tr:CBW76873" FT /db_xref="GOA:E5AUU9" FT /db_xref="InterPro:IPR000014" FT /db_xref="UniProtKB/TrEMBL:E5AUU9" FT /protein_id="CBW76873.1" FT /translation="MWRTLEHGCQWSGLVKSRCKNGDDDWVLDSVTPVIGPGEWSATLA FT CA" FT CDS complement(479140..479325) FT /transl_table=11 FT /locus_tag="RBRH_00251" FT /db_xref="EnsemblGenomes-Gn:RBRH_00251" FT /db_xref="EnsemblGenomes-Tr:CBW76874" FT /db_xref="UniProtKB/TrEMBL:E5AUV0" FT /protein_id="CBW76874.1" FT /translation="MTNMSGYAPVAPHAAGWPCSGCRRRPGPVRHPWLQGGHGRPHIGI FT RQLDIQAVNFCEGSVT" FT CDS complement(479350..480030) FT /transl_table=11 FT /locus_tag="RBRH_00250" FT /db_xref="EnsemblGenomes-Gn:RBRH_00250" FT /db_xref="EnsemblGenomes-Tr:CBW76875" FT /db_xref="UniProtKB/TrEMBL:E5AUV1" FT /protein_id="CBW76875.1" FT /translation="MLNRCALHFRQVRCLYLTVQLVRLPMQVNTISPGSAQVDSLSFHN FT ELNTGSEVAGQRQARAGSKPEGVLAELPALACRTSMARRRNVTSQAACFAQHPEAKYYP FT PVVQQISGLLEKQNIGISDRAHDGVIANMEGLRSGTQTHTGAHLVESRVFGRDAIEHFK FT SGETYLAVVNCVGSLINGVASMTVGPAHDFDDARRSSDPQRAARAYASIAWDFETLPSP FT TPRD" FT CDS 480414..480806 FT /transl_table=11 FT /locus_tag="RBRH_00249" FT /note="COG: Transcriptional regulators containing a FT DNA-binding HTH domain and an aminotransferase domain (MocR FT family) and their eukaryotic orthologs" FT /db_xref="EnsemblGenomes-Gn:RBRH_00249" FT /db_xref="EnsemblGenomes-Tr:CBW76876" FT /db_xref="UniProtKB/TrEMBL:E5AUV2" FT /protein_id="CBW76876.1" FT /translation="MQETACAAYPILRSCHGSKAPTVDSRDGPHPAGAQTNDWGRVRPA FT RRARTITAPRGSGFYVSSRAAPLSLMDIGPRLDRAIDPLWIARQSLETSSNMLTPGCGS FT MPHRLDARGRRAPRTAVAGTRWIGPG" FT CDS 480893..481408 FT /transl_table=11 FT /locus_tag="RBRH_00248" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00248" FT /db_xref="EnsemblGenomes-Tr:CBW76877" FT /db_xref="UniProtKB/TrEMBL:E5AUV3" FT /protein_id="CBW76877.1" FT /translation="MSRMRSPLGCGAHACVTLARQRAASAQSACYNFRRLHTAMMPTHG FT RRGPLLYAKAPSLRRRPDEPTGAFEWSMPCPAIPHLRALALAAAVPAALAACVVEPTHP FT PQPALVVEVVPGAPAPGYHWVRGHYRWGYNHGKWVHKHWAPVIDFLAFRAPAATIIQIG FT AGRAPSPG" FT CDS 481405..481773 FT /transl_table=11 FT /locus_tag="RBRH_00247" FT /note="COG: DnaK suppressor protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00247" FT /db_xref="EnsemblGenomes-Tr:CBW76878" FT /db_xref="InterPro:IPR009962" FT /db_xref="UniProtKB/TrEMBL:E5AUV4" FT /protein_id="CBW76878.1" FT /translation="MMRRRAAVRTTSVRATWEPFMEITFVNTPPEFRGWNLTVGFTAKV FT DDRQVDCSISAEALEDHFGAQSPNPGDLLAAFDRHRSAIEHAARNVLQVSDSNEILLRS FT GYLRFQQCRKAARAIQRG" FT CDS 481819..482220 FT /transl_table=11 FT /locus_tag="RBRH_00246" FT /db_xref="EnsemblGenomes-Gn:RBRH_00246" FT /db_xref="EnsemblGenomes-Tr:CBW76879" FT /db_xref="InterPro:IPR021947" FT /db_xref="UniProtKB/TrEMBL:E5AUV5" FT /protein_id="CBW76879.1" FT /translation="MRSDGVPANREEHMMHLTILVNGSDPQARDDFAVLWPDIDERVWS FT RELHSGIDLPSRGRRHDEDDTMLLCSPEENAPLCTLHGLRFGRGVRAAIEHGAAAWVST FT RSGEPADGRWHLQAIERDVKPAEHSALCR" FT CDS complement(482232..483293) FT /transl_table=11 FT /locus_tag="RBRH_00245" FT /product="Hypothetical membrane spanning protein" FT /function="Hypothetical membrane spanning protein" FT /note="Hypothetical membrane spanning protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_00245" FT /db_xref="EnsemblGenomes-Tr:CBW76880" FT /db_xref="InterPro:IPR022791" FT /db_xref="UniProtKB/TrEMBL:E5AUV6" FT /protein_id="CBW76880.1" FT /translation="MKLLRALSWPLGIAIFVALLWHEGVHDVKQPLSQAGFALLWLVPF FT HVVPLAFDAQAWRILLERRASLPFLTWAATVREAVSRMLPSAGIGGELVGIRLAAWRVN FT DSSLVAASVVVEVLTTIAVQYVFSALGIVLIFLQASHRGSLTPIVVGLVLSLPIPFVCA FT VLLRRGGLFDKLDRFAKRLFGAGHRLLAGVDGAALDRCINAMLTRAATLASAFAWQLAG FT YIIGALETYWALALLGHPVSIGAALAIEALTQAVRHAAFIVPAGLGVQEAAVLVLAQML FT GVDAATAMSLAVTKRMREVVFSGLALASWQLAEFWRAHRAIGEPWRRRWRVQRRLRLRA FT RRTAAASVPLGRR" FT CDS complement(483290..484147) FT /transl_table=11 FT /locus_tag="RBRH_00244" FT /product="cellobiose phosphotransferase system celC" FT /function="cellobiose phosphotransferase system celC" FT /note="cellobiose phosphotransferase system celC" FT /note="COG: Uncharacterized protein conserved in bacteria" FT /note="Pfam: YdjC-like protein::PF04794" FT /db_xref="EnsemblGenomes-Gn:RBRH_00244" FT /db_xref="EnsemblGenomes-Tr:CBW76881" FT /db_xref="GOA:E5AUV7" FT /db_xref="InterPro:IPR002509" FT /db_xref="InterPro:IPR006879" FT /db_xref="InterPro:IPR011330" FT /db_xref="InterPro:IPR017836" FT /db_xref="UniProtKB/TrEMBL:E5AUV7" FT /protein_id="CBW76881.1" FT /translation="MTQSPARALIVTADDFGLHPRVNEAVERAHRDGILSAASLMVAAP FT AARDALERARRMPSLRVGLHLVLADGNAMLPRERIASLVDARGRFGDAMARDGARFFFL FT PPVRRQLAREIRAQFDAFAATGLTLDHVNTHKHFHLHPTVLSLIVEIGRDYGMHAMRLP FT REVDAPLLLRPWIALVKSRLRRAGIAHNDYVVGMARSGQMDEAALLAAVAHLPPGVGEI FT YLHPAVPGEGAITSSMRDYRHADELDALLSPRVAAALAAANVRRGGFRDVLPARPRANR FT EALA" FT CDS complement(484144..485565) FT /transl_table=11 FT /locus_tag="RBRH_00243" FT /product="Radical SAM superfamily" FT /function="Radical SAM superfamily" FT /note="Radical SAM superfamily" FT /note="COG: Fe-S oxidoreductase" FT /note="Pfam: Radical SAM superfamily::PF04055" FT /db_xref="EnsemblGenomes-Gn:RBRH_00243" FT /db_xref="EnsemblGenomes-Tr:CBW76882" FT /db_xref="GOA:E5AUV9" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR017834" FT /db_xref="InterPro:IPR023404" FT /db_xref="InterPro:IPR023970" FT /db_xref="UniProtKB/TrEMBL:E5AUV9" FT /protein_id="CBW76882.1" FT /translation="MKTLFLQAPSFDGFDGGAGSRYQAKREIRSFWYPTWLAQPAAMVP FT GSRVLDAPADGLSVEATLDIAQGYDLVVIHTSTPSFPTDALFAQKLKERKPSVMIGMVG FT AKVAVDPHGSLGASAAIDWVGREEFDYTCKEVAEGRPLKEVTGLSYRLADGSIEHNPPR FT PMIENMDALPFVAPVYKRDLKIDNYFIGYLKHPYVSIYTGRGCRSRCTFCLWPQTVGGH FT RYRVRSVENVLEEVKWIRDNMPEVKEIMFDDDTFTDFKPRVEAIARGLGKLGVTWSCNA FT KANVPYSTLKIMKENGLRLLLVGYESGDDQILLNIKKGLRTDIARRFSEDCRKLGIKIH FT GTFILGLPGETRETIQKTIAYAKEINPHTIQVSLAAPYPGTTLYKQAVENGWLEENKVI FT NLVSHEGVQLAAIGYPHLSREDIYHGLEEFYKRFYFRPSKIWEIVREMLTSWEMMKRRL FT REGVEFFRFLRAHEA" FT CDS complement(485654..486880) FT /transl_table=11 FT /locus_tag="RBRH_00242" FT /product="Ceramide glucosyltransferase (EC 2.4.1.80)" FT /function="Ceramide glucosyltransferase (EC 2.4.1.80)" FT /EC_number="2.4.1.80" FT /note="Ceramide glucosyltransferase (EC 2.4.1.80)" FT /note="COG: Glycosyltransferases, probably involved in cell FT wall biogenesis" FT /db_xref="EnsemblGenomes-Gn:RBRH_00242" FT /db_xref="EnsemblGenomes-Tr:CBW76883" FT /db_xref="GOA:E5AUV8" FT /db_xref="InterPro:IPR017835" FT /db_xref="InterPro:IPR025993" FT /db_xref="UniProtKB/TrEMBL:E5AUV8" FT /protein_id="CBW76883.1" FT /translation="MAATANLASWLIVTVAAMAVLYAVVAAAASLRRRRPSHPARLNAP FT GAPLAPVSVLKPLCGLEPRLFENLATFCEQDHPCFELLCGVHSPNDPAIAVVERLQAAY FT PTCDIRLVVDPHVHGSNLKVSNLINLAARARYDTIVLADSDIAVQPHYLASVCAPLTDP FT AVGVVTCLYRAHGVGPWWTRLGAMFVNDWFAPSVRVAHAGGSTRFGFGSTLALRRQTLD FT TIGGFQRLKNCLADDYWLAEHARETGLATVLSDITVSTDVAESHFGALWRRETRWLRTI FT RSINPFGFGCLFVTFTSPWLIAAAALALVQPASQTLLGGVAAALAGIGLLARLALHWRG FT IDITGELARDHDARAVRPFLRDLPLVPLRDILLLGQWLSAAVGSHVDWRGSRVPLVGTP FT LPSRNRESL" FT CDS 486828..486965 FT /transl_table=11 FT /locus_tag="RBRH_00241" FT /db_xref="EnsemblGenomes-Gn:RBRH_00241" FT /db_xref="EnsemblGenomes-Tr:CBW76884" FT /db_xref="UniProtKB/TrEMBL:E5AUW0" FT /protein_id="CBW76884.1" FT /translation="MAATVTINQDARFAVAAITQYDACYLGNMRRFRLLWPVQAGPGQR FT " FT CDS complement(487053..487214) FT /transl_table=11 FT /locus_tag="RBRH_00240" FT /db_xref="EnsemblGenomes-Gn:RBRH_00240" FT /db_xref="EnsemblGenomes-Tr:CBW76885" FT /db_xref="UniProtKB/TrEMBL:E5AUW1" FT /protein_id="CBW76885.1" FT /translation="MRDAVVLAVLDTTPNHAYQDDESPSRSFVRGWDFSSRCSCCHYIE FT SLSSVVRF" FT CDS 487406..487654 FT /transl_table=11 FT /locus_tag="RBRH_00239" FT /db_xref="EnsemblGenomes-Gn:RBRH_00239" FT /db_xref="EnsemblGenomes-Tr:CBW76886" FT /db_xref="UniProtKB/TrEMBL:E5AUW2" FT /protein_id="CBW76886.1" FT /translation="MLTCAAHAARAAASDSASSPFVPGAIAGIVHGDRVDPSGDCQSRV FT LRCDAGAAMFGYCAASDAVSRLRAFNRCYASSPRARL" FT CDS complement(487649..489511) FT /transl_table=11 FT /locus_tag="RBRH_00238" FT /db_xref="EnsemblGenomes-Gn:RBRH_00238" FT /db_xref="EnsemblGenomes-Tr:CBW76887" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AUW3" FT /protein_id="CBW76887.1" FT /translation="MPSAGVKVIKCGELIFGDRSSGIRRQLRHRASSPPTLATSLCAHA FT AATHVCAASGALPSPRRLLVIGPGHGVAHPRQQAAHRALCSTTRRAKSADCGDPAALAD FT NGLSAKNLGIAAHNYVHPPAFSYLTAQHRFVLRVFNLLLNLRMDFDLNAALNNHQAYIC FT ALEACPQPAASAPPSLKPPSSALANTSASRPATYHDLPAKILQQVADHMPFDDIGNLST FT VNSQTYHALQEKRLSWLCRKRISHAGALDRTSVQQVLTEIERIGADSVRAELLQALWQR FT ARRQYKVKPEIFIAIFQAAGRVPKQGLQVQKYMIGTLPGIPIQYQRNLYRFVYADAERR FT APEQASTWGAIASMLPIYGYTPPSNLWLDAPQIESEYRALLSRLPALDASGQAELITAL FT ADVLGAFSLSFPSAQYHAYRYDIASATIIEWYETLFQWMQRLPASYRGAPIGALADRVS FT MLPEAHRPVHVAHLRHLTLSLPDHQLGSALRYLPGALVRAVPPEQHAHEISLLEPALER FT VPLAQRELAALGLLEATSQLDDALLKQVWQRAMRLLDGSNGPDIAETFYDIHLRIGLTL FT NNQQWESAKTEMKAFFKRNRFDQVTRDEMLNSRNYCWFHMYQTL" FT CDS complement(489545..489850) FT /transl_table=11 FT /locus_tag="RBRH_00237" FT /db_xref="EnsemblGenomes-Gn:RBRH_00237" FT /db_xref="EnsemblGenomes-Tr:CBW76888" FT /db_xref="UniProtKB/TrEMBL:E5AUW5" FT /protein_id="CBW76888.1" FT /translation="MELDEGTFYRRANHWDPAPGRGLHHLFCARWAAANSTSVRLLARS FT ITRTLLSHRWRSNRTRYTWQQRHERNNSSTGVGKRTGTRSGTGFMPASFPNGRSAR" FT CDS 490273..491721 FT /transl_table=11 FT /locus_tag="RBRH_00236" FT /product="NIFS PROTEIN" FT /function="NIFS PROTEIN" FT /note="NIFS PROTEIN" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: TfuA-like protein::PF07812" FT /db_xref="EnsemblGenomes-Gn:RBRH_00236" FT /db_xref="EnsemblGenomes-Tr:CBW76889" FT /db_xref="InterPro:IPR012924" FT /db_xref="UniProtKB/TrEMBL:E5AUW4" FT /protein_id="CBW76889.1" FT /translation="METSRPRRSQIGSIPLSTHQIAVFLGPSCPLDEARTHLADADYFP FT PAARGSFYDIINDGYQIIVLIDGFFYGKLSVWHKEILYALDSGIVVIGASSMGALRAAE FT LQGTGIIGAGTIFGWYRDGLIDGDDEVALLHESTQDNYTGLTIPLVNLRWQLMRAVEDG FT LIDSRSEALIIDRAKQMCFTERTLEGILEPLRDVIDIGAVKTTLSNGTDLKKSDAILAL FT KLAAEHRSSAGAPSSLRLREYEYAHMNLGIEYYTSERLTSIKAKGSAGAIPLAEYLGRT FT EADQIGYRDLIRARVCQRLIVGWARELHLDVGNEDDIGLGASPWNVQVLDLEHRRATGL FT TLIDIARESRDAEFSRRIQQRFCRTAGASQVIADIDKRLAAQVQDAPIPWRRMVDLTGD FT LVYTMCCLGLEKGIGPAPQEVQPCGARWEDDAILTDAERIMAYAEWIYQVGPRLFGYVL FT DPAREVLLAHQYLNCLDRLDRRAP" FT CDS 491718..492947 FT /transl_table=11 FT /locus_tag="RBRH_00235" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: YcaO-like family::PF02624" FT /db_xref="EnsemblGenomes-Gn:RBRH_00235" FT /db_xref="EnsemblGenomes-Tr:CBW76890" FT /db_xref="InterPro:IPR003776" FT /db_xref="UniProtKB/TrEMBL:E5AUW6" FT /protein_id="CBW76890.1" FT /translation="MTLSPATSHEYAQGTQRVCAPEETLRRIQPVLARCGITRVLDVTQ FT LDRIGIPTYNAIRPNGIILSISNGKGWSSAAAAVSAIMESIEVEHSEYPDTSSWRLATS FT ATALRTEGLDPVDPTTLIRDCLWPKDEYGGLYYTPELVLDWVEADELISGNKVMIPAST FT IYAVPPFLQYFTSNGLASGNTYAEAVLHAICEIVERDAIAKLMGRTKDSPPSRLRPIRL FT DSLPGHLVKLAELITSGGIELFLLSMPSAIDIYTFWTIFYCPGEPAFILSTSGGYGTHP FT DPVIAASRALTEAAQARLAHIHGAREDLGIDHVNRQLPASELEQRSALQVRSFDKFRTM FT PAWSWDEMLQVYPHRCKGRNIQGSLDQVLEMLAGAGSDKVYVHDLTKPDLDLAVTRVFI FT PGMKICASML" FT CDS 493017..493967 FT /transl_table=11 FT /locus_tag="RBRH_00234" FT /db_xref="EnsemblGenomes-Gn:RBRH_00234" FT /db_xref="EnsemblGenomes-Tr:CBW76891" FT /db_xref="UniProtKB/TrEMBL:E5AUW7" FT /protein_id="CBW76891.1" FT /translation="MWMPPVAERPSETPFGELLRLAELHPAWSLLQVIELLDRERWDIE FT TLTPAQRALYGRINARAALARLHGSVDDFQSGHALDAPARSPQWLATGRHLCVSGLLDA FT QTRARLVAQCDATLSVPGTPPIRLFSHPDCMDQAELRSIASAVLAALPDPLPPGTRPTI FT LKRRTILRRTFPPSRLPSQPGNANNQFWHQDSNAQFNDSPMLTLWIPLQDHAGVTRPGL FT QISDAPVANFSIFHGDSSHDIGPMLAQMFPASQIVSPQVAAGECLVFNGLTFHRTLATP FT AMAEHRDALLIRVLDQRTAHRFPVADHDQDLLPLA" FT CDS 493939..494898 FT /transl_table=11 FT /locus_tag="RBRH_00233" FT /db_xref="EnsemblGenomes-Gn:RBRH_00233" FT /db_xref="EnsemblGenomes-Tr:CBW76892" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:E5AUW8" FT /protein_id="CBW76892.1" FT /translation="MTRICCPLHELTVHVVGTGAVGLAYGYLLTERGHRVFHSSLRGRV FT TSALPLSLQTGTGTTHGCYTPRYWHDTPQASIPHVQIFAVHGAQLAPALQLCGGALAPQ FT ACHLVFCSNPDAVNAAWRRVAADSYTLVYPLLSAEHCGDQGLRIITNGEVEITLPQGKP FT IGERIALKALLERMGLTVSGDVPLSRFRARYLQTAAIYIALLAVSVGAIDHAQVDGALL FT SAIHDELAAMVERRDGARVADVPGQARHFASLAALIAAGERDGAMLGATLEYLVRDGRR FT KLTAHLAAITPAWDDHLAARPATASQRLISAVLALCRL" FT CDS 495006..495347 FT /transl_table=11 FT /locus_tag="RBRH_00232" FT /note="Pfam: ThiS family::PF02597" FT /db_xref="EnsemblGenomes-Gn:RBRH_00232" FT /db_xref="EnsemblGenomes-Tr:CBW76893" FT /db_xref="InterPro:IPR003749" FT /db_xref="InterPro:IPR012675" FT /db_xref="InterPro:IPR016155" FT /db_xref="UniProtKB/TrEMBL:E5AUW9" FT /protein_id="CBW76893.1" FT /translation="MISWDRQRHAWRAVMLSKLEEPRLNTVTVIVPPSMRKFLGGRTRV FT PVQAETVRGALDALAGGSDTLRGHLFDQTNAINRFVRVFVNGRQIHSSAEEPVSDGAEV FT TILVALAGG" FT CDS 495328..496506 FT /transl_table=11 FT /locus_tag="RBRH_00231" FT /product="Molybdopterin biosynthesis MoeB protein" FT /function="Molybdopterin biosynthesis MoeB protein" FT /note="Molybdopterin biosynthesis MoeB protein" FT /note="COG: Dinucleotide-utilizing enzymes involved in FT molybdopterin and thiamine biosynthesis family 2" FT /note="Pfam: MoeZ/MoeB domain::PF05237
Rhodanese-like FT domain::PF00581
ThiF family::PF00899" FT /db_xref="EnsemblGenomes-Gn:RBRH_00231" FT /db_xref="EnsemblGenomes-Tr:CBW76894" FT /db_xref="GOA:E5AUX0" FT /db_xref="InterPro:IPR000594" FT /db_xref="InterPro:IPR001763" FT /db_xref="InterPro:IPR007901" FT /db_xref="InterPro:IPR009036" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:E5AUX0" FT /protein_id="CBW76894.1" FT /translation="MRWREADMTLQQQRLAQLKAEITEIDPREAAQRLAAGAILLDIRD FT TDEWAQGTPVAAVRVGRSFLEQQIEGVVADPDTALMILCGSGVRSLFVADALKRLGYRS FT VASVAGGFQAWTECDLPVERPKILSATERERYARHLRIPEVGEAGQAKLLARRVALVGA FT GGLGSPIAYYLAAAGVGTLGLIDDDRIERSNLQRQILHTDARVGQSKARSAAETLTGFN FT PNVALVLHEVRLDSANAEAILADYDLVIDGSDNIATRYVVNDACVKHGIPMIYGAIFRF FT EGQVSAFHPAGPNGGPCYRCLFPEPPPRDLTPSCAEAGVLGVLPGVIGTLMATEALKIL FT LGIGEPLVGRLLTYDALSERFDELRLEASPDCRWCAPHRRDRPTLNIPALTE" FT CDS 496510..497160 FT /transl_table=11 FT /locus_tag="RBRH_00230" FT /note="Pfam: Methyltransferase FT domain::PF08241
Methyltransferase domain::PF08242" FT /db_xref="EnsemblGenomes-Gn:RBRH_00230" FT /db_xref="EnsemblGenomes-Tr:CBW76895" FT /db_xref="UniProtKB/TrEMBL:E5AUX1" FT /protein_id="CBW76895.1" FT /translation="MRTPIPPLPDAGPTAASSPLSVKQAFRFAPTDQGHIDQLLVWAEL FT PIGANVLDLGAGNGCVAARMRARRPDLSFCLVDQDRRALDAAGSTWHTHCADICNIPEP FT NGSFDALLCCYAMGYVPTADFFREAARVARRGAVVFIVDMVPLDGTLDSLSLFGYAIRG FT RTNVESHAASAGLKLDFYLEPTDDRSWGEAQFPGYFHILFGEVRPAIWRFTLP" FT CDS complement(497187..498362) FT /transl_table=11 FT /locus_tag="RBRH_00229" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: YcaO-like family::PF02624" FT /db_xref="EnsemblGenomes-Gn:RBRH_00229" FT /db_xref="EnsemblGenomes-Tr:CBW76896" FT /db_xref="InterPro:IPR003776" FT /db_xref="UniProtKB/TrEMBL:E5AUX2" FT /protein_id="CBW76896.1" FT /translation="MPTNLVTSMRLITATDTLSSIGPILAEYDIHGYAEHTPAGIASIR FT SIEVFRGNPRSGYLNLGKGFGFDAALASGYMEAIEVSTIEQAPQVPVLSTGDLAPVSLV FT YTAARKAAQRAGMLDDKERHRPVIGGVDLLTSMQVYGYVDENFLPQQWGGERLHLSTDG FT LASGNSLAEARLHAIYELLERHVAASSLRALGQVLSIALEDIPLTLRKALDEIEQAGWR FT SEFFLLGWTLGVTVIQCALSPLTAAKAGRSDVHFGWGAHHSLSIAVARALAEAVQGWAT FT RAACQLGNIPPARMKGGMLLSSEQLMGLKSGSPVGEQILHAHLRACRSAPASLGEADEG FT TLAAAPVALEQVLSLAREAGISHVLSWTLSPPHRPFAVVKCVIPEFESLFS" FT CDS complement(498439..498672) FT /transl_table=11 FT /locus_tag="RBRH_00228" FT /note="Pfam: Nitrogen fixation protein of unknown FT function::PF07862" FT /db_xref="EnsemblGenomes-Gn:RBRH_00228" FT /db_xref="EnsemblGenomes-Tr:CBW76897" FT /db_xref="InterPro:IPR012903" FT /db_xref="InterPro:IPR022516" FT /db_xref="UniProtKB/TrEMBL:E5AUX3" FT /protein_id="CBW76897.1" FT /translation="MSSIQQFRTKLESDPEFVKKIKNCANSSEIISVAQAEGISLSEAD FT LAKALVNSDTDLTDEELESVSVGTPMAAALIK" FT CDS 498857..502003 FT /transl_table=11 FT /locus_tag="RBRH_00226" FT /product="Serine (threonine) dehydratase (lantibiotic FT biosynthesis) / Lanthionine synthetase (lantibiotic FT biosynthesis)" FT /function="Serine (threonine) dehydratase (lantibiotic FT biosynthesis) / Lanthionine synthetase (lantibiotic FT biosynthesis)" FT /note="Serine (threonine) dehydratase (lantibiotic FT biosynthesis) / Lanthionine synthetase (lantibiotic FT biosynthesis)" FT /note="COG: Lantibiotic modifying enzyme" FT /note="Pfam: Lanthionine synthetase C-like FT protein::PF05147" FT /db_xref="EnsemblGenomes-Gn:RBRH_00226" FT /db_xref="EnsemblGenomes-Tr:CBW76898" FT /db_xref="InterPro:IPR007822" FT /db_xref="InterPro:IPR017146" FT /db_xref="InterPro:IPR025410" FT /db_xref="UniProtKB/TrEMBL:E5AUX4" FT /protein_id="CBW76898.1" FT /translation="MENANMSFRSPPLPLSPPWQTALAGEAPFPNTDDDACREILAQLC FT EAIKASSSSAWHLEDVALSASGQQLPFVDLWRPAVNAALAWLHLRVDASLGAPPAAPAD FT RDLADTLLARLCLLSQYAVWELFKADCGVGMAVCACFGVDDDRSGPPSRERYRSFIQQH FT RSDGLARLLGDFPVLGRLLAQTVMFWLDSSAEILLRVHDDRQVLLAEFGIPVHARLVRI FT GQDSGDRHRHGRTVAMLGFSDNRQEWKVVYKPRDMAIDFAFQRLLGDRDVIAHLPALAS FT LKVLPRAGYGYMEVAMHHPCADEQALSLFYLHAGRLCAILYVLGCTDGHHENLIASSTN FT LFLIDAETLFEPVVRADLRAVSRPDSVLLGSALQARFEESVARTELFPVWLLVSTQRQA FT IDTSAFGVASSALECRPVSGWRNINCDAMTFGTVDVLDQQPASLPVGRGQANPFACHLA FT TFSEGFRLQGSVIIRQRDAWLKTGGILDRFAGLTGRVVLRATRIYSAIGQQQLQAGALR FT SAHAQRLTLEPLARLFSTSASPLENWSALAAERSQMAQLDIPYFTHRLDQNCLLLGTGE FT RAIEGYFEANGLDDCRRRLQSLDLDVIEFQLLVIDGLVAAKTLRAHAGPVGERASPTPQ FT ARPLSPDERLHMVRSVAADLVGRIFDDRPEWLGFDMARDGRRFHFRPLGLSPYSGTLGI FT AAFFACLAGSPLAQSSRFGLDVWVKRMIQPLEVLAGQPGAALSRWWRDQPLGLAGCGGQ FT LLALMAICATNIAPSAASAGRELASRLLEGLDERWLTNAALDLIEGATGLVGPLLMLDS FT DNALRIAMTIGDRLVHDACAWYPMTDAQRGLAPHSPGFVAGASGMIAALTRLHHHTGVN FT RYRDCAQRLLTHDRSTLGIGNDGWESRFSLALGGNDALHHSWCHGLAGVALGRLSMFET FT ELWEATAERELDAILASLCAAASPADHVCCGQFGAIAVLRIAQDMLRKRACESHAEQLE FT AAAVMGMIRDRNHLAVRSHGPGKHHLGLMNGLSGIGLVLTDNRVSRAMLKTLLGGGLLG FT " FT CDS complement(502046..502663) FT /transl_table=11 FT /locus_tag="RBRH_00225" FT /db_xref="EnsemblGenomes-Gn:RBRH_00225" FT /db_xref="EnsemblGenomes-Tr:CBW76899" FT /db_xref="UniProtKB/TrEMBL:E5AUX5" FT /protein_id="CBW76899.1" FT /translation="MPHTPIMLADGRKKVRPPKSSAVDELLEGVSDPVLRARINLLIAD FT LESTRAQLLAARHLASKNSVLVLSGPEALATAPAQPDAALTPQEKKSFAAAISEKTLEH FT WGWLIDSNGRVLTNRGQVVFGAGFVTTIYSQRTASGRILNEQVYILVARDRARQTLDFV FT PSKGPVTAQQLHEHLFPRLAPHVQNVNTYYSRLRDDCAWFSC" FT CDS complement(503222..503863) FT /transl_table=11 FT /locus_tag="RBRH_00224" FT /db_xref="EnsemblGenomes-Gn:RBRH_00224" FT /db_xref="EnsemblGenomes-Tr:CBW76900" FT /db_xref="UniProtKB/TrEMBL:E5AUX6" FT /protein_id="CBW76900.1" FT /translation="MSRGKRRACRNHKLSPRNCALPHRCLHHSPACGTPGQANPCALLD FT RERRRGPLRADGDGRVCGVSALDASAPESWIIGDLGICPVSGSKCHQGGPVQHSAASKP FT YYSPGLGGAKNCVRCRFFITGPAFLGGLVARFNAEVPSDNTGSLTRAYERRDRVLDEGD FT GIAHIWHAIYWLVERCRATLTAPTEGKQQVKLVLAGGVEDLQAALSECSE" FT CDS complement(503856..503963) FT /transl_table=11 FT /locus_tag="RBRH_04265" FT /db_xref="EnsemblGenomes-Gn:RBRH_04265" FT /db_xref="EnsemblGenomes-Tr:CBW76901" FT /db_xref="UniProtKB/TrEMBL:E5AUX7" FT /protein_id="CBW76901.1" FT /translation="MIMAEIRFARLVSLDLKVETSASAEATLNMLACVE" FT CDS complement(504289..505350) FT /transl_table=11 FT /locus_tag="RBRH_00221" FT /product="Lipopolysaccharide heptosyltransferase-1 (EC FT 2.-.-.-)" FT /function="Lipopolysaccharide heptosyltransferase-1 (EC FT 2.-.-.-)" FT /EC_number="2.-.-.-" FT /note="Lipopolysaccharide heptosyltransferase-1 (EC FT 2.-.-.-)" FT /note="COG: ADP-heptose:LPS heptosyltransferase" FT /note="Pfam: Glycosyltransferase family 9 FT (heptosyltransferase)::PF01075" FT /db_xref="EnsemblGenomes-Gn:RBRH_00221" FT /db_xref="EnsemblGenomes-Tr:CBW76902" FT /db_xref="GOA:E5AUX8" FT /db_xref="InterPro:IPR002201" FT /db_xref="InterPro:IPR011908" FT /db_xref="UniProtKB/TrEMBL:E5AUX8" FT /protein_id="CBW76902.1" FT /translation="MKRILVVKVTSLGDIVQAQPVVWDLRRAFPEARIDWAADEAFADV FT VRWNPGVDRVLCAPLRRFKKARNLDDLRAIIASIRMLRSERYDLVLDIHGVYKSAIIAF FT IARSRRRYGYCRENLGEAGAAFAYTDRFDRRHSLNAWYAMRRSVGDALGYSVEGRPHFG FT LKLPPALPLSAIGDSGRRAMLFHATSTDVKKWPVGHWIDVARALAARGLQVLLPWGSER FT EHDEACRIAAGVPQAQVLPKLTVTECAQFIEASELVVGMDTGFVHLAYALDKPTVMIFT FT ATSRSHFGIDIPGRATSVGDEGSPPAVRDVLAAIDSVYPRGVVSTISTGSRVESIVAVK FT SCPVIIPFRHEAA" FT CDS complement(505623..505961) FT /transl_table=11 FT /locus_tag="RBRH_00219" FT /product="Acetyltransferase, GNAT family" FT /function="Acetyltransferase, GNAT family" FT /note="Acetyltransferase, GNAT family" FT /note="COG: Acetyltransferases, including N-acetylases of FT ribosomal proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_00219" FT /db_xref="EnsemblGenomes-Tr:CBW76903" FT /db_xref="GOA:E5AUX9" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUX9" FT /protein_id="CBW76903.1" FT /translation="MHMVCTWYATWYLRAPVKQYQRTAVNTEAKLLLLTHAFERLDAIA FT VEFRTRYVNTAARSAILQLGTRQDGNLRNHPLAADGSYRDTVVLSISGSEWMAVRNDLR FT VWLQRDPA" FT CDS complement(505990..506199) FT /transl_table=11 FT /locus_tag="RBRH_04266" FT /db_xref="EnsemblGenomes-Gn:RBRH_04266" FT /db_xref="EnsemblGenomes-Tr:CBW76904" FT /db_xref="InterPro:IPR016181" FT /db_xref="UniProtKB/TrEMBL:E5AUY0" FT /protein_id="CBW76904.1" FT /translation="MAILAVDDSHTAPDRLTRIAMESWIHPVTLSGQAIVLELLSLDYV FT DALEEAVTDRRLWEWWALRGCTDA" FT CDS 506246..507478 FT /transl_table=11 FT /locus_tag="RBRH_00218" FT /product="Phosphoesterase" FT /function="Phosphoesterase" FT /note="Phosphoesterase" FT /note="COG: Predicted phosphohydrolases" FT /note="Pfam: Calcineurin-like phosphoesterase::PF00149" FT /db_xref="EnsemblGenomes-Gn:RBRH_00218" FT /db_xref="EnsemblGenomes-Tr:CBW76905" FT /db_xref="GOA:E5AUY1" FT /db_xref="InterPro:IPR004843" FT /db_xref="UniProtKB/TrEMBL:E5AUY1" FT /protein_id="CBW76905.1" FT /translation="MRRYSFLIRIIAIGILMHLYVGVRLVPVLPGGPAVCNAAVAYLGL FT SVILILFGMLAQAIERQPLSDWLAWAGMLAMGFFSSLLVLTFARDVALLFVHVLDAALA FT AHWPLEQWQRDSAPVVPALALLASFAGFVNARRRAGVVTVQVPIDGLPDALDGFTIAQI FT SDIHVGPTIKRGYVEAIVEAVNTLRPDLIAITGDIVDGRVEQLAPHTQPLGQLQARHGV FT FLVTGNHEYYCSAHAWIDEFKRLGLTVLMNQHVVIGHGTACVVVAGVTDYSAGHFDAAH FT ASDPAGALRGAPPHAAVRILLAHQPRTASAAVQAGYTLQLSGHTHGGQFFPWNFFVRLQ FT QPFTAGLHRLSQLWVYTSRGTGYWGPPKRIGAPSEITLVRLVPARAGSRAPAPPGSSVA FT RAARPPSPRSH" FT CDS 507655..507909 FT /transl_table=11 FT /locus_tag="RBRH_04267" FT /db_xref="EnsemblGenomes-Gn:RBRH_04267" FT /db_xref="EnsemblGenomes-Tr:CBW76906" FT /db_xref="UniProtKB/TrEMBL:E5AUY2" FT /protein_id="CBW76906.1" FT /translation="MCDSDQKTAVFGMEACSRMDILELAKQSGFFVTLDGKIGHEQYQS FT VHGSVTALERFAEAVRTEADHDRHEKCAVTPQPGTRQTG" FT CDS 507867..507962 FT /transl_table=11 FT /locus_tag="RBRH_04268" FT /db_xref="EnsemblGenomes-Gn:RBRH_04268" FT /db_xref="EnsemblGenomes-Tr:CBW76907" FT /db_xref="UniProtKB/TrEMBL:E5AUY3" FT /protein_id="CBW76907.1" FT /translation="MRSDAPTGDTPNRMTRRTTARPRIAAERKGV" FT CDS 507985..508224 FT /transl_table=11 FT /locus_tag="RBRH_04269" FT /db_xref="EnsemblGenomes-Gn:RBRH_04269" FT /db_xref="EnsemblGenomes-Tr:CBW76908" FT /db_xref="UniProtKB/TrEMBL:E5AUY4" FT /protein_id="CBW76908.1" FT /translation="MTARASTMAAPQTTATTPLVWVSKLLPAICGGRPPRQGDRHAWMR FT RAKRPGRSHSTARRAAEPSGAAAPAGAGTGFSLY" FT CDS complement(508275..508985) FT /transl_table=11 FT /locus_tag="RBRH_00215" FT /product="Glycerol uptake facilitator protein" FT /function="Glycerol uptake facilitator protein" FT /note="Glycerol uptake facilitator protein" FT /note="COG: Glycerol uptake facilitator and related FT permeases (Major Intrinsic Protein Family)" FT /note="Pfam: Major intrinsic protein::PF00230" FT /db_xref="EnsemblGenomes-Gn:RBRH_00215" FT /db_xref="EnsemblGenomes-Tr:CBW76909" FT /db_xref="GOA:E5AUY5" FT /db_xref="InterPro:IPR000425" FT /db_xref="InterPro:IPR022357" FT /db_xref="InterPro:IPR023271" FT /db_xref="UniProtKB/TrEMBL:E5AUY5" FT /protein_id="CBW76909.1" FT /translation="MTHALIAELIGTALLVLLGDGVVANVILARTKGHNSGLIVIAIGW FT AMAVFVGIVCSAAYSGAHLNPAVSVALAVAGKFAWAKVPAYVAVQMLGGMFGAFLVWLV FT YRKHFESTDCPDTKLAVFCTGPAIRNTLGNLTSEIVATFVLVYAVLHMAAPSVGLGAIN FT ALPVALLVLGIGVSLGGTTGYAMNPARDLSPRIMHALLPIPGKRDSDWGYAWVPVAGSL FT IGGVLAAVVCVLQG" FT CDS complement(509007..510542) FT /transl_table=11 FT /locus_tag="RBRH_00214" FT /product="Glycerol kinase (EC 2.7.1.30)" FT /function="Glycerol kinase (EC 2.7.1.30)" FT /EC_number="2.7.1.30" FT /note="Glycerol kinase (EC 2.7.1.30)" FT /note="COG: Glycerol kinase" FT /note="Pfam: FGGY family of carbohydrate kinases, FT C-terminal domain::PF02782
FGGY family of carbohydrate FT kinases, N-terminal domain::PF00370" FT /db_xref="EnsemblGenomes-Gn:RBRH_00214" FT /db_xref="EnsemblGenomes-Tr:CBW76910" FT /db_xref="GOA:E5AUY6" FT /db_xref="InterPro:IPR005999" FT /db_xref="InterPro:IPR018483" FT /db_xref="InterPro:IPR018484" FT /db_xref="InterPro:IPR018485" FT /db_xref="UniProtKB/TrEMBL:E5AUY6" FT /protein_id="CBW76910.1" FT /translation="MQRSTTAKPTETVMEGKYVLALDQGTTSSRAIVFDRGGNIVSTAQ FT KEFRQIYPQPGWVEHNPQEIWSTQAGVAAEAVVRAGLNGGSIHALGITNQRETTIVWDR FT ETGLPIYNAIVWQDRRTADFCAELKARGLEGAVRAKTGLPIDAYFSATKIRWILDNVAG FT ARERAKQGKLAFGTVDSWLIWNFTRHNTHATDVTNASRTMLFNIHTLDWDDELLAELDI FT PRSMMPQVKPSSGLYDATKTTVFASRIPIAGVAGDQHAALFGQMCITPGMVKNTYGTGC FT FLVMNTGDKPIESRNNLVTTIAWQIDGKTTYALEGSIFIGGAVVQWLRDGLGIIKQAAD FT IEALAASVPHSDGVFLVPAFAGLGAPHWNPHARGTLFGATRGTTAAHIARAALDSIAHQ FT SFDVLKAMEADAGQPITELRVDGGAVENNLLMQFQADILGVDVVRPRVTETTALGAAYL FT AGLATGYWDGIDEVRDQWQLDRRFIPALESEETARHRAGWQRAVSAAMMWAAA" FT CDS complement(510846..511298) FT /transl_table=11 FT /locus_tag="RBRH_00213" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_00213" FT /db_xref="EnsemblGenomes-Tr:CBW76911" FT /db_xref="GOA:E5AUY7" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUY7" FT /protein_id="CBW76911.1" FT /translation="MCFANESVEDGVGERKEARRIEACLTKHPLVREAVVAAVGDGADK FT RLVAYVVVDPSESLPATLCAHVAGALPDYMVPSAFLRLDAFALTPNGKIDRPPGVPMCW FT GRSRPMTSRARTTIWTGRARRRKSAACCGKSSTNCMARRRRSAAGW" FT CDS complement(511320..511793) FT /transl_table=11 FT /locus_tag="RBRH_00212" FT /db_xref="EnsemblGenomes-Gn:RBRH_00212" FT /db_xref="EnsemblGenomes-Tr:CBW76912" FT /db_xref="UniProtKB/TrEMBL:E5AUY8" FT /protein_id="CBW76912.1" FT /translation="MSNSPRLMQQGSEAETVWWGQVCILVKPNVRRIWPRVKRESMRRV FT NVLIQSTCLVDAWPCQLRFARQGCLNENQLALVCGKRLDIPYFCAPRLPSRLAGYAYST FT ESEQRFHAKATTDSTRIRPLNAQRGEHVKRGDARLYVFTPRSPCWSNHSGACA" FT CDS complement(511808..531583) FT /transl_table=11 FT /locus_tag="RBRH_01792" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550
Thioesterase domain::PF00975" FT /db_xref="EnsemblGenomes-Gn:RBRH_01792" FT /db_xref="EnsemblGenomes-Tr:CBW76913" FT /db_xref="GOA:E5AUY9" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AUY9" FT /protein_id="CBW76913.1" FT /translation="MTREGIGGLTPLKSNKSLIKFGVHVMSAGAISLTTYPLSSAQTEI FT WLAQQLHSGSPVYNIAQYTVIEGAIDPTVFEAALRQVIDEADSLRLQFVESEAGLRQRI FT GSPAWSMPVLNLTAEAESQAVAQAWMRTDYEEPVDLMQGPLFQYALLKVAPKQWIWYQR FT YHHIMMDGYGAVLIAQRVAQVYSALCAEREPAPCTFGSVLKLLESDAQYRASAQREKDE FT AYWLKHCAHWPVPATLAGRAAPALQHRLRQTAYLATQALGDAASDVGRLAQFLTAALAT FT YLHRMTRAQDVALGLPVTARLGANRHIPGVVSNTVPLRFTFEAKMTLASLLQQATQIQR FT GFRYQRYPSEALRRKLELMPGQALFGATVNVMPFDYDLSFDGYPSSNHNLLNGPVEDLM FT LAVYWTPDNPQLRIDFDVNPACYTAEELEAHRCRFVRFMQALAADVTQPIGEIDLLDTE FT ERHRLLIEWNATQQDYPAHQCIHQLFEAQVEHTPEAMALVYEEQTLSYAELNARANRLA FT HQLIELGVMPDARVAICVQRSPAMVVGLLAILKAGGAYVPLDPSYPGERLAHILADAAP FT NIVLADAAGRAALGGAALTDRTVLDPNWLPAQAETNPVVPDLASRHLAYVIYTSGSTGM FT PKGVMVEHRSIARLVINNGYLDVGAADRVALAANPAFDASTFEVWAPLLNGAAAVVISR FT DTVLNPAAFAQTLQEQRISILWLTVGLFNQLFIELGPVFPQLKALIVGGDALDANVVAQ FT VLQGTPPQQLINGYGPTESTTFTTTYRIDAIREDTLSIPIGRPIANTQIYLLDAYKQPV FT PLGAVGELYIGGAGVARGYLNRPELTAERFVRDPFVDEADARMYKTGDLARYLPDGNLE FT FLGRNDHQVKIRGFRIELGEIEACLAQHAQVRDAVVLAVGEGPDKRLVAYVVAEPDDAL FT AGMLRTHVAAALPEYMVPSAFVRLDALPLTPNGKLDRRALPAPSADAFAHQAYEAPQGE FT LEIMLAEIWTELLGVEPVGRHDNFFALGGHSLLAVRLMNRVAALGITLPLATLFAAPTL FT AGLAAVLEAQRASDGAALPAITPVSRDGALPLSFAQQRLWFFAQLGGASDTYHMPMALR FT LRGTLNRVAWQQALDVLWARHEALRSVFISVEGQPQVQLLPAEAGMPMTWHDLRGVSDA FT ATQLAQLSAEAAQAPFDLACGPLMRACGIQVADDEYVMLLVQHHIVSDGWSVGVLVREL FT NTLYRAACDGQTDPLPALTIQYPDYAAWQRQWLSGERLKAQSEYWRTQLADAPVLLTLP FT TDRPRPAQQSFEGAYVPIQIDALTTQALKRWSQAQGATLFMTVLAAWSAVLARLSGQED FT LVIGTASANRHHPQIEPLIGFFVNTLALRMDVSGEPSAAQLLERVRRTTLGAQAHQDVP FT FEQVVEIVQPPRRLDHTPLFQVMFAWQSNERAVWDLPEVEVTPADWAYDVVKFDLDLHL FT YESGEEMVGALGYATALFDRATIERHIGYLQTTLQAMAADASHPVTRVELLSPAERTLL FT LQTWNTTQRDYPAHQCIHQLFEAQVEHTPEAMALVYEEQTLSYAELNARANRLAHQLIE FT LGVMPDARVAICVQRSPAMVVGLLAILKAGGAYVPLDPSYPGERLAHILADAAPNIVLA FT DAAGRAALGGAALTDRTVLDPNWLPAQAETNPVVPDLTSRHLAYVIYTSGSTGTPKGVM FT VEHRGVVNLAQAQIACFDVHATSRIVQFASFSFDASVFEIFMALGCGASLHLPSDGVRY FT DRYRLWQYLTECGITHVTLPPALLQEGRDLPRLNQPLTAILAGEAPSVALFHNLMNQGV FT VVFNAYGPTETTVCVSAWRGLNLFNGKVLPIGRPLANTRVYLLDAHGQPVPLGAVGELY FT IGGAGVARGYLNRPELTAERFVRDPFASEPDARMYKTGDLARYLPDGNLEFLGRNDHQV FT KIRGFRIELGEIETCLVQHAQVHEAVVLAMGEGQDKRLVAYVVTEPDEQLANTLRTHVA FT AVLPEYMVPSAFVRLDALPLTPNGKLDRRALPAPSADAFAHQAYEAPQGELEIMLAEIW FT TELLGVEPVGRHDNFFALGGHSLLAVRLMNRVAALGITLPLATLFAAPTLAGLAAVLEA FT QRASDGAALPAITPVSRDGALPLSFAQQRLWFFAQLGGASDTYHMPMALRLRGTLNRVA FT WQQALDVLWARHEALRSVFISVEGQPQVQLLPAEAGMPMTWHDLRGVRDAEAQLVRLSA FT EAAQVPFDLTCGPLMRACGVQLANDEYVMLLVQHHIVSDGWSIGVLARELNTLYRAACD FT GQADPLPALTIQYPDYAAWQRQWLSGERLQAQSEYWRTQLADAPVLLTLPTDRPRPAQQ FT SFAGACVPIRIDAQTTRKLKRLSQAQGATLFMTVLAAWSAVLARLSGQEDLTIGTASAN FT RHHPQIEPLIGFFVNTLALRLDVSGEPSAAQLLERVRRTTLGAQAHQDVPFEQVVEIVQ FT PPRRLDHTPLFQVMFVWQSNERAVWDLPEVEVTPVDWAYDVAKFDLNLHLSEAGGEMVG FT VLHYATALFDCATIERHIGYLQTMLQAMAADASHPVTRVELLSPAERTLLLQTWNATQR FT DYPAHQCIHQLFEAQVERTPEATALVYENQTLSYAELNDKANQLAHYLRALDVGPEVVV FT GLCAERSLEAIIGLLGILKAGGAYLPLDPSHPAERLASMLRQASVAVLVTQSHLEARLP FT EIQARRIDLDTDWAKIAACPKTRLDSGVTAEHLAYMIYTSGSTGQPKGVMHSHRGVVNY FT LSFLTRHYAITCADTILNITGLAFDPCVRDLFGPLTAGARVIILPNEQAKEPGRYLSAI FT RERSVTKLLSITPSFLRSLCETVPAGPIASSLNTILTSGEPLEASVCEQVHKAFGLQVT FT VVNQYGPSECTMASTWFKADAQQEGRVPIGRPVPNVRVYVLGRHLEPLPIGVTGELYIA FT GAGVARGYINQPELSAERFIPSPFGPGERLYRTGDLARWRLDGQLEYIGRLDQQIKIRG FT FRIEPGEIEAALVKHPSIAQSVVVSREDHPGDRRLVAYWVAADGGAMTPVELKAYLSQT FT LPDYMVPVAFVQLDTLPLTLSGKLNQRALPAPDSAAFALQVYEAPQGELETTLAAIWSE FT LLSVKRVGRHDNFFALGGHSLLAVRLMNRVAALGITLPLATLFAAPTLAGLAAVLEARA FT SDSAALPAITPVSRDGALPLSFAQQRLWFFAQLDSASDTYHMPMALRLRGTLNPIAWQQ FT ALDALWARHEALRSVFVSVDGQPQVQLLPAETGMPMTWHDLRGVSDAATQLVQLSAEAA FT QAPFDLACGPLMRACGIQVADDEYVMLLVQHHIVSDGWSVGVLVRELNTLYRAACDGQT FT DPLPALTIQYPDYAAWQRQWLSGERLKAQSEYWRTQLADAPVLLTLPTDRPRPAQQSFE FT GAYVPIQIDAQTTQALKRWSQAQGATLFMTVLAAWSAVLARLSGQEDLVIGTASANRHH FT PQIEPLIGFFVNTLALRMDVSGEPSATQLLERVRRTALEAQAHQDLPFEQVVEIVQPPR FT RLEHTPLFQVMFVWQSNERAVWDLPEVEVTPAKWAYDVVKFDLDLHLYESGEEIVGALG FT YATALFDRATIERHIGYLQTTLQAMAADASHPVTRVELLSPAERTLLLQTWNATQRDYP FT AHQCIHQLFEAQVARTPEATALVYEDQTLSYAELNARANRLAHQLIELGVVPDARVAIC FT VQRSPALVVGLLAILKAGGAYVPLDPTYPSERLAHILVDAAPSIVLADAAGRAALGEAA FT LAECTVLDPATVPALPDTNPSVASLTSRHLAYVIYTSGSTGVPKGVMVHHQGVVRLVRN FT TDYIKVEPGAVFALASNLAFDATTFEIWTPLLNGARIEVIERETLLSPAMLSRKLKQSG FT VTVLFLTTALFNQMVKEKVEAFSDLHYLLFGGENADPRCVFRVLQQAKPRHLLHVYGPT FT ETVTYASWYEVSNVKQDTSIPIGRPIANTRIYLLDRYGQPVPLGAVGELYIGGAGVARG FT YLNRPELTAERFVHDPFASEPDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIEL FT GEIETCLAQHTQVRDAVVLATGEGQDKRLVAYVVADPDDALAGTLRTHVAAALPEYMVP FT SAFVRLDALPLTPNGKLDRRALPAPSADAFAHQAYEVPQGELETTLAAIWSELLSVNRV FT GRHDNFFALGGHSLLAVRLMNRVAALGIALPLATLFAAPTLAGLAAVLEAQRASDGAAL FT PAITPVSRDGALPLSFAQQRLWFLAQLDGGSDTYHMSMALRLRGALNRVAWQQALDALW FT ARHEALRSVFISVEGQPQVQLLPAEAGMPMTWHDLRGVSDAATQLAQFSAEAAQAPFDL FT ACGPLMRACGIQVADDEYVMLLVQHHIVSDGWSVGVLVRELNTLYRAACDGQTDPLPAL FT TIQYPDYAAWQRQWLSGERLKAQSEYWRTQLADAPVLLTLPTDRPRPAQQSFEGAYVPI FT QIDAQTTQALKHWSQAQGATLFMTVLAAWSAVLARLSGQEDLVIGTASANRHHPQIEPL FT IGFFVNTLALRMDVSGEPSATQLLERVRRTALEAQAHQDLPFEQVVEIVQPPRRLDHTP FT LFQVMFAWQSNERAVWDLPALEVTPADLAYDVAKFDLDLHLYEAGGEIVGALGYATALF FT DRATIERHVGYLQTMLQAMAADAAYPVTRVELLSPAERTLLLQTWNATQRDYPAHQCIH FT QLFEAQAERMPEAIALVYEDQALSYTELNARANRLAHQLIELGVVPNARVAICVQRSPA FT MVVGLLAILKAGGAYVPLDPSYPGERLAHILMDAAPDIVLADAAGQVALGDAALAHRTV FT LDPNRLPAQRETNPSVPALTSRHLAYVIYTSGSTGIPKGVMVEHAQTVNFLFWALQTFT FT SAETQHTLLATSISFDLSIYECFVPLAQGSTVHLVEDALALMHHAQPVSLINTVPSALQ FT SLLAHQADLSSAVTINMAGEPLKASLIKQVFEKTPVQRLCNLYGPSESTTYSTWLSIQR FT GAPFIESIGRPIANTRIYLLDRYGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVH FT DPFASEPDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIETCLAQHTQVR FT DAVVLATGEGQDKRLVAYVVADPDDALAGTLRTHVAAALPEYMVPSAFVRLDALPLTPN FT GKLDRRALPAPSADAFAHQAYEVPQGELETTLAAIWSELLSVNRVGRHDNFFALGGHSL FT LAVRLMNRVAALGIALPLATLFAAPTLAGLAAVLEAQRASDGAALPAITPVSRDGALPL FT SFAQQRLWFLAQLDGGSDTYHMPMALRLRGTLNPIAWQQALDALWARHEALRSVFVSVD FT GQPQVQLLPAEAGMPMTWHDLRGVSDAATQLVQLSAEAAQAPFDLACGPLMRACGIQVA FT DDEYVMLLVQHHIVSDGWSVGVLVRELNMLYRAACDGQTDPLPALTIQYPDYAAWQRQW FT LSGERLKAQSEYWRTQLADAPVLLTLPTDRPRPAQQSFAGAHVPIRIDAQTTRELKRLS FT QAQGATLFMTVLAAWSAVLARLSGQEDLVIGTASANRHHPQIEPLIGFFVNTLALRMDV FT SGEPSATQLLERVRRTALEAQAHQDLPFEQVVEIVQPPRRLDHTPLFQVMFVWQSNERG FT TWALPGLEVTSAGRDHEVAKFDLNLHMHEVGGEMIGVLHYATALFDHATIERHVGYLQT FT MLQAMAADTSHPVTRVDLLSPAERTLLLQTWNATQRDYPAHQCIHQLFEAQAERMPEAI FT ALVYEDQALSYTELNARANRLAHQLIELGVVPNARVAICVQRSPAMVVGLLAILKAGGA FT YVPLDPSYPGERLAHILMDAVPDIVLADAAGRAALGGAALAECTVLDPNRLPAQAETNP FT VVPDLTSRHLAYVIYTSGSTGVPKGVMVHHQGVVRLVRNTDYIKVEPGAVFALASNLAF FT DATTFEIWTPLLNGARIEVIERETLLSPAMLSRKLKQSGVTVLFLTTALFNQMVKEKVE FT AFSDLHYLLFGGENADPRCVFRVLQQAKPRHLLHVYGPTETVTYASWYEVSNVKQDTSI FT PIGRPIANTRIYLLDRYGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVHDPFASE FT PDARMYKTGDLARYLPDGNLEFLGRNDHQVKIRGFRIELGEIEACLAQHTQVRDAVVLA FT TGEGQDKRLVAYVVADPDDALAGTLRTHVAAALPEYMVPSAFVRLDALPLTPNGKLDRR FT ALPAPSADAFAHQAYEAPQGELETTLAQIWSELLGVEQVSRHDNFFALGGHSLLAVQMI FT SRSRTALGISIPMPVLFEAPTLAALAQRVSAQENVRDESFAVLLPIQPHGARPALFCVH FT PVTGLSWHYRGLVSHLEADQPVYGLQARGLDGGSSPALTIEAMALDYIQQIRCIQPHGP FT YYLLGWSFGGKVVHSMATQLEQQGERVALLAVLDATPGHVQLDNKPELAEDDFYHLFVR FT HAVGSLSETGHYLWDKTRAVFQNNVQLAQRFSPRICGGDMLFFRAAVAQNAWTQPISPE FT VWQPYVLGNIEVHDIACQHYDMELPVPTAHIGRILRQKLNMLQGEQKSDNKEETLI" FT CDS 532648..533094 FT /transl_table=11 FT /locus_tag="RBRH_01793" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_01793" FT /db_xref="EnsemblGenomes-Tr:CBW76914" FT /db_xref="UniProtKB/TrEMBL:E5AUZ0" FT /protein_id="CBW76914.1" FT /translation="MCNARHVEQQAPEYTQSTDDALRTCRVVAIAPRSKCRFGAFTART FT ERIVDKDLPKAFRFCRTPSTPHGQKQTIPTSPLTMVGGDAEALRHAYHYGTLLVDLEKC FT RPLDLLPERNATTGTSRLSGHHAVQWVSRDRAGVYAKGVTRGAP" FT CDS complement(533850..534092) FT /transl_table=11 FT /locus_tag="RBRH_01795" FT /db_xref="EnsemblGenomes-Gn:RBRH_01795" FT /db_xref="EnsemblGenomes-Tr:CBW76915" FT /db_xref="UniProtKB/TrEMBL:E5AUZ1" FT /protein_id="CBW76915.1" FT /translation="MLQWGPVCQAWCFMAAAREGTRRNLHARHTLGRECGLLEHWQGAP FT GIGGGAGGAVRGAAAAWPWVWEGSWLALGSTDTGF" FT CDS 534062..535162 FT /transl_table=11 FT /locus_tag="RBRH_01796" FT /product="DNA topoisomerase I (EC 5.99.1.2)" FT /function="DNA topoisomerase I (EC 5.99.1.2)" FT /EC_number="5.99.1.2" FT /note="DNA topoisomerase I (EC 5.99.1.2)" FT /note="COG: Topoisomerase IB" FT /db_xref="EnsemblGenomes-Gn:RBRH_01796" FT /db_xref="EnsemblGenomes-Tr:CBW76916" FT /db_xref="GOA:E5AUZ2" FT /db_xref="InterPro:IPR001631" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013500" FT /db_xref="InterPro:IPR014711" FT /db_xref="InterPro:IPR027362" FT /db_xref="UniProtKB/TrEMBL:E5AUZ2" FT /protein_id="CBW76916.1" FT /translation="MPGTPAPTATQATPRRRQRPAPDADACEQLRYVSDTQPGYTRRAV FT NGRFAYFDTRGTRIRDRARIERINALAIPPAYTDVWICPDPYGHLQATGRDARGRKQYR FT YHAAWRMMRDTHKYARMADFARALPKIRTRVTRDLQRPGMPREKVAAALVRLLDRTLVR FT IGSPEYARENRSYGLTTLRKQHLALDADRMRLRFRGKSGVEHDVDIDDPRIVRVVRRCM FT DLPGHELFQYVDECGERHAIGSTDINAYLREISGTGFTAKDYRTWAGSVLALGVLRQIP FT PCNLTSARRHVVDTVRQVADLLRNTPAVCRKCYIHPVVLEAFETGTLATLEPLRQHRRL FT KADEALFASLLHHHARTARAGSRRTR" FT CDS complement(535309..535404) FT /transl_table=11 FT /locus_tag="RBRH_01797" FT /db_xref="EnsemblGenomes-Gn:RBRH_01797" FT /db_xref="EnsemblGenomes-Tr:CBW76917" FT /db_xref="UniProtKB/TrEMBL:E5AUZ3" FT /protein_id="CBW76917.1" FT /translation="MVDRLSKNFELLRDGAVRHALCAAKRVQPWT" FT CDS 535433..537619 FT /transl_table=11 FT /locus_tag="RBRH_01798" FT /product="Enoyl-CoA hydratase (EC 4.2.1.17) / FT Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC FT 5.3.3.8) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / FT 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)" FT /function="Enoyl-CoA hydratase (EC 4.2.1.17) / FT Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC FT 5.3.3.8) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / FT 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)" FT /EC_number="4.2.1.17" FT /note="Enoyl-CoA hydratase (EC 4.2.1.17) / FT Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase (EC FT 5.3.3.8) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / FT 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)" FT /note="COG: 3-hydroxyacyl-CoA dehydrogenase" FT /note="Pfam: 3-hydroxyacyl-CoA dehydrogenase, C-terminal FT domain::PF00725
3-hydroxyacyl-CoA dehydrogenase, NAD FT binding domain::PF02737
Enoyl-CoA hydratase/isomerase FT family::PF00378" FT /db_xref="EnsemblGenomes-Gn:RBRH_01798" FT /db_xref="EnsemblGenomes-Tr:CBW76918" FT /db_xref="GOA:E5AUZ4" FT /db_xref="InterPro:IPR001753" FT /db_xref="InterPro:IPR006108" FT /db_xref="InterPro:IPR006176" FT /db_xref="InterPro:IPR008927" FT /db_xref="InterPro:IPR013328" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR018376" FT /db_xref="UniProtKB/TrEMBL:E5AUZ4" FT /protein_id="CBW76918.1" FT /translation="MDNWPAKCAARPPIPETRPMTLAPSPTQPVSHERHGKVLVVTIDY FT PPVNALGVAVRRGLIDAIDAAEGCDEVAAVLLLGAGRNFIAGADIREFGKPPLPPSLPQ FT VCQRIESCRKPVVAAIHGAALGGGLEIALSAHYRIATPGAKLGLPEVQLGLMPGAGGTQ FT RTPRLIGARAALDLALSARHVNIDEALQLGLLDRISQSDDTRAEGLAYVQALLASHAGA FT RPTRCAKALADRDASHAAVQAARADVVRRSRGLFSPLKIVEAIEAAIDLPFDEGMKLER FT QAFLQCLDSPQRAGLVHAFFAEREAAKTPESQHASPRTIDTVGVVGGGTMGAGIALAAL FT DAGFPVTLIERDDASLARARAHVQRVYDGLIVKGKLSASASAATLSRLCGSTSYDALAN FT VDLVIEAVFEDLVVKKAIFAELDRVCQRGAVLATNTSYLDIDEIAASTGRASDVIGLHF FT FSPANVMKLLEIVVPAKVDADVVATAFEFAKRLRKTPVRAGVCDGFIGNRLLAVYRAAA FT DAMMEDGASPYQIDRAIRDFGFPMGPYQVIDLAGGDIGWAARKRRAATRDPRARYVQIP FT DRLCERGWFGQKTGRGYYVYESGQRTGTPDPEVEAIIASERQRAGITPREFTDEEIVRR FT YLAAMINEGANVVHERIALRPLDVDVVLVHGYGFPRYHGGPMHYADTRGLANVLAEIRQ FT FARQDPLFWQPSPLLVELADKSATFASLNRLADA" FT CDS 537984..538787 FT /transl_table=11 FT /locus_tag="RBRH_01799" FT /product="Sensory box/GGDEF family protein" FT /function="Sensory box/GGDEF family protein" FT /note="Sensory box/GGDEF family protein" FT /note="COG: FOG: EAL domain" FT /note="Pfam: EAL domain::PF00563" FT /db_xref="EnsemblGenomes-Gn:RBRH_01799" FT /db_xref="EnsemblGenomes-Tr:CBW76919" FT /db_xref="InterPro:IPR001633" FT /db_xref="UniProtKB/TrEMBL:E5AUZ5" FT /protein_id="CBW76919.1" FT /translation="MNASLNAPMTLKESVEQAIRDNTFRLRYQPQVNLTSGWIEGAVVS FT LYWPDPDGKPVAQSALLSAAHDSEIVVEVGEWMLRQACQQNYKWQQAGLPPIHVAVPMP FT AALFRMQNVAQRVEAILQQAQLHGCYLALDIAETALLENLAHADAALSALHALQVQSTV FT TDVRFRAQGDEHLATLQLDRIKLDGALVSPSAKARTGETLARLLVAHAHSTGLKITVHD FT VNSFEQFEFFRRHECFEMIGNFYYRPVDSAVMSQLLNRESKSSLL" FT CDS 538821..540272 FT /transl_table=11 FT /locus_tag="RBRH_01800" FT /product="6-phosphogluconate dehydrogenase (EC 1.1.1.44)" FT /function="6-phosphogluconate dehydrogenase (EC 1.1.1.44)" FT /EC_number="1.1.1.44" FT /note="6-phosphogluconate dehydrogenase (EC 1.1.1.44)" FT /note="COG: 6-phosphogluconate dehydrogenase" FT /note="Pfam: 6-phosphogluconate dehydrogenase, C-terminal FT domain::PF00393
NAD binding domain of 6-phosphogluconate FT dehydrogenase::PF03446" FT /db_xref="EnsemblGenomes-Gn:RBRH_01800" FT /db_xref="EnsemblGenomes-Tr:CBW76920" FT /db_xref="GOA:E5AUZ6" FT /db_xref="InterPro:IPR006113" FT /db_xref="InterPro:IPR006114" FT /db_xref="InterPro:IPR006115" FT /db_xref="InterPro:IPR006184" FT /db_xref="InterPro:IPR008927" FT /db_xref="InterPro:IPR012284" FT /db_xref="InterPro:IPR013328" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:E5AUZ6" FT /protein_id="CBW76920.1" FT /translation="MRQSKTCNAFRSCNMGKQAIGVIGLAVMGRNLALNIESRGYAVSV FT YNRTRERTDALIRALPDRKLVPTNTLQAFVESLETPRRILLMVKAGTPTDDTIAALKPL FT LERGDVLIDGGNTHFTDTMRRHRELADAGLHFIGTGVSGGEEGALHGPSIMPGGPRDAY FT ERVEPILTRIAARADDGEPCVAYMGPDGAGHYVKMVHNGIEYGDMQLIAESYALLKHVA FT GLSNAQLRDVYAQWNEGELDSYLIDITSKIFARKDDETGQDLVDVVLDRAAQKGTGKWT FT SQNALDLGVPLQLITESVFARVLSSLKSERVMASRQLSGPSPRALTGAREPFIEAIRRA FT LYLSKVISYAQGFAQLRAASDEYGWDLQYGTIARIFRAGCIIRARFLQKITDAYAQNPA FT LVNLLLAPYFRDVAAQYQAALREVVVAAVQAGVPVPAFASAIAYFDAYRAETLPANLIQ FT AQRDFFGAHTFERIDKPGSFHARWV" FT CDS 540351..541847 FT /transl_table=11 FT /locus_tag="RBRH_01801" FT /product="Transporter, MFS superfamily" FT /function="Transporter, MFS superfamily" FT /note="Transporter, MFS superfamily" FT /note="COG: Permeases of the major facilitator superfamily" FT /note="Pfam: Major Facilitator Superfamily::PF07690" FT /db_xref="EnsemblGenomes-Gn:RBRH_01801" FT /db_xref="EnsemblGenomes-Tr:CBW76921" FT /db_xref="GOA:E5AUZ7" FT /db_xref="InterPro:IPR011701" FT /db_xref="InterPro:IPR016196" FT /db_xref="InterPro:IPR020846" FT /db_xref="UniProtKB/TrEMBL:E5AUZ7" FT /protein_id="CBW76921.1" FT /translation="MSCIHAAQRCSAPAVILLTPFVPQRRPGMNDPRFDPNMATAMPGA FT AAADAALAEPPAKQASNAPPNPSNDPAQDVPLEPPPAPPPSEAAARQWHDLPRPTVQPD FT PTGALFRSLSGLLAAYAVLMVGNGLFTTLIPIRMLHAGLSTVAVGLVQSCYYVGFVAGA FT VTNSRLIERIGQHRAFVAFSAGAALTALAFGTFDSPWIGGALRFCSGVAFMGVYACVES FT WLNGAVPNAMRGRVFSTYLAITYLGVGAGQFLLDIAGASGGRNLLIVGALFVGAILPVT FT LLEGWPVHVFEDRAGVRRPRSWIGNATDLWRDTPLAIPGCICAGLLSSAFYSMTPVFLT FT GIGFSVSELSHFMGLVLIGALLSQWPIGKLSDRIERRVLVFHLAVLAAILSASLIVVRV FT HWFVGIATLVYVAAAFTLYGVIVSYVNDHIDANRRIAISATLLILFSIGGLSGPTIASM FT AMTVLGPGGLFVFNTATAALLAYAARRSITGGRATRPEMP" FT CDS complement(542041..542160) FT /transl_table=11 FT /locus_tag="RBRH_01803" FT /db_xref="EnsemblGenomes-Gn:RBRH_01803" FT /db_xref="EnsemblGenomes-Tr:CBW76922" FT /db_xref="UniProtKB/TrEMBL:E5AUZ8" FT /protein_id="CBW76922.1" FT /translation="MPSTSKGVRAQQHHFIGSFAAPLAKRVVGTFSVEKNLQG" FT CDS complement(542275..542613) FT /transl_table=11 FT /locus_tag="RBRH_04270" FT /db_xref="EnsemblGenomes-Gn:RBRH_04270" FT /db_xref="EnsemblGenomes-Tr:CBW76923" FT /db_xref="UniProtKB/TrEMBL:E5AUZ9" FT /protein_id="CBW76923.1" FT /translation="MHNVHIIFGRNGFDRRAPSTYIGWAKIRHGNPVCIALQLPVEYRL FT DKFTRAIQWREIFAVGTDFHETIASVANNRYMCRCVPSMADHRGAGVGRSRMGRCIDAA FT TSAAYWNG" FT CDS complement(543006..543344) FT /transl_table=11 FT /locus_tag="RBRH_01806" FT /db_xref="EnsemblGenomes-Gn:RBRH_01806" FT /db_xref="EnsemblGenomes-Tr:CBW76924" FT /db_xref="UniProtKB/TrEMBL:E5AV00" FT /protein_id="CBW76924.1" FT /translation="MIRRRPYRYSLKLRRAYHTCCRSADARAAYARNVGKLSWLLCSGR FT PWPACHMCCRTSGYWLVWPCSGRMKSCVFLLFFRLTQRMRARRSRCVTVCQHWVRGADS FT AERIGEDQ" FT CDS complement(543802..544053) FT /transl_table=11 FT /locus_tag="RBRH_04271" FT /db_xref="EnsemblGenomes-Gn:RBRH_04271" FT /db_xref="EnsemblGenomes-Tr:CBW76925" FT /db_xref="UniProtKB/TrEMBL:E5AV01" FT /protein_id="CBW76925.1" FT /translation="MVGVDAAAVSANADAGAFASVFESIVAGAAVVATAVSEAAVPKEA FT AFDVGVLAAANSEATAPEAFMLELEMVDAATGACVEAA" FT CDS 544323..545084 FT /transl_table=11 FT /locus_tag="RBRH_01808" FT /db_xref="EnsemblGenomes-Gn:RBRH_01808" FT /db_xref="EnsemblGenomes-Tr:CBW76926" FT /db_xref="GOA:E5AV02" FT /db_xref="InterPro:IPR002890" FT /db_xref="UniProtKB/TrEMBL:E5AV02" FT /protein_id="CBW76926.1" FT /translation="MPEPRRGKWKHCEIAAHLSDILEKTEMKFQKTLAVTCAVTLLASA FT CATQNGMNTGSTETVLRCAALGAGGAIVGALLGGTKGALSGATAGLAACAVIEVETRQT FT KTSAEVDREYRASNRNSLPTYAKIDAYTTTVTPRTAIKTGEPIKLQSQIRAVSGTNEAV FT QEVKEVVTVYAPSGQAFKRGEKIVNAAPGSGEFDNSFTLKLPAGAPQGTYTLKSQVVLN FT GKPGSTRQSSVQLAQVEGVTVVALLDAPAER" FT CDS 545108..546358 FT /transl_table=11 FT /locus_tag="RBRH_01809" FT /db_xref="EnsemblGenomes-Gn:RBRH_01809" FT /db_xref="EnsemblGenomes-Tr:CBW76927" FT /db_xref="UniProtKB/TrEMBL:E5AV03" FT /protein_id="CBW76927.1" FT /translation="MTMSMTDHTLATGQFGLLRAAEAVTNWRALAMCALSVVATMLIGM FT LTMQMLRHSIMLGLPFILATIAAMIVGYSAVGIILMRGAQGERVGFIDALRQAALTAHR FT FVGVGALLGTGWLALLLALLFVFFVCKIPGVGPLLYAIAYPIAAIVAGAAFAGMWYVGY FT PLAAPAIWQGNSTLQTTARLLHIGRHQLLGMIIQMFMLLLLVGVLSIIVFGILGTGMVI FT ASSASMGVGIRPLSGLFDLLSGLGRVDGFGGLSTFDGQYGGYGMNGNAMGSASGNGLDR FT HSIAYLGSFGFGNGLLIAIGLVIPFLTFVNGTCLIYLQTASGIDVSVTERKLRQRVADA FT RRRARQARAAYASGAMTNPPAAPHGASPHAPTPTSRDTATHPTPSDNNGATTCTQCHKP FT MGEEDLFCGECGTRRQA" FT CDS 546400..546726 FT /transl_table=11 FT /locus_tag="RBRH_01810" FT /db_xref="EnsemblGenomes-Gn:RBRH_01810" FT /db_xref="EnsemblGenomes-Tr:CBW76928" FT /db_xref="UniProtKB/TrEMBL:E5AV04" FT /protein_id="CBW76928.1" FT /translation="MATALAFAVQAAINVRSPAGARQQTATTTAGGYCMASGGRPSQPA FT SGWPTDRGNSWQTPTRHRTGIRPISSVWQNDRLQTSIPAGNRSWTVAARWWATNCYSDM FT SRTT" FT CDS complement(546793..547110) FT /transl_table=11 FT /locus_tag="RBRH_01811" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01811" FT /db_xref="EnsemblGenomes-Tr:CBW76929" FT /db_xref="UniProtKB/TrEMBL:E5AV05" FT /protein_id="CBW76929.1" FT /translation="MKLRDLAHSRTGDKGDTLNISVICYDSRHYEYLRRTLSAERVKAH FT LRDVVRGDVIRYELPRLAAFNFVAQHALGGGVTRSLALDAHGKSLSSVLLDLDLEDAED FT V" FT CDS complement(547112..548488) FT /transl_table=11 FT /locus_tag="RBRH_01812" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Protein of unknown function FT (DUF1446)::PF07287" FT /db_xref="EnsemblGenomes-Gn:RBRH_01812" FT /db_xref="EnsemblGenomes-Tr:CBW76930" FT /db_xref="InterPro:IPR010839" FT /db_xref="UniProtKB/TrEMBL:E5AV06" FT /protein_id="CBW76930.1" FT /translation="MLMENEAMAVTHDPRRVRVGAGAGYSGDRIEPAVELAEYGELDYL FT VFECLAERTIAIAQQMRRSNPELGYDPLLEARMMAVLPVAARNGVQIISNMGAANPLAA FT ARKTAQIARSLDLDGLKIAAVTGDDVLDVVRQGNFYFEESGDSVASYAERLVSANAYLG FT AAPIIAALAAGADVVLTGRVADPALFIAPLIHEFGWNRDDWDRLGQATVIGHLLECAGQ FT VTGGYFADPGFKDVPHLARLGFPIAEVCADGAAVITKLPAAGGRVTEATCKEQLLYEIH FT DPSRYVQPDVVADFTEVRVLEEAPDRVRLTGGRGTAHTDTLKVSVGYLDGFIGEGQISY FT CGPGALARARAALDIVRERLQLTGVETRELRLDLIGVNALSGRAGTRDGEPYEVRARVA FT GRTASIGDAMRIGNEVETLYTNGPAGGGGVSKTTREVLAVQSILLPRAHVHPTFEFVEA FT " FT CDS complement(548489..549793) FT /transl_table=11 FT /locus_tag="RBRH_01813" FT /product="Arsenite permease" FT /function="Arsenite permease" FT /note="Arsenite permease" FT /note="COG: H+/citrate symporter" FT /note="Pfam: Citrate transporter::PF03600" FT /db_xref="EnsemblGenomes-Gn:RBRH_01813" FT /db_xref="EnsemblGenomes-Tr:CBW76931" FT /db_xref="GOA:E5AV07" FT /db_xref="InterPro:IPR004680" FT /db_xref="InterPro:IPR014738" FT /db_xref="UniProtKB/TrEMBL:E5AV07" FT /protein_id="CBW76931.1" FT /translation="MLPLLGFATIVVLLAVILSKRMSPLVALIVVPIAASLIGGFGWQT FT CKFVIDGLRNMAPVVGMFIFAILYFGTVTDAGMLDPIIDRILRAVGTRPTRIVIGTTLL FT ALLIHLDGSGAVCFLVTIPAMLPLYDRLKMDRRVLAAAVSMAAGINFLPWTGPTIRASA FT SLNLPVSSIFNPLIPVQAIGLVFVFGTAYLLGRREEKRLGFTRLTKPIPIPERKLTPEE FT MKVRRPQYFWFNVGLTISVLGTLVAMGDKVPPAIVFMVGLCIALVVNYPNVEMQRNRID FT AHARAALMMAGILLAAGVFTGVLQGSGMLKAMAHSAVGLVPQEMASHIPFTLGLIAMPL FT SMLFDPDSFYFGVLPVVAEVAGHLGVPALQVAQAALLGQMTTGFPVSPLTPATFLVVGL FT CGIDLADHQKFSFPLLFGASIVMTVAAVVLGVFPL" FT CDS complement(549778..549888) FT /transl_table=11 FT /locus_tag="RBRH_01814" FT /db_xref="EnsemblGenomes-Gn:RBRH_01814" FT /db_xref="EnsemblGenomes-Tr:CBW76932" FT /db_xref="UniProtKB/TrEMBL:E5AV08" FT /protein_id="CBW76932.1" FT /translation="MFSNAAIKLFQLIYPMDENILGRVERQTMDRSCCRC" FT CDS 550042..550245 FT /transl_table=11 FT /locus_tag="RBRH_01815" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /db_xref="EnsemblGenomes-Gn:RBRH_01815" FT /db_xref="EnsemblGenomes-Tr:CBW76933" FT /db_xref="InterPro:IPR005119" FT /db_xref="UniProtKB/TrEMBL:E5AV09" FT /protein_id="CBW76933.1" FT /translation="MLVDARTLGGGLSGVVRIACLPTFAASLLPGLIQELRADMPRISF FT YLRDVVASTVNTLVRSEEADIG" FT CDS 550281..550709 FT /transl_table=11 FT /locus_tag="RBRH_01816" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /db_xref="EnsemblGenomes-Gn:RBRH_01816" FT /db_xref="EnsemblGenomes-Tr:CBW76934" FT /db_xref="InterPro:IPR005119" FT /db_xref="UniProtKB/TrEMBL:E5AV10" FT /protein_id="CBW76934.1" FT /translation="MYSGVDRLVAVFPMDHPHARRQHIGLDHLLSEPLVLMVQGTSVRA FT IVDAALANASSTPDISCEPTYMMTAVAMVRSGLGITILPSNAREVRAEPGLVVRPIADE FT AFVCPIALVKMRSRTLPPVTERFVSALRRKLNDGTTLA" FT CDS 550865..551149 FT /transl_table=11 FT /locus_tag="RBRH_01817" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_01817" FT /db_xref="EnsemblGenomes-Tr:CBW76935" FT /db_xref="InterPro:IPR025161" FT /db_xref="UniProtKB/TrEMBL:E5AV11" FT /protein_id="CBW76935.1" FT /translation="MARRKISNELWAVLEPLIPAFTPSPKGGRRRTVDDRAALNGIVYV FT LHTGIAWEDLPQELGFGSGMTCWRRLRHWQAAGVWSKLHLAMLCRLRET" FT CDS 551139..551672 FT /transl_table=11 FT /locus_tag="RBRH_04272" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /note="Pfam: Transposase DDE domain::PF01609" FT /db_xref="EnsemblGenomes-Gn:RBRH_04272" FT /db_xref="EnsemblGenomes-Tr:CBW76936" FT /db_xref="UniProtKB/TrEMBL:E5AV12" FT /protein_id="CBW76936.1" FT /translation="MKHDQIDWQRASLDAASVASPRGGQETGPNPTDRGKLGSKRHLVV FT DARGVPLAITVTGANRHDSMAFERTLDTLPAVPGLNGSPRKRPGKLHADKGYDFARCRR FT YLKQRVITARIARRGVEKRERLGRHRWVVERTHAWFAGFGKLRIRFERRLDIHIALLRL FT AAAVICSRFVDDLC" FT CDS 551934..552125 FT /transl_table=11 FT /locus_tag="RBRH_01820" FT /product="Metal-dependent hydrolase related to alanyl-tRNA FT synthetase" FT /function="Metal-dependent hydrolase related to alanyl-tRNA FT synthetase" FT /note="Metal-dependent hydrolase related to alanyl-tRNA FT synthetase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01820" FT /db_xref="EnsemblGenomes-Tr:CBW76937" FT /db_xref="GOA:E5AV13" FT /db_xref="InterPro:IPR012947" FT /db_xref="InterPro:IPR018163" FT /db_xref="UniProtKB/TrEMBL:E5AV13" FT /protein_id="CBW76937.1" FT /translation="MRSVTLPATEDGQIRIAEIVGLGRQACGNIHLSETGALRPIRILK FT IDNKGRHNRRVCIGLLNR" FT CDS complement(552305..552460) FT /transl_table=11 FT /locus_tag="RBRH_04273" FT /db_xref="EnsemblGenomes-Gn:RBRH_04273" FT /db_xref="EnsemblGenomes-Tr:CBW76938" FT /db_xref="UniProtKB/TrEMBL:E5AV14" FT /protein_id="CBW76938.1" FT /translation="MARISGWPEDEDNSACWRKGAEDGGLSLRKVPSLDARAGRHADSE FT MLALRQ" FT CDS complement(552461..553249) FT /transl_table=11 FT /locus_tag="RBRH_01821" FT /product="embryo-specific protein" FT /function="embryo-specific protein" FT /note="embryo-specific protein" FT /note="COG: 1,4-alpha-glucan branching enzyme" FT /note="Pfam: Protein of unknown function FT (DUF1264)::PF06884" FT /db_xref="EnsemblGenomes-Gn:RBRH_01821" FT /db_xref="EnsemblGenomes-Tr:CBW76939" FT /db_xref="InterPro:IPR010686" FT /db_xref="UniProtKB/TrEMBL:E5AV15" FT /protein_id="CBW76939.1" FT /translation="MKQPAICACRRAFTSSALKIALASAAGVSASLARADEDHGTPVPG FT AKLSPRSRVLDTGARLLQKKRPVDAMSAFLNGFHFYADDMGRQVEAFHYCTHLTEDFHQ FT CVIYDSDAPDAKLIGIEYIVSERVFRTLPDEERRLWHSHRYEVRSGELLAPGIPEQAEH FT ALMGQLVNTYGKTWHTWQIDRDHALPFGIPQLMMSFTDDGQLDRARVRARDARFGVSTD FT ALRRRRADLAQPQPIAGADAWQDGSTLQLAAAEVKVKVPR" FT CDS complement(553320..553562) FT /transl_table=11 FT /locus_tag="RBRH_01822" FT /db_xref="EnsemblGenomes-Gn:RBRH_01822" FT /db_xref="EnsemblGenomes-Tr:CBW76940" FT /db_xref="UniProtKB/TrEMBL:E5AV16" FT /protein_id="CBW76940.1" FT /translation="MMKHRDAADCADPAMRKHAEGESEVTIDKDGKVHQKGHGSMDETM FT IPQKPEPDRGPYQPPPGHLDNPKDVEPRSGGDLSA" FT CDS 553871..554578 FT /transl_table=11 FT /locus_tag="RBRH_01823" FT /product="Transcriptional regulator" FT /function="Transcriptional regulator" FT /note="Transcriptional regulator" FT /note="COG: Predicted transcriptional regulators" FT /note="Pfam: Transcriptional regulator PadR-like FT family::PF03551" FT /db_xref="EnsemblGenomes-Gn:RBRH_01823" FT /db_xref="EnsemblGenomes-Tr:CBW76941" FT /db_xref="InterPro:IPR005149" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AV17" FT /protein_id="CBW76941.1" FT /translation="MEKAMRHFSLFRDGPRSPRSWDDCMPFAALRHAMGRHSHQRHGGS FT SPFWGGGGSGGFGDDENMSRGRKFSSDDLQLLLLALIAQQPSHGYELIKTLDARSNGYY FT SPSPGMVYPALTYLEELGYVTVQLEGNRKRYVLADPGRDYLDANRERADLLLAKLQHIG FT RKMEMIRRFFASGEGDDMSGGSAWLPEFNEARLALKQALYRRDNLPPDEQRRIAAILMR FT AVAEIEQKPEASQ" FT CDS 554575..555417 FT /transl_table=11 FT /locus_tag="RBRH_01825" FT /product="Siderophore-interacting protein" FT /function="Siderophore-interacting protein" FT /note="Siderophore-interacting protein" FT /note="COG: Siderophore-interacting protein" FT /note="Pfam: Siderophore-interacting FAD-binding FT domain::PF08021
Siderophore-interacting FT protein::PF04954" FT /db_xref="EnsemblGenomes-Gn:RBRH_01825" FT /db_xref="EnsemblGenomes-Tr:CBW76942" FT /db_xref="GOA:E5AV18" FT /db_xref="InterPro:IPR007037" FT /db_xref="InterPro:IPR013113" FT /db_xref="InterPro:IPR017927" FT /db_xref="InterPro:IPR017938" FT /db_xref="UniProtKB/TrEMBL:E5AV18" FT /protein_id="CBW76942.1" FT /translation="MTSNQDNVTGRDRSERIVTRVRHPLKFRLLCVKRVRQITPTLVRV FT TLAGDDLHDFISASFDDHVKVFFPLPGMDNPPLPTVGPDGVAFPEHHPRPPARDYTPRR FT YDRHAGELDLEFALHDAGPASAWARQAQPGQWLGVGGPRSSLVIPTDFDWHLLIGDDTA FT LPAIARRLDELPADTRVATVIEVADAASRIDLKTRAQLHAVWCYRDCAGPDGGALLRAV FT RDTYLPDGDGYVWVAAEASVARAVRQHLVEERGVPKSRIRAASYWRRGTAAVHETIDG" FT CDS 555620..555880 FT /transl_table=11 FT /locus_tag="RBRH_01826" FT /db_xref="EnsemblGenomes-Gn:RBRH_01826" FT /db_xref="EnsemblGenomes-Tr:CBW76943" FT /db_xref="UniProtKB/TrEMBL:E5AV19" FT /protein_id="CBW76943.1" FT /translation="MSMGHHDASRLLRSSAPVYGGLGELLRDLTCRWQPTATIGALNMA FT DFLNPAVLAVVVAALTMRALVAFYYRDSTRVLHLLRLLPRL" FT CDS complement(556300..556599) FT /transl_table=11 FT /locus_tag="RBRH_01827" FT /db_xref="EnsemblGenomes-Gn:RBRH_01827" FT /db_xref="EnsemblGenomes-Tr:CBW76944" FT /db_xref="UniProtKB/TrEMBL:E5AV20" FT /protein_id="CBW76944.1" FT /translation="MKWLQDNGALWFEMLAKGSAGQRKQDFKDKVVATSSHHALVQVSD FT MVAICYEKAHLDREVRVGEKVVIQHGDKKAKSMNRVKSRRVNTRVTWSDKQTSI" FT CDS complement(556517..557689) FT /transl_table=11 FT /locus_tag="RBRH_01828" FT /note="Pfam: Zeta toxin::PF06414" FT /db_xref="EnsemblGenomes-Gn:RBRH_01828" FT /db_xref="EnsemblGenomes-Tr:CBW76945" FT /db_xref="GOA:E5AV21" FT /db_xref="InterPro:IPR010488" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AV21" FT /protein_id="CBW76945.1" FT /translation="MTQRSLRLSSALSSSTLRRPADCTATELAAEAIHELRSSGGAVLI FT DADRMRERNLCHKRLSREDPQHAADRTHKEAGEWVTRLTIVAAENRRNLVIDDTMRSPE FT SICDLTRRLKDAGYKIEARVMAVNAKTSFARARLRFEEQVAERGTGRFVNEEQHDNAYT FT GIVESVRALEHEKLVDAVRVYDANQQPIYENLQERGNWQKAPEAVQVLEQERARDWTYD FT ERCDYVSVLEQINALASQRGSYRDNVADTLRMVADGKAMDGNENPPSHTYAQVSRSEQD FT RTLRPVSADHDELAAKLEALAKHPELDGAYKQLHDIKQGRVTQISQNDRETPYLSVSAQ FT LSEQLHREQVPKGNVALDESRRVIEMAAGQRGLMVRDAGQRKCWPKEARL" FT CDS complement(557610..557873) FT /transl_table=11 FT /locus_tag="RBRH_01829" FT /db_xref="EnsemblGenomes-Gn:RBRH_01829" FT /db_xref="EnsemblGenomes-Tr:CBW76946" FT /db_xref="UniProtKB/TrEMBL:E5AV22" FT /protein_id="CBW76946.1" FT /translation="MTKQLFSRAGVRYEVALDVLGAIIAHHSETIAAERDRPVPDEPAI FT ERALQEVDALDALRDELDPKEPEAIERVIQQYAPQARGLYGY" FT CDS complement(558050..558469) FT /transl_table=11 FT /locus_tag="RBRH_01830" FT /db_xref="EnsemblGenomes-Gn:RBRH_01830" FT /db_xref="EnsemblGenomes-Tr:CBW76947" FT /db_xref="InterPro:IPR002716" FT /db_xref="UniProtKB/TrEMBL:E5AV23" FT /protein_id="CBW76947.1" FT /translation="MSNKAIVLDANILIRAVLGTRVRELVMAHVHAVQFFAPDVAYTDA FT RKYLPALLEKRGVASESAIAVLDSLVPLIQIVDAEIYGDAQAAALQRIGARDADDWPVL FT ACAMAIGCPVWTEDADFFGTGVATWTTDRIQFYLN" FT CDS complement(558466..558756) FT /transl_table=11 FT /locus_tag="RBRH_01831" FT /db_xref="EnsemblGenomes-Gn:RBRH_01831" FT /db_xref="EnsemblGenomes-Tr:CBW76948" FT /db_xref="UniProtKB/TrEMBL:E5AV24" FT /protein_id="CBW76948.1" FT /translation="MDMEAITVGIREFRADLAEYIAANMPVAVTRHGQTVGYFIPAHGQ FT AEAHLAAMKKASEILDDLLTGRGVDVEEVVSEFKAVRRASTGKGKTGAKSA" FT CDS complement(558993..559301) FT /transl_table=11 FT /locus_tag="RBRH_01832" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01832" FT /db_xref="EnsemblGenomes-Tr:CBW76949" FT /db_xref="InterPro:IPR025296" FT /db_xref="UniProtKB/TrEMBL:E5AV25" FT /protein_id="CBW76949.1" FT /translation="MFGLSHYRATVHSLVGLAMQTNKGIVLAQALVEYPRRQVILLPSV FT NVIERICAKVMTAYNPPDLQNIDGGASLGRASSKTRPVAGAPSGFEIFRTIAAMHNQ" FT CDS complement(559361..559531) FT /transl_table=11 FT /locus_tag="RBRH_01833" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01833" FT /db_xref="EnsemblGenomes-Tr:CBW76950" FT /db_xref="InterPro:IPR025296" FT /db_xref="UniProtKB/TrEMBL:E5AV26" FT /protein_id="CBW76950.1" FT /translation="MIRQRHGDANRLGFAVQRCLLWCLGQGGLTTTDVPPALLQWTPRN FT GASIRRAGPSV" FT CDS complement(559679..559822) FT /transl_table=11 FT /locus_tag="RBRH_01834" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01834" FT /db_xref="EnsemblGenomes-Tr:CBW76951" FT /db_xref="GOA:E5AV27" FT /db_xref="InterPro:IPR011010" FT /db_xref="InterPro:IPR013762" FT /db_xref="UniProtKB/TrEMBL:E5AV27" FT /protein_id="CBW76951.1" FT /translation="MTDQQLELRFVCDNLGHASLATTSVYLHAEDDVRHEAMQTRHRLS FT WD" FT CDS complement(559880..560125) FT /transl_table=11 FT /locus_tag="RBRH_01835" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01835" FT /db_xref="EnsemblGenomes-Tr:CBW76952" FT /db_xref="UniProtKB/TrEMBL:E5AV28" FT /protein_id="CBW76952.1" FT /translation="MARGNRMRLVPATDEPIAELARYRRAHGLAPSPYQGENRTLLLPL FT IGHEKPLARSSIHLIVKEIFALAAARLRSRGLEWHV" FT CDS complement(560135..560455) FT /transl_table=11 FT /locus_tag="RBRH_01836" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01836" FT /db_xref="EnsemblGenomes-Tr:CBW76953" FT /db_xref="UniProtKB/TrEMBL:E5AV29" FT /protein_id="CBW76953.1" FT /translation="MTILNVIFAWFVDAGYLAGNPLSLTRRRGVATRPAVARYLTYEWW FT SVVKTTIETLLVGTERERLHTARCRWLFTVLYLAGLYAAEIASTPIGGVFCRRDAAGVE FT RW" FT CDS 560596..561603 FT /transl_table=11 FT /locus_tag="RBRH_01838" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /note="Pfam: Transposase IS116/IS110/IS902 family::PF02371" FT /db_xref="EnsemblGenomes-Gn:RBRH_01838" FT /db_xref="EnsemblGenomes-Tr:CBW76954" FT /db_xref="GOA:E5AV30" FT /db_xref="InterPro:IPR002525" FT /db_xref="InterPro:IPR003346" FT /db_xref="UniProtKB/TrEMBL:E5AV30" FT /protein_id="CBW76954.1" FT /translation="MEPTTIAIDLAKRVFQIHFVDTDGTIHSKALKRVQMLPFFANRPA FT ARIVMEACGSAHHWARQLTRLGHEVRLIAAQFVCPFVKSNKNDAADAAAIWEASQRPGM FT RFVAVKSAHQQAMLALHRMRQQLVRIRVMQVNQLRGLLYEFGVVLPQGRRPSIQAAQAA FT IATLADQFPAMLIDSLRDQLSRLPLLDEQIQRIEQRILEWRRGDPACRCISEIPGVGLL FT TATAAVSVIGQAKTFRSGREFAAYLGLVPRQNSSGGKVRLSGISKRGDVYLRTLLIHGA FT RSVISSSKHLPERLRALLTRRPTNVVAVALANKMARTIWALLAYGRTYQAAPAQ" FT CDS complement(561618..562250) FT /transl_table=11 FT /locus_tag="RBRH_01839" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_01839" FT /db_xref="EnsemblGenomes-Tr:CBW76955" FT /db_xref="UniProtKB/TrEMBL:E5AV31" FT /protein_id="CBW76955.1" FT /translation="MIGNRLIVALKHQGLVAHCTACGATSSRIHGWYRRRVEDLPCSGH FT RVTLEIHVQHFRCDNIMCRRRTFAPCLAPFGARQQRRTARAQTVLWHVGLALSDAAGAR FT LAQRLGISISGETMLRLLKRNGQKYVATTFLIWSPSICKAIVRGRRVVADLYPDSIAGV FT PAGPNGLRRKGPNLIGGLEVREMSQARLRAVQPVLPSFNTPVQPWMG" FT CDS 562161..562322 FT /transl_table=11 FT /locus_tag="RBRH_01840" FT /db_xref="EnsemblGenomes-Gn:RBRH_01840" FT /db_xref="EnsemblGenomes-Tr:CBW76956" FT /db_xref="UniProtKB/TrEMBL:E5AV32" FT /protein_id="CBW76956.1" FT /translation="MYPGACRSTRRAVRNEPLMFQCNDEPIADHLSSENAHVGSGQQAL FT KKKLMPII" FT CDS 562504..564060 FT /transl_table=11 FT /locus_tag="RBRH_01841" FT /db_xref="EnsemblGenomes-Gn:RBRH_01841" FT /db_xref="EnsemblGenomes-Tr:CBW76957" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AV33" FT /protein_id="CBW76957.1" FT /translation="MPASHELLQQCALPTDDVTAAAYEHSTIRQERGGHSPSLCLASRF FT QLACCAASLRIAPFFYRLPSLPMDFDLHAALNDYQAYMRALESCPQAAASAPPPTLKPA FT SGELMSPSASRPTTYHDLPPELIQQIGDYVPVQDVGNFSAVDRRTYHAMHSRRVVYRYW FT QRANQVVSLASVNQLLKEMDGTLADPAQHVEPLEALRQRLEALPYREQGEAFKRMYAAA FT QRIPKDGVQIQKALLLHSLRDFHWSHSDELFDFAYAMAQRRAPEEENVWTELADSLESL FT LFGSAEFVERYQALVARLASLRVSEQAELIPVLCRRMIHFGGSDDRLPGLYAVLREHAL FT ELPPSHQGAPVGRLASAIWVLPHAERLAQYTQLRDVALSLPDEQLGIALRDLPEGLTRL FT PSEHHAHEFQLLVPALLRVLPAQRAQVALGLLMYTYRLDDALVQWVWQQGLSLLNGAGE FT VALCDVLSRLRAQGAIGNLDDRQWNIAKGEITRFMEANQFSEPARARIQDSVPWFRSVP FT R" FT CDS complement(564366..564830) FT /transl_table=11 FT /locus_tag="RBRH_01842" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_01842" FT /db_xref="EnsemblGenomes-Tr:CBW76958" FT /db_xref="GOA:E5AV34" FT /db_xref="InterPro:IPR001207" FT /db_xref="UniProtKB/TrEMBL:E5AV34" FT /protein_id="CBW76958.1" FT /translation="MWQRQWEQVIPFFAYPPQVRRIIYATNAIESMHMQLRKIVKNRGH FT FPSDRSELLLRNKTGSRLTRANRRVRRRRARSSACRGRVCRRFDRHESRREQRIDVAFH FT SAAIAMQACCYAQSKNGSSTLCVKFVPRSSIDSTREYEAAESRRGYPSVA" FT CDS complement(564803..565168) FT /transl_table=11 FT /locus_tag="RBRH_01843" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01843" FT /db_xref="EnsemblGenomes-Tr:CBW76959" FT /db_xref="GOA:E5AV35" FT /db_xref="InterPro:IPR001207" FT /db_xref="UniProtKB/TrEMBL:E5AV35" FT /protein_id="CBW76959.1" FT /translation="MTNTTVNKKSKNPKAPKLFPDELIDQLLAQVQSKDAESILDESGL FT AGQLKKQLAQRMLAAELTHHLETEAAQGKSGSHRNGTSPKTVITPNGELKLDISRKVNG FT AVNFLPLQPCGNANGNR" FT CDS complement(565327..567642) FT /transl_table=11 FT /locus_tag="RBRH_01844" FT /note="COG: AraC-type DNA-binding domain-containing FT proteins" FT /note="Pfam: Xanthomonas avirulence protein, FT Avr/PthA::PF03377" FT /db_xref="EnsemblGenomes-Gn:RBRH_01844" FT /db_xref="EnsemblGenomes-Tr:CBW76960" FT /db_xref="InterPro:IPR005042" FT /db_xref="InterPro:IPR020683" FT /db_xref="UniProtKB/TrEMBL:E5AV36" FT /protein_id="CBW76960.1" FT /translation="MSTAFVDQDKQMANRLNLSPLERSKIEKQYGGATTLAFISNKQNE FT LAQILSRADILKIASYDCAAHALQAVLDCGPMLGKRGFSQSDIVKIAGNIGGAQALQAV FT LDLESMLGKRGFSRDDIAKMAGNIGGAQTLQAVLDLESAFRERGFSQADIVKIAGNNGG FT AQALYSVLDVEPTLGKRGFSRADIVKIAGNTGGAQALHTVLDLEPALGKRGFSRIDIVK FT IAANNGGAQALHAVLDLGPTLRECGFSQATIAKIAGNIGGAQALQMVLDLGPALGKRGF FT SQATIAKIAGNIGGAQALQTVLDLEPALCERGFSQATIAKMAGNNGGAQALQTVLDLEP FT ALRKRDFRQADIIKIAGNDGGAQALQAVIEHGPTLRQHGFNLADIVKMAGNIGGAQALQ FT AVLDLKPVLDEHGFSQPDIVKMAGNIGGAQALQAVLSLGPALRERGFSQPDIVKIAGNT FT GGAQALQAVLDLELTLVEHGFSQPDIVRITGNRGGAQALQAVLALELTLRERGFSQPDI FT VKIAGNSGGAQALQAVLDLELTFRERGFSQADIVKIAGNDGGTQALHAVLDLERMLGER FT GFSRADIVNVAGNNGGAQALKAVLEHEATLNERGFSRADIVKIAGNGGGAQALKAVLEH FT EATLDERGFSRADIVRIAGNGGGAQALKAVLEHGPTLNERGFNLTDIVEMAANSGGAQA FT LKAVLEHGPTLRQRGLSLIDIVEIASNGGAQALKAVLKYGPVLMQAGRSNEEIVHVAAR FT RGGAGRIRKMVAPLLERQ" FT CDS 568329..568511 FT /transl_table=11 FT /locus_tag="RBRH_01846" FT /product="Nucleotidyltransferase (EC 2.7.7.-)" FT /function="Nucleotidyltransferase (EC 2.7.7.-)" FT /EC_number="2.7.7.-" FT /note="Nucleotidyltransferase (EC 2.7.7.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_01846" FT /db_xref="EnsemblGenomes-Tr:CBW76961" FT /db_xref="GOA:E5AV37" FT /db_xref="UniProtKB/TrEMBL:E5AV37" FT /protein_id="CBW76961.1" FT /translation="MVCLKLTSIALDMAGIAFDVLLETGVLVEALPLWEDEMEHPELFS FT NPALIRNIHREGIAL" FT CDS 568501..568725 FT /transl_table=11 FT /locus_tag="RBRH_01847" FT /db_xref="EnsemblGenomes-Gn:RBRH_01847" FT /db_xref="EnsemblGenomes-Tr:CBW76962" FT /db_xref="InterPro:IPR007842" FT /db_xref="UniProtKB/TrEMBL:E5AV38" FT /protein_id="CBW76962.1" FT /translation="MRYEHDGQRLHRQAGHALEEAHVLLNAGGFEGACNRAYYAMFDAA FT HAALLVTGVTVPDASPKKHRSLIASFGLN" FT CDS 568726..568932 FT /transl_table=11 FT /locus_tag="RBRH_01848" FT /db_xref="EnsemblGenomes-Gn:RBRH_01848" FT /db_xref="EnsemblGenomes-Tr:CBW76963" FT /db_xref="UniProtKB/TrEMBL:E5AV39" FT /protein_id="CBW76963.1" FT /translation="MKAGMVESELGSALNKVERLRRLADYTGETVTEEDARWAVEQAGK FT LVNTVRERMLPNKSTSLPSAPRP" FT CDS 569480..570856 FT /transl_table=11 FT /locus_tag="RBRH_01849" FT /db_xref="EnsemblGenomes-Gn:RBRH_01849" FT /db_xref="EnsemblGenomes-Tr:CBW76964" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AV40" FT /protein_id="CBW76964.1" FT /translation="MLSLPMDFDLNAALNDYQAYTCALEARPTPAASAPPPPQLPSAAW FT ANPPAKRPTTYQDLPSEVIARIGDYVPVQDVMSFATVDRRTYYAMQTRRLVHSYWQRAK FT QAVTFESINRLLDEMDGTLADPAQHAEPLDALCQRLRALHSADRGDVFKRLFAAAQRIP FT QDGVQIQKALLLMHRDFTYERERIELFDFAYTLAEQREPGQDNVWPELALGLSNFSPDT FT PETPHFAQWYYAILARLPSLSVAEQAQIIPTLARLLSKFRQPDSRISELYTLLHDYALR FT LPPSHQGASVGALASYVWRFPEAEQPARYTQMRDWALSLPDDQWGIALQRLPEGLGSFS FT PKRQAQELALLERYLGRVPTAQRTQAAVGLIRSIYFINDTLAKRGWQQGLSLLNGAGED FT ALWEVLTELRANGMLCRRSNRQWKVAMGEITRFMKANQFSKPAQARIQDSAAWLRSEPD FT " FT CDS 570981..571433 FT /transl_table=11 FT /locus_tag="RBRH_01850" FT /db_xref="EnsemblGenomes-Gn:RBRH_01850" FT /db_xref="EnsemblGenomes-Tr:CBW76965" FT /db_xref="UniProtKB/TrEMBL:E5AV41" FT /protein_id="CBW76965.1" FT /translation="MSQFISSRDYHSTHIICVLCAAIAMIGADGLRKASRAAALRTAHP FT TTTRASGTKCSRIGMVFRSAKPVMHATRHIATVPVQGYFPMSSPAISRTASVNSTVTDA FT PSVVPSSNALLGQATRQGQHGRLSGLNKVGSKLRQIGPALGKVGSS" FT CDS 571451..572146 FT /transl_table=11 FT /locus_tag="RBRH_01851" FT /db_xref="EnsemblGenomes-Gn:RBRH_01851" FT /db_xref="EnsemblGenomes-Tr:CBW76966" FT /db_xref="UniProtKB/TrEMBL:E5AV42" FT /protein_id="CBW76966.1" FT /translation="MGEANTDCMAGCPPFLKTNRANWAPRQHRAHCKKAVEYAKNAVAK FT HTLRHEAEYNKLSGKMCWDAVKYCAFSANIITEDEHDALNARWDLVTPHDSRIRNSDDL FT KNVPPGHALGFFRIEHFAASNASNVRMDPFHVMLNTGGNKAAGNKNDCVGLGDMFGWEE FT RDLSQLKWYQGAVVAPKGGDVTVDPAHQDALSKFPEEIVARAKTVPFKKIEQPSFHIST FT TAMIHADSS" FT CDS complement(572264..572530) FT /transl_table=11 FT /locus_tag="RBRH_01852" FT /product="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /function="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /EC_number="2.7.7.7" FT /note="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /note="COG: DNA polymerase III, alpha subunit" FT /db_xref="EnsemblGenomes-Gn:RBRH_01852" FT /db_xref="EnsemblGenomes-Tr:CBW76967" FT /db_xref="GOA:E5AV43" FT /db_xref="UniProtKB/TrEMBL:E5AV43" FT /protein_id="CBW76967.1" FT /translation="MRLVTVRQRPGTAKGVLFVMLEDERGHTNVIIWPSLLERQRKEAL FT GASLFAVYGVWQRQGEVTHLVAQRLVDLSHLLGSLMTTSRDFC" FT CDS 572598..572837 FT /transl_table=11 FT /locus_tag="RBRH_01853" FT /db_xref="EnsemblGenomes-Gn:RBRH_01853" FT /db_xref="EnsemblGenomes-Tr:CBW76968" FT /db_xref="UniProtKB/TrEMBL:E5AV44" FT /protein_id="CBW76968.1" FT /translation="MRAQQCARMPPERQTQRAIVVRNGLPLRERRKRRCRVVRASRTEQ FT IPVRHRGECVPQRRAAIARKARQVCIMPDFSTFE" FT CDS 573663..575261 FT /transl_table=11 FT /locus_tag="RBRH_01855" FT /db_xref="EnsemblGenomes-Gn:RBRH_01855" FT /db_xref="EnsemblGenomes-Tr:CBW76969" FT /db_xref="UniProtKB/TrEMBL:E5AV45" FT /protein_id="CBW76969.1" FT /translation="MDFNTTPPPNAHNAAIYASIDSHSPGNSPPSGFLSVGDPNMAQRQ FT APASYAGIAPMERVHAFLKTLRKKDIEREVCIEALRDLLDGLRRDVADPYALSQALDKL FT AMSGINRFPRLGQTEAFAHIFAEVLKIPNSKALQDKMIDHFSSDYYVLSHDGLGSYHVV FT PAESMIAVFDEIFNRTIESPLIKRREILPFLALQLDSSHWIGDQTWGALHGRPYNPRPE FT LATRFDWLLNEMARLDDIGRAALSTRLADQLFMLHCLDRNLVLERHQRLLDYVEALPVG FT LQSSPRKTLATAIRWLPEHTRRATYDSMLDAATRLTVGKGEALSGLPEAMIGLSAGEQN FT RRLQQWKYEILPTLDLSDQEPIVAGLIDAFSKLAEGNNPEFALTLALDTLNKTSGGKGL FT NKRQFDYIIRGITDKDNLAHTYSPEILERVLDLGRDIPLETRERLLLDLERWLELRFVN FT KMLGKREQLFLPIQARIREERAELISFPLLNLDPDPSPLTWWDDPSQRKAPDHTNSERR FT RRPIVDWVKARLRRQ" FT CDS complement(575357..576247) FT /transl_table=11 FT /locus_tag="RBRH_01856" FT /db_xref="EnsemblGenomes-Gn:RBRH_01856" FT /db_xref="EnsemblGenomes-Tr:CBW76970" FT /db_xref="UniProtKB/TrEMBL:E5AV46" FT /protein_id="CBW76970.1" FT /translation="MGCSHVSMSNCKTRRRFMCIECGFELVKNCLWRPESKHGMENKLG FT AIVKLPGIGNIRTIISNKTKDGWKELQKNSSVAAKKGQNFILDNIRPLGVNKDVKARWS FT ISASQKPVNRPALPRKINVDFAKVVNNVWLHKTSGSMPPKGINVKLKSSLSGAKIANGF FT FQKTSTVSDKDRDVLQERANNLLKRLDNAEEAINRSRRNVFINRNRNNKENREVLDSRL FT RGIFGEATSEIDLSRRRIHKITQINSYQRSGSLPKAGLSKKQYDDLMKKLDNIELGIQS FT RLRITKNIFDDLYKL" FT CDS complement(576237..576389) FT /transl_table=11 FT /locus_tag="RBRH_04274" FT /db_xref="EnsemblGenomes-Gn:RBRH_04274" FT /db_xref="EnsemblGenomes-Tr:CBW76971" FT /db_xref="UniProtKB/TrEMBL:E5AV47" FT /protein_id="CBW76971.1" FT /translation="MSARHRPTEGKDAQRYSRACTPTQRSKLRIVVYGFAYERVRAQNQ FT SYIGL" FT CDS complement(576400..576720) FT /transl_table=11 FT /locus_tag="RBRH_01857" FT /product="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /function="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /EC_number="2.7.7.7" FT /note="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /note="COG: DNA polymerase III, alpha subunit" FT /note="Pfam: OB-fold nucleic acid binding domain::PF01336" FT /db_xref="EnsemblGenomes-Gn:RBRH_01857" FT /db_xref="EnsemblGenomes-Tr:CBW76972" FT /db_xref="GOA:E5AV48" FT /db_xref="UniProtKB/TrEMBL:E5AV48" FT /protein_id="CBW76972.1" FT /translation="MLPAAALQRYRDGQLARACGLVTVRQRPGTAKGVLFVTLEVESGH FT TNVIIWPSLLERQRKEALGASLLAVYGVWQRQGEVTHLVAQRLVDLSHLLGSLVTTSRN FT FC" FT CDS complement(577008..577373) FT /transl_table=11 FT /locus_tag="RBRH_01859" FT /product="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /function="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /EC_number="2.7.7.7" FT /note="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /note="COG: DNA polymerase III, alpha subunit" FT /db_xref="EnsemblGenomes-Gn:RBRH_01859" FT /db_xref="EnsemblGenomes-Tr:CBW76973" FT /db_xref="GOA:E5AV49" FT /db_xref="InterPro:IPR011708" FT /db_xref="UniProtKB/TrEMBL:E5AV49" FT /protein_id="CBW76973.1" FT /translation="MISRADTVGVFQIESRAQMSMLPRLRPRCFYDLVIEVAIVRSLNR FT SSRRLNSQPMGFYTPSQLVQDARRHGVKVLPVDVTVSDWDSTLQRHSLEVPMRLGLSLI FT RGLAEDAAARIELARAV" FT CDS complement(577370..577831) FT /transl_table=11 FT /locus_tag="RBRH_01860" FT /product="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /function="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /EC_number="2.7.7.7" FT /note="DNA polymerase III alpha subunit (EC 2.7.7.7)" FT /note="COG: DNA polymerase III, alpha subunit" FT /db_xref="EnsemblGenomes-Gn:RBRH_01860" FT /db_xref="EnsemblGenomes-Tr:CBW76974" FT /db_xref="GOA:E5AV50" FT /db_xref="InterPro:IPR011708" FT /db_xref="UniProtKB/TrEMBL:E5AV50" FT /protein_id="CBW76974.1" FT /translation="MVFEISNRILCSGFPKPVFGQCVPHSERKDAERTRGMHTCRRIFE FT RALIIEQWATLAATLLGFPRHLSQHSGGFVISRGKPSRLVPIESAAMPDRSVIQWDKND FT IDALELLKIDILALGMLPVIRRALALVAPSAASRSSCTISPPRMRLPTR" FT CDS complement(578419..578538) FT /transl_table=11 FT /locus_tag="RBRH_01862" FT /db_xref="EnsemblGenomes-Gn:RBRH_01862" FT /db_xref="EnsemblGenomes-Tr:CBW76975" FT /db_xref="UniProtKB/TrEMBL:E5AV51" FT /protein_id="CBW76975.1" FT /translation="MRSASAEFVAVVEDFTLLRWLRGSVRYGQIARHPFKGNK" FT CDS 578601..579299 FT /transl_table=11 FT /locus_tag="RBRH_01863" FT /db_xref="EnsemblGenomes-Gn:RBRH_01863" FT /db_xref="EnsemblGenomes-Tr:CBW76976" FT /db_xref="UniProtKB/TrEMBL:E5AV52" FT /protein_id="CBW76976.1" FT /translation="MARGDVFCPKQGEGAWPASLQRRRPTDTVVDQGFYVIAMDPAHVR FT FVVPPVVLSKREGIGLWLAVTSLTVTAFLMRLDFGIVVLLSEAWTAWRWLRRFEPAMTE FT SQFSISAAGIVWFGSKSGPALIAMHQISRICLVAPHRRRVVLLSLRATSSEPQALPWRR FT PNRRHLAKWGIVVEADGLDYAIAQGLSRHTAVRLARAVRRALHAALRDGHWVCRSSHAD FT MSRIEHCSKY" FT CDS 579327..580964 FT /transl_table=11 FT /locus_tag="RBRH_01864" FT /product="Membrane-bound serine protease (EC 3.4.21.-)" FT /function="Membrane-bound serine protease (EC 3.4.21.-)" FT /EC_number="3.4.21.-" FT /note="Membrane-bound serine protease (EC 3.4.21.-)" FT /note="COG: Membrane-bound serine protease (ClpP class)" FT /note="Pfam: NfeD-like::PF01957" FT /db_xref="EnsemblGenomes-Gn:RBRH_01864" FT /db_xref="EnsemblGenomes-Tr:CBW76977" FT /db_xref="GOA:E5AV53" FT /db_xref="InterPro:IPR002810" FT /db_xref="InterPro:IPR012340" FT /db_xref="UniProtKB/TrEMBL:E5AV53" FT /protein_id="CBW76977.1" FT /translation="MPAGGQPPIRRPGFAQPPRLTQSVIVALKNSANRPTFDKRGFRNS FT VMLLRALRKLCFGWILATLAAGAVPAPAPVVLIPVSGAIGPASADFIERGLARAASLHA FT QLAVIELDTPGGLDPSMRQIIKAMLASPVPVVTFVAPAGARAASAGTYILYASHIAAMA FT PGTNLGAATPIQLGIGGEPSPPGPDSDTATDTPGSRSAEAASGAATAAAEPTSSPTRSI FT GVPDDPRRTGAHKQMQDAAAYIRSLAQLHGRNGEWAERAVRDAVSLPASEALSRHVIDV FT VAGDLDALLAQLDGRWVSTAHGVRTLQTAHAPVVRIAPDWRTRLLAVITNPNVALILMA FT IGMYGLFFEFANPGFVLPGVAGAISLLVGLFALHMLPVNYVGLILILLGVAFLIAEAFL FT PAFGSLGFGGIIAFGIGALMLIDTEVPGFGIPLPLIIALALLSATCFIAISSIALRARR FT RPVVAGAETLVGSTGVMLGELAPSHAGDGASDTGEASNGWARIQGEQWRVRSDHALPGG FT APVRVTGRHGLTLSVVPAAAPPKPGEHS" FT CDS 580964..581728 FT /transl_table=11 FT /locus_tag="RBRH_01865" FT /product="Membrane protease family, stomatin/prohibitin FT homologs" FT /function="Membrane protease family, stomatin/prohibitin FT homologs" FT /note="Membrane protease family, stomatin/prohibitin FT homologs" FT /note="COG: Membrane protease subunits, stomatin/prohibitin FT homologs" FT /note="Pfam: SPFH domain / Band 7 family::PF01145" FT /db_xref="EnsemblGenomes-Gn:RBRH_01865" FT /db_xref="EnsemblGenomes-Tr:CBW76978" FT /db_xref="GOA:E5AV54" FT /db_xref="InterPro:IPR001107" FT /db_xref="InterPro:IPR001972" FT /db_xref="UniProtKB/TrEMBL:E5AV54" FT /protein_id="CBW76978.1" FT /translation="MDLTFGFAGFVVLLVAILVAAIRVFREYERGVVFMLGRFWQVKGP FT GLVLIIPGVQQLVRIDLRTVVLDVPSQDLITHDNVSVKVNAVVYFRVVDPEKAVIQVAR FT YLEATSQLAQTTLRSVLGKHELDELLAEREKLNDDIQKVLDAQTDAWGIKVSNVEIKHV FT DLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLLQAAQMLARQPQAMQLRYLQTL FT TSIAGDKTSTIVFPVPIDLVDALAATARKSGS" FT CDS 581907..582995 FT /transl_table=11 FT /locus_tag="RBRH_01866" FT /product="Ferredoxin--NAD(P)(+) reductase (EC 1.18.1.-)" FT /function="Ferredoxin--NAD(P)(+) reductase (EC 1.18.1.-)" FT /EC_number="1.18.1.-" FT /note="Ferredoxin--NAD(P)(+) reductase (EC 1.18.1.-)" FT /note="COG: Thioredoxin reductase" FT /note="Pfam: Pyridine nucleotide-disulphide FT oxidoreductase::PF00070
Pyridine nucleotide-disulphide FT oxidoreductase::PF07992" FT /db_xref="EnsemblGenomes-Gn:RBRH_01866" FT /db_xref="EnsemblGenomes-Tr:CBW76979" FT /db_xref="GOA:E5AV55" FT /db_xref="InterPro:IPR000103" FT /db_xref="InterPro:IPR001327" FT /db_xref="InterPro:IPR013027" FT /db_xref="InterPro:IPR022890" FT /db_xref="InterPro:IPR023753" FT /db_xref="UniProtKB/TrEMBL:E5AV55" FT /protein_id="CBW76979.1" FT /translation="MRVPAAYREMPDTTESVHEPIRTDVLIIGAGPVGLFAAFEAGVIG FT LTCEVVDTLAQIGGQCTELYPDKPIFDIPAIPVCTARELVERLAEQCRPFNVPIRLGQR FT VVHVEQREDGRWRARTEQQLEFDAAAILISAGNGAFVPQRLALPDAASLEGRHLHYAVR FT NLDDFAGRRVVVAGGGDSALDWALALRHIAQHVTLVHRRNAFRAADSTVEQLRRAADAG FT ELDIVTGTITALRTEHGVLQAVDITQIGAQTSVPAEHVIALYGLVADLGPIAQWGMEIR FT AGRIAVDTSNYESSRPGLFAVGDIAIYPNKQKLILSGFHEAALALRKIYGYAHPERKRV FT HVHSSYDPTLSEKILGTPAASA" FT CDS complement(583214..583306) FT /transl_table=11 FT /locus_tag="RBRH_01867" FT /db_xref="EnsemblGenomes-Gn:RBRH_01867" FT /db_xref="EnsemblGenomes-Tr:CBW76980" FT /db_xref="UniProtKB/TrEMBL:E5AV56" FT /protein_id="CBW76980.1" FT /translation="MKKSRFTDSQIRPNMALGGLTLKQQPAMAA" FT CDS complement(583365..583460) FT /transl_table=11 FT /locus_tag="RBRH_04275" FT /db_xref="EnsemblGenomes-Gn:RBRH_04275" FT /db_xref="EnsemblGenomes-Tr:CBW76981" FT /db_xref="UniProtKB/TrEMBL:E5AV57" FT /protein_id="CBW76981.1" FT /translation="MPQGWIEQPVNQQKRAFDAAEFAQSARETIW" FT CDS 583422..583820 FT /transl_table=11 FT /locus_tag="RBRH_01868" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01868" FT /db_xref="EnsemblGenomes-Tr:CBW76982" FT /db_xref="GOA:E5AV58" FT /db_xref="InterPro:IPR002513" FT /db_xref="UniProtKB/TrEMBL:E5AV58" FT /protein_id="CBW76982.1" FT /translation="MLIDWLLDPALRQRVAAALSKGEARNTLARAVCFNRLDKLHDPPY FT ELQCHRASGLNLAVAARANGELAFPHPPPKCDALREVPQPLATELLPLAEIKLNCDENT FT TYSIVCRASPGRGRIRDRAPEQACMPIP" FT CDS 583864..584118 FT /transl_table=11 FT /locus_tag="RBRH_01869" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_01869" FT /db_xref="EnsemblGenomes-Tr:CBW76983" FT /db_xref="InterPro:IPR006442" FT /db_xref="UniProtKB/TrEMBL:E5AV59" FT /protein_id="CBW76983.1" FT /translation="MTITTLSSRELNHDVTRAKKAANNGPVFITDRGKPAHVLLSFEAY FT QKLTQQRRNIADTLAMPGVEDIEFNPPRANVQTRPADLT" FT CDS 584115..584540 FT /transl_table=11 FT /locus_tag="RBRH_01870" FT /product="Plasmid stability protein stbB" FT /function="Plasmid stability protein stbB" FT /note="Plasmid stability protein stbB" FT /note="COG: Predicted nucleic acid-binding protein, FT contains PIN domain" FT /note="Pfam: PIN domain::PF01850" FT /db_xref="EnsemblGenomes-Gn:RBRH_01870" FT /db_xref="EnsemblGenomes-Tr:CBW76984" FT /db_xref="GOA:E5AV60" FT /db_xref="InterPro:IPR002716" FT /db_xref="InterPro:IPR022907" FT /db_xref="UniProtKB/TrEMBL:E5AV60" FT /protein_id="CBW76984.1" FT /translation="MMYVLDTNVVSELRKVRAGKADANVTAWTTSVDAGWLFVSAITIM FT ELETGVLQIERRDADQGRILRAWIEHHVLPEFADRVLPIDIRVAQRCARLHVPNRQSER FT DALIAATALVHGMTVVTRNVADFAATGVNLLNPWMDT" FT CDS complement(584953..585996) FT /transl_table=11 FT /locus_tag="RBRH_01871" FT /db_xref="EnsemblGenomes-Gn:RBRH_01871" FT /db_xref="EnsemblGenomes-Tr:CBW76985" FT /db_xref="UniProtKB/TrEMBL:E5AV61" FT /protein_id="CBW76985.1" FT /translation="MRRSTNCSMRWMARSPIRRSMSSRLRRCANIWKRCRIASKAEAFK FT RIYAAAQRIPKDGVQIQKALLLHSLRDFHWSHRDELFDFAYARAQRRAPEEENVWTELA FT ESLGSLLFGSPEFVERYQALVARLASLRVSEQAELIPVLCLRMIHFGGSDDPRPELYAV FT LFGQALQLPPSVQGASVGMLASFIWVLPQAERLAPYTQLRDVALSLPDEQLGVALRGLP FT EGLTRLPSEHHAHELQLLEPALLRVLPAQRAQVALGLLMYAYSLDDALVKWVWQQGLSL FT LNGAGEAALCNVLSRLRGAGWLNNLNDHQWNIAKGEITRFMEANQFSEPARARIQDSVP FT WLRSRAH" FT CDS 586494..586766 FT /transl_table=11 FT /locus_tag="RBRH_01872" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01872" FT /db_xref="EnsemblGenomes-Tr:CBW76986" FT /db_xref="UniProtKB/TrEMBL:E5AV62" FT /protein_id="CBW76986.1" FT /translation="MEAPTDRREALEVLPRRGLSQRKACCYLGLGRRVATYTLKQPQKN FT RSVSERLIAAAQEVPRLGYRRMSVWLALGESHVRRMWRALQLNSD" FT CDS 586736..586897 FT /transl_table=11 FT /locus_tag="RBRH_01873" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /db_xref="EnsemblGenomes-Gn:RBRH_01873" FT /db_xref="EnsemblGenomes-Tr:CBW76987" FT /db_xref="GOA:E5AV63" FT /db_xref="InterPro:IPR001584" FT /db_xref="InterPro:IPR012337" FT /db_xref="UniProtKB/TrEMBL:E5AV63" FT /protein_id="CBW76987.1" FT /translation="MASVAAQQRLMRLYGKPAFIRSDNGAEFTAARSCSWLQDAAIGPA FT SIAPGSAW" FT CDS complement(587011..587388) FT /transl_table=11 FT /locus_tag="RBRH_01874" FT /db_xref="EnsemblGenomes-Gn:RBRH_01874" FT /db_xref="EnsemblGenomes-Tr:CBW76988" FT /db_xref="UniProtKB/TrEMBL:E5AV64" FT /protein_id="CBW76988.1" FT /translation="MRKPSHSAFIRRCCFTFATVLSMAGCSSATNGGHDASPLAQDKPL FT IYVSSLRSMRDVSACLRERLPNVRASRSGETTELDIGRGSWVILLTPSATGGTIVSVAQ FT PARGAEPEESTMRFHVARCLT" FT CDS complement(587996..588328) FT /transl_table=11 FT /locus_tag="RBRH_01875" FT /product="Quaternary ammonium compound-resistance protein" FT /function="Quaternary ammonium compound-resistance protein" FT /note="Quaternary ammonium compound-resistance protein" FT /note="COG: Membrane transporters of cations and cationic FT drugs" FT /note="Pfam: Small Multidrug Resistance protein::PF00893" FT /db_xref="EnsemblGenomes-Gn:RBRH_01875" FT /db_xref="EnsemblGenomes-Tr:CBW76989" FT /db_xref="GOA:E5AV65" FT /db_xref="InterPro:IPR000390" FT /db_xref="UniProtKB/TrEMBL:E5AV65" FT /protein_id="CBW76989.1" FT /translation="MLAYLYLAIAIVAEVIGTSALKASDGFTRLLPSVITALGYAVAFY FT CLSLTLRSVSVGIAYAIWSGVGIVLISLVAFFVYDQRLDWPAVTGMGFIVAGVVLMNGF FT SKTAAH" FT CDS complement(588514..588753) FT /transl_table=11 FT /locus_tag="RBRH_01876" FT /db_xref="EnsemblGenomes-Gn:RBRH_01876" FT /db_xref="EnsemblGenomes-Tr:CBW76990" FT /db_xref="UniProtKB/TrEMBL:E5AV66" FT /protein_id="CBW76990.1" FT /translation="MTARSHDGAPRRHYGDCARQNIRKGSIVCCCLPRSRRILPGSARI FT VRRSARFIGELAQATAIVTPLSQEASREARERWC" FT CDS 589305..591692 FT /transl_table=11 FT /locus_tag="RBRH_03441" FT /product="Squalene--hopene cyclase (EC 5.4.99.17)" FT /function="Squalene--hopene cyclase (EC 5.4.99.17)" FT /EC_number="5.4.99.17" FT /note="Squalene--hopene cyclase (EC 5.4.99.17)" FT /note="COG: Squalene cyclase" FT /note="Pfam: Prenyltransferase and squalene oxidase FT repeat::PF00432" FT /db_xref="EnsemblGenomes-Gn:RBRH_03441" FT /db_xref="EnsemblGenomes-Tr:CBW76991" FT /db_xref="GOA:E5AV67" FT /db_xref="InterPro:IPR001330" FT /db_xref="InterPro:IPR002365" FT /db_xref="InterPro:IPR006400" FT /db_xref="InterPro:IPR008930" FT /db_xref="InterPro:IPR018333" FT /db_xref="UniProtKB/TrEMBL:E5AV67" FT /protein_id="CBW76991.1" FT /translation="MPISAASTCRATRSRQPASCTSRLTRSAPRRSTAPARPWLPTRAS FT TLHKPPRSWHGIRAAWSLRRASWRKPITRYSRSWSGVALLRRVSACACRVRASCWPLPD FT TGCSDHAAGPPPAVRRTAELLRGIRMNMLHEPLNPDVDDARTAHASAPPNERLEQAIRS FT ATNALLDAQHDDGHWLFELEADATIPAEYVLMVHYLGETPDPVLEAKIGAYLKRIQGEH FT GGWPLFHDGAFDMSASVKAYFALKMIGEPLDAPHMKRARDAILARGGAAKSNVFTRILL FT ALYGILDWRAVPMMPVEIMLLPTWFPFHLSKVSYWARTVIVPLLVLQAKRPRARNPRGI FT GIDEIFVGSPRDIGPISKAAHQSQGWFSFFSTIDALLRKLDPYFPKQSRQKAIDAAVHF FT VDARLNGEDGLGAIFPAMVNSVLMYDVLGYPPDHPHRAIARKSIDKLLVIHEHEAYCQP FT CLSPVWDTALTAHALLETGEPRAIEHAAKGLDWLLPLQVLDTRGDWISRRATVRPGGWA FT FQFANPHYPDVDDTAVVAMAMDRVEKLQVRDRYRNAIDRACEWVVGMQSHNGGWGAFEP FT ENTHLYLNNIPFSDHGALLDPPTVDVSSRCLSMLAQLPSTPQRQTSASRAKHYILADQE FT DDGSWYGRWGMNYIYGTWSALCGLRAAGVAPDTLPLRRAAHWLRSIQNPDGGWGEDGDS FT YKLDYRGYERAPSTASQTAWALLGLMAAGCEHDEAVARGIAYLLDTQNDEGLWDETLFT FT ATGFPRVFYLRYHGYRKFFPLWALARYRNLAVRNACTVACGM" FT CDS 591626..592462 FT /transl_table=11 FT /locus_tag="RBRH_03440" FT /product="5'-methylthioadenosine nucleosidase (EC 3.2.2.16) FT / S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" FT /function="5'-methylthioadenosine nucleosidase (EC FT 3.2.2.16) / S-adenosylhomocysteine nucleosidase (EC FT 3.2.2.9)" FT /EC_number="3.2.2.16" FT /note="5'-methylthioadenosine nucleosidase (EC 3.2.2.16) / FT S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" FT /db_xref="EnsemblGenomes-Gn:RBRH_03440" FT /db_xref="EnsemblGenomes-Tr:CBW76992" FT /db_xref="GOA:E5AV68" FT /db_xref="InterPro:IPR000845" FT /db_xref="UniProtKB/TrEMBL:E5AV68" FT /protein_id="CBW76992.1" FT /translation="MGARTLPQSRRTQRMHRSLRDVMHDAPVVVVTGLAFEARIAAGPG FT VRVICQQNAGLATTLDAIVAQSRSCSGLVSFGTAGALLESLRPGALLVARSVLAADPCR FT LRQASAAARDDATPVSAQRYASDEPWSHALLERLNGAVHADLAGITTPVSQAADKQRLQ FT HMCGAWAADMESHIVARVAYAHGLPFVCVRAIVDPAERSVPPAAVAALNDDGSTDLGAV FT LRSLLAHPGQLPALLALARDARDARRALITARRRIGNAFGFPSRASGRAAVTSAGG" FT CDS complement(592612..593766) FT /transl_table=11 FT /locus_tag="RBRH_03439" FT /product="HpnB protein" FT /function="HpnB protein" FT /note="HpnB protein" FT /note="COG: Glycosyltransferases involved in cell wall FT biogenesis" FT /note="Pfam: Glycosyl transferase family 2::PF00535" FT /db_xref="EnsemblGenomes-Gn:RBRH_03439" FT /db_xref="EnsemblGenomes-Tr:CBW76993" FT /db_xref="InterPro:IPR017832" FT /db_xref="UniProtKB/TrEMBL:E5AV69" FT /protein_id="CBW76993.1" FT /translation="MLTAIAVLSLVIWIVLLVARGGFWQAQERDDRDSPATGAPDAWPA FT VVAVIPARNEAASIAQTVSSLLRQDYRGSVRIVVVDDHSEDGTAALARDAARAMGAAER FT LTVLRGEPLPAGWTGKLWAVRQGIEAAHATDPPPAWWLLTDAAIEHAPDNLRQLVTRAI FT VDRRVMVSLMAKLRCDAWFERALIPAFVLFFQMLYPFSWVNRRDHPMAAAAGGCMLVQE FT EALRAAGGIEAIRDEIIDDCALGARMKTQGAIWLGLTNRARSVRPYDNLGEIHRMVART FT AYAQLHYSPWLLCGTIVSLLVTFVAPPLLALFGSGLARVAGALGWAAMTFAYLPMLRFY FT GRSRWWGPCLPVIAALYTAFTLDSALQHWRGRGGMWKGRAQARR" FT CDS complement(593770..594765) FT /transl_table=11 FT /locus_tag="RBRH_03438" FT /product="Nucleoside-diphosphate-sugar epimerases" FT /function="Nucleoside-diphosphate-sugar epimerases" FT /note="Nucleoside-diphosphate-sugar epimerases" FT /note="COG: Nucleoside-diphosphate-sugar epimerases" FT /note="Pfam: 3-beta hydroxysteroid dehydrogenase/isomerase FT family::PF01073
NAD dependent epimerase/dehydratase FT family::PF01370
Male sterility FT protein::PF07993
NmrA-like family::PF05368" FT /db_xref="EnsemblGenomes-Gn:RBRH_03438" FT /db_xref="EnsemblGenomes-Tr:CBW76994" FT /db_xref="GOA:E5AV71" FT /db_xref="InterPro:IPR001509" FT /db_xref="InterPro:IPR016040" FT /db_xref="InterPro:IPR017829" FT /db_xref="UniProtKB/TrEMBL:E5AV71" FT /protein_id="CBW76994.1" FT /translation="MSVRVLVTGASGFVGSALARAALARGYRVRALVRASSPRGNLRDL FT DIELAEGDMRDVASVERALDQVDVLFHVAADYRLWARDSHEIMRANADGTRCVMQAALR FT RRVERVVYTSSVATLRVSGATGPLDETAPADEASTIGVYKRSKVAAERIVEQMVAQQGL FT PAVIVNPSTPIGPRDIKPTPTGRIIVEAATGKIPAFVDTGLNLVHVDDVAQGHLLAMDH FT GRIGERYILGGDDVLLREMLAAIARMVGRKPPSIELPRWPLYPIALAAQGLAQWTGREP FT FVTVDALRMSRYHMFFSSAKARRELGYRARPHSDGLRDALDWFRTNGYLR" FT CDS complement(594765..595886) FT /transl_table=11 FT /locus_tag="RBRH_03437" FT /product="Molybdenum cofactor biosynthesis protein A" FT /function="Molybdenum cofactor biosynthesis protein A" FT /note="Molybdenum cofactor biosynthesis protein A" FT /note="COG: Predicted Fe-S oxidoreductases" FT /note="Pfam: Radical SAM superfamily::PF04055" FT /db_xref="EnsemblGenomes-Gn:RBRH_03437" FT /db_xref="EnsemblGenomes-Tr:CBW76995" FT /db_xref="GOA:E5AV70" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR017833" FT /db_xref="InterPro:IPR022563" FT /db_xref="UniProtKB/TrEMBL:E5AV70" FT /protein_id="CBW76995.1" FT /translation="MAIPFLQSAYVGAYLVKQRLKRNKRYPLVLMLEPLFRCNLACSGC FT GKIDYPDPILNQRVSVAEALEAVDECGAPVVSIAGGEPLLHKDMPEIVKGIIARRKFVY FT LCTNALLLEKKIKDYQPSPFFVWSIHLDGDREMHDKSVCQEGVYDRCVSAIKLAKSRGF FT RVNINCTLFNDAQPEQVATFFDEVKRLGIDGITVSPGYAYERAPNQQHFLNREKTKNLF FT RDILRRGKGGKAWSFSQSSLFLDFLAGNRTYHCTPWGNPTRTVFGWQRPCYLLGEGYTK FT TYRELMETTDWDRYGTGNYEKCADCMVHSGYEATAVNDTISHPWRALGVSLRGVKTEGP FT FAPDVSFDRQRPAEYVFSRHVEIKLAELRQSKT" FT CDS complement(595903..596838) FT /transl_table=11 FT /locus_tag="RBRH_03436" FT /product="4-hydroxy-3-methylbut-2-enyl diphosphate FT reductase (EC 1.17.1.2)" FT /function="4-hydroxy-3-methylbut-2-enyl diphosphate FT reductase (EC 1.17.1.2)" FT /EC_number="1.17.1.2" FT /note="4-hydroxy-3-methylbut-2-enyl diphosphate reductase FT (EC 1.17.1.2)" FT /note="COG: Penicillin tolerance protein" FT /note="Pfam: LytB protein::PF02401" FT /db_xref="EnsemblGenomes-Gn:RBRH_03436" FT /db_xref="EnsemblGenomes-Tr:CBW76996" FT /db_xref="GOA:E5AV72" FT /db_xref="InterPro:IPR003451" FT /db_xref="UniProtKB/TrEMBL:E5AV72" FT /protein_id="CBW76996.1" FT /translation="MENSMQVILAQPRGFCAGVVRAIEIVERALQKYGAPVYVRHEIVH FT NRHVVESLKAKGARFIDELSEAPPGAVTIFSAHGVAKAVEDEAHERGLRVLNATCPLVT FT KVHLQGKNYLKSGRQVILIGHAGHPEILGTMGQIDGPVSLVQTEADVERLDIPVDTPVS FT YVTQTTLSVDETRGIIAALKRRFTDIVGPDTKDICYATQNRQTAVRELCKRADVLLVVG FT ATNSSNSNRLREIGAESGVPSYLLADGSELNPQWVRGANTIGLTAGASAPESMVNDVID FT ALRRLGPVDVSVMDGIEENIQFRLPAELTA" FT CDS complement(596946..597578) FT /transl_table=11 FT /locus_tag="RBRH_03435" FT /product="Toluene transport system Ttg2D protein" FT /function="Toluene transport system Ttg2D protein" FT /note="Toluene transport system Ttg2D protein" FT /note="COG: ABC-type transport system involved in FT resistance to organic solvents, auxiliary component" FT /note="Pfam: Toluene tolerance, Ttg2::PF05494" FT /db_xref="EnsemblGenomes-Gn:RBRH_03435" FT /db_xref="EnsemblGenomes-Tr:CBW76997" FT /db_xref="InterPro:IPR008869" FT /db_xref="InterPro:IPR023094" FT /db_xref="UniProtKB/TrEMBL:E5AV73" FT /protein_id="CBW76997.1" FT /translation="MNKWLTFLVALCVFGTAGTALAQTSKGGAASPSDAVRSAVENVVK FT ATRADVAARSGDVNATSKIVEREFLPYTDFARTTRIAVGAAAWKQATPAQRKQLVEQFQ FT KLLVHTYALQLTQIRDQNVRFRFEPAALSAKGTDAVVKTRVQGSGDDMDVGYRLGKGRD FT GWRIYDIDMMGAWLIQIYQQQFASQIAQGGIDGLIQYLSAHNARFGQ" FT CDS 597673..600378 FT /transl_table=11 FT /locus_tag="RBRH_03434" FT /product="Acriflavin resistance plasma membrane protein" FT /function="Acriflavin resistance plasma membrane protein" FT /note="Acriflavin resistance plasma membrane protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_03434" FT /db_xref="EnsemblGenomes-Tr:CBW76998" FT /db_xref="GOA:E5AV74" FT /db_xref="InterPro:IPR004869" FT /db_xref="InterPro:IPR017841" FT /db_xref="UniProtKB/TrEMBL:E5AV74" FT /protein_id="CBW76998.1" FT /translation="MPHPVYSAPNPEFQAIPMLTSLLVRTVRFSARHAYFVIAVSILLC FT AASIVYIAKHFAIDTDVAGLIDQNTPWAQRGKAIDDAFPQRADVTLALVQAPAAEFAQR FT AAAELAVRLKSETAYFSCVTRPDGGAFFERHGLLFMSQNELTELTGKLVDARPLLNRLA FT HDPSLRGLSSLLSVTLLTPLQTGQVTLPGMAKLLGRSADTIDAVLAGQPAGLSWSGLVA FT PELPSRAFVQVQPLLDYRSLEAGAAAAARIKQVAAELQLAQRYGASVQLTGPRPLADEE FT FGSVREGAVPNAIGTLLTVLVILWFAVRSRRMVFAVFVTLLVGLTITAALGLMMVGALN FT MISVAFAVLFVGIGVDFGIQFAVRYREQFHLGGHLERALEGTARSIAMPLSLAAAATAA FT SFFSFLPTAYRGISELGQIAGVGILFVALPSCVTLLPALISVLRPTGRGAAPGFKSFAP FT LDEFTERHRKPLLLVTLALIAAGLPLLTQLRFDFNPLHLKDPNSESMRTLASLASASDT FT GVNDVQLLAASLGDAQQAANKLRALPEVGRVVTAASFVPDDQPQKLTTIAQAARQLLPV FT LEQTPSDPAPDGARVSALRNAAAMLESAALDHPGPGAKEAEHLAASLRKLAAADAATRD FT RAERAIAKPLQWSLASLANLLKPTSITLQTLPAELRSQWVTSDGRALVQISPKLATSMN FT PDDDTKLRAFSAAVLAAEPQAIGGPISILHSADTIVHAFVQAGVLALVSITVLLWIALR FT SLGDVLRTLVPLLVSAVVTLELSVVLNLPLNFANIIALPLLLGVGVAFKIYYVMAWRAG FT ATKLLQSGLTQAVILSAGTTATAFGSLWLSHHPGTSSMGELLALSLVCTLIGAVFFQPV FT LMGKPREQAARTAASQRTHDKPRADDAKSR" FT CDS complement(600398..600850) FT /transl_table=11 FT /locus_tag="RBRH_03433" FT /db_xref="EnsemblGenomes-Gn:RBRH_03433" FT /db_xref="EnsemblGenomes-Tr:CBW76999" FT /db_xref="UniProtKB/TrEMBL:E5AV75" FT /protein_id="CBW76999.1" FT /translation="MPSPAQASQPAGIYPDDSPILRPERESDRLPSAVPHASTATLLPA FT PLEGLSTFPLPELVSAAGAARDSGLATHSAAATAQQGSAGLPPFVLGPLPPLPYEREQA FT SRSLSDDDRADILAYADAVPSPSEPVTRASAQWGRCDIIGHAAPAA" FT CDS complement(601053..602135) FT /transl_table=11 FT /locus_tag="RBRH_03432" FT /db_xref="EnsemblGenomes-Gn:RBRH_03432" FT /db_xref="EnsemblGenomes-Tr:CBW77000" FT /db_xref="UniProtKB/TrEMBL:E5AV76" FT /protein_id="CBW77000.1" FT /translation="MSIPPIRSVRIASPSDERNASLQRSPVTASAQHTHLILDGLQRRR FT SSAADGVDIPATRRDSLARQLDAHFDTDWHPLYHAPWTQAAMEPASAWDPLPVWQAEPA FT SPLSSIGAQRRDALLLLPSARYLAAHGMPLSELGLELNASSHDDEPRTSGVRADGGEPR FT PSDKLTHDDLRALVRSLTQHVERRRLRAMLRAAQRAAHAIAPPADLNDGATYRSTLREA FT IRQYMCPRSTRALRQAVCRYAPVFGEPALAGPVSDSTLKAMLGAAAVDGRLPMNLAELV FT LLPDGMTQPLRQRAKEAGGVIAPVPRQGDEAGADDAQQAMSALEALQANGTISEDQYIA FT AANRLASLLGYRVGSYPRAV" FT CDS complement(602086..602184) FT /transl_table=11 FT /locus_tag="RBRH_03431" FT /db_xref="EnsemblGenomes-Gn:RBRH_03431" FT /db_xref="EnsemblGenomes-Tr:CBW77001" FT /db_xref="UniProtKB/TrEMBL:E5AV77" FT /protein_id="CBW77001.1" FT /translation="MTRRYPPGVLHVDGGIDVDTTHTFGPHRVAIG" FT CDS complement(602181..602273) FT /transl_table=11 FT /locus_tag="RBRH_04276" FT /db_xref="EnsemblGenomes-Gn:RBRH_04276" FT /db_xref="EnsemblGenomes-Tr:CBW77002" FT /db_xref="UniProtKB/TrEMBL:E5AV78" FT /protein_id="CBW77002.1" FT /translation="MCYWPVAGQPDKTLTFAGVGRDIASASRQR" FT CDS complement(602282..604249) FT /transl_table=11 FT /locus_tag="RBRH_03430" FT /product="1-deoxy-D-xylulose 5-phosphate synthase (EC FT 2.2.1.7)" FT /function="1-deoxy-D-xylulose 5-phosphate synthase (EC FT 2.2.1.7)" FT /EC_number="2.2.1.7" FT /note="1-deoxy-D-xylulose 5-phosphate synthase (EC FT 2.2.1.7)" FT /note="COG: Deoxyxylulose-5-phosphate synthase" FT /note="Pfam: Transketolase, pyrimidine binding FT domain::PF02779
Transketolase, C-terminal FT domain::PF02780" FT /db_xref="EnsemblGenomes-Gn:RBRH_03430" FT /db_xref="EnsemblGenomes-Tr:CBW77003" FT /db_xref="GOA:E5AV79" FT /db_xref="InterPro:IPR005474" FT /db_xref="InterPro:IPR005475" FT /db_xref="InterPro:IPR005476" FT /db_xref="InterPro:IPR005477" FT /db_xref="InterPro:IPR009014" FT /db_xref="InterPro:IPR020826" FT /db_xref="UniProtKB/TrEMBL:E5AV79" FT /protein_id="CBW77003.1" FT /translation="MAAQKNRHSRPAQPGVSTANPMTLLLPTIDHPAQLRSLSCTDLKA FT LANELRAFVLDSVSRTGGHLSSNLGTVELTIALHYVFDTPKDRIVWDVGHQTYPHKILT FT GRRDQMSTLRQWNGISGFPRRSESQFDAFGTAHSSTSISAALGMAVASQLKGEHHRAIA FT VIGDGAMTAGEAFEALNNAGVCEDIPLLVVLNDNDMSISPPVGALNQYLVKLMSGRFYA FT NAKEGVRKILPLPMLAFAHKLEEHAKGMVTPATLFEEFGFNYIGPIDGHDLDALIPTLQ FT NIRGLRGPQFLHVVTKKGQGYKLAEADPVLYHGPGKFNPAEGIKPAASSKKTYTQVFGE FT WLCDAAELDPRVVGITPAMREGSGLVEFEQRFPQRYFDVGIAEQHAVTFAGGLAAEGLK FT PVVAIYSTFLQRGYDQLIHDVALQNLPVVFALARAGLVGADGATHAGAYDMAYLRCIPN FT MVVMAPADENECRQMLHTGLQIEGPSAVRYPRGTGPGVATHKRLSAMPVGKGEIRRQSQ FT APAGHRVAILAFGSMLAPSLTAAQEFDATVANMRFVKPLDEALVRQLADTHELLVTVEE FT GTLMGGAGSAVAEALACHGKLVPLMQLGLPDTFIDHGDAAQQLASVGLDATGIAASIRR FT GITDRLSRPPVRVTQGKRSA" FT CDS complement(604301..605494) FT /transl_table=11 FT /locus_tag="RBRH_02825" FT /product="(2-aminoethyl)phosphonate--pyruvate transaminase FT (EC 2.6.1.37)" FT /function="(2-aminoethyl)phosphonate--pyruvate transaminase FT (EC 2.6.1.37)" FT /EC_number="2.6.1.37" FT /note="(2-aminoethyl)phosphonate--pyruvate transaminase (EC FT 2.6.1.37)" FT /note="COG: Serine-pyruvate aminotransferase/archaeal FT aspartate aminotransferase" FT /note="Pfam: Aminotransferase class-V::PF00266" FT /db_xref="EnsemblGenomes-Gn:RBRH_02825" FT /db_xref="EnsemblGenomes-Tr:CBW77004" FT /db_xref="GOA:E5AV80" FT /db_xref="InterPro:IPR000192" FT /db_xref="InterPro:IPR012703" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="InterPro:IPR024169" FT /db_xref="UniProtKB/TrEMBL:E5AV80" FT /protein_id="CBW77004.1" FT /translation="MYQNTARLVREPATTVRDARASEEAFDEPHRTVCGRPLMLLLNPG FT PVTLTERVRQSLLQPDLCHREPEFYDLQQEARERLVGVYALDSAEWQAVLMTASGTGAV FT ESMVAALVPEHGRLLVVENGVYGERITHIARHYRIDHEVAAHRWIDAPDVQALAARLDD FT AARAQRPFTHVALVHHETTTGRLNELGGVLAACRARGVGVLLDGVSSFGAEAIDFADPA FT LVAVAATANKCLHGVPGASFVVVRRAALADAASRAFYLDLGRLARLQDERNTPFTPSVH FT AYYALVEALRELEDEGGWRERHARYRKLAEQVRDGLARLGVDGVLSPQESSVVLRAYRL FT PPKIDYAQLHDALKLHGFVIYAGQGGLSAELFRISTMGNLTAHDMDRLLRAFGQWLA" FT CDS complement(606542..608359) FT /transl_table=11 FT /locus_tag="RBRH_02824" FT /product="Isocitrate lyase family protein / FT Nucleotidyltransferase family protein" FT /function="Isocitrate lyase family protein / FT Nucleotidyltransferase family protein" FT /note="Isocitrate lyase family protein / FT Nucleotidyltransferase family protein" FT /note="COG: PEP phosphonomutase and related enzymes" FT /db_xref="EnsemblGenomes-Gn:RBRH_02824" FT /db_xref="EnsemblGenomes-Tr:CBW77005" FT /db_xref="GOA:E5AV81" FT /db_xref="InterPro:IPR012698" FT /db_xref="InterPro:IPR015813" FT /db_xref="InterPro:IPR025877" FT /db_xref="UniProtKB/TrEMBL:E5AV81" FT /protein_id="CBW77005.1" FT /translation="MDRNRFCRGCRARANAGTALAAAGGRGEHERITLRQELVEFMNAP FT DTFVARAPSRAARLRRMLTSDKLEFMMEAHNGLSARIVREAGFDAIWASGLAISAQYGV FT RDNNEASWTQVVDTLEFMVDASDLPILLDGDTGYGNFNNVRRLVKKLEQRGVAGVCIED FT KQFPKTNSFIGGERQPLADVDEFCGKIKAGKDSQGDPDFSIVARVEALIAGWGMDEALR FT RAEAYHAAGADAILIHSKLARADEIVAFAREWAHRAPLVIVPTKYYSTPTQVFRNAGIS FT VVIWANHLIRAATSAMQAVAKEIHDSETLVGVEDRVASVNEIFRLQGADEYSAAERVYL FT TARAPRTALVLAASRGRGLEAVTAQRPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGG FT YRADAIDTAGIRLVVNERHETTGELASLACATQAFEHDTVISYGDLLFRSYILHDLVES FT DAHFCVIVDSSQTQPTNQSVRDFAYCSSGDDRGLFGQKVVLRRVSSEATAPDGTAPHGR FT WIGLLGVHGEGREKLQRIFATLRERGDFDSLDMPALLNALVDAGEQIEVQYVHGHWRGV FT NDLDDFRRAADFAHTQVPIAEASAGGGND" FT CDS complement(608257..609033) FT /transl_table=11 FT /locus_tag="RBRH_02823" FT /product="Mannose-1-phosphate guanyltransferase (EC FT 2.7.7.13)" FT /function="Mannose-1-phosphate guanyltransferase (EC FT 2.7.7.13)" FT /EC_number="2.7.7.13" FT /note="Mannose-1-phosphate guanyltransferase (EC 2.7.7.13)" FT /note="COG: Predicted sugar nucleotidyltransferases" FT /db_xref="EnsemblGenomes-Gn:RBRH_02823" FT /db_xref="EnsemblGenomes-Tr:CBW77006" FT /db_xref="GOA:E5AV82" FT /db_xref="InterPro:IPR025877" FT /db_xref="UniProtKB/TrEMBL:E5AV82" FT /protein_id="CBW77006.1" FT /translation="MRAIILAAGRGLRLVQPENKQLPKCLLQFDGMTLLERHLQLLRAV FT GVGEIVLALGFHHETIEAELLRLGWAPPPRIVLNPDYELGSVLTVHVVSDALCAGGDVL FT LMDADVLYDERIMAPLVAGKHVNRLLIDRDVEPGDEPVKLCLRDGVPIELRKQVAADLR FT YDTMGESVGFFRLTEGAAQRLAQIAADYVGSGRANLPHEEALRDLLLERSHVFEAADVT FT GAPWIEIDFAADVERARTQVLPLLQPVVVASTNASR" FT CDS complement(609120..610145) FT /transl_table=11 FT /locus_tag="RBRH_02822" FT /product="Hypothetical membrane spanning protein" FT /function="Hypothetical membrane spanning protein" FT /note="Hypothetical membrane spanning protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02822" FT /db_xref="EnsemblGenomes-Tr:CBW77007" FT /db_xref="InterPro:IPR022791" FT /db_xref="UniProtKB/TrEMBL:E5AV83" FT /protein_id="CBW77007.1" FT /translation="MGRQVNTHMTRAAWISLTIGASLFVALLAWQGIAPLMAALSAAGF FT GLLLVAAFHGLPVVLDAAAIRVLAGDRGGVTIGDAVLTRWAGESVNSLLPAGQIGGPLL FT MVRHLAQRRLSLPESAAVITVSTTWQTIAQVVFALLGLAVFAADAAHGALDNLRTPLLA FT ASTGFALLLYGFYMAQRRRLFGRLSRVMSKLSARRDWSALFDRADAVDAHVAALYRQPR FT AVAVSFALSLSGWIVGTGEVWLILKLIGHPVGWGDALLLESIGQAIRGAAFMIPGSLGV FT QEGGYLLLAPLVGLPPDTALALSLAKRAREILLGVPGLVYLHFSEHRWQRRRAVRMPAA FT D" FT CDS complement(610130..610927) FT /transl_table=11 FT /locus_tag="RBRH_02821" FT /db_xref="EnsemblGenomes-Gn:RBRH_02821" FT /db_xref="EnsemblGenomes-Tr:CBW77008" FT /db_xref="GOA:E5AV84" FT /db_xref="InterPro:IPR005123" FT /db_xref="UniProtKB/TrEMBL:E5AV84" FT /protein_id="CBW77008.1" FT /translation="MRLGAMNATAGLARDGAGVGHQCSTIVDASMHERIATLDTERLRE FT TFGEQGAFLFLDTFLAPDMTTRLVDAVRRVDGEVNRNYLPGHKQGGSVSRHTIDRLAPV FT IAQLYRSPALIRWLEALCGDRLMACPDTDPHAYALYFYTKPGDHIGWHYDTSYYHGQRY FT TLLLGVVDESSCKLEYRLHTREPGLPVVEAAVQLPPGGLVFFDGDKLQHRITPLGVNER FT RVSLTFEYVTDPSMGRLQRFVSNMKDAIAYFGFRQVFRQWAGK" FT CDS complement(610909..611658) FT /transl_table=11 FT /locus_tag="RBRH_02820" FT /product="CDP-alcohol phosphatidyltransferase (EC 2.7.8.-)" FT /function="CDP-alcohol phosphatidyltransferase (EC FT 2.7.8.-)" FT /EC_number="2.7.8.-" FT /note="CDP-alcohol phosphatidyltransferase (EC 2.7.8.-)" FT /note="Pfam: CDP-alcohol phosphatidyltransferase::PF01066" FT /db_xref="EnsemblGenomes-Gn:RBRH_02820" FT /db_xref="EnsemblGenomes-Tr:CBW77009" FT /db_xref="GOA:E5AV85" FT /db_xref="InterPro:IPR000462" FT /db_xref="UniProtKB/TrEMBL:E5AV85" FT /protein_id="CBW77009.1" FT /translation="MRTWPWTAMGAQKGYISGMEKRQNMAFGTSSDMPAPPRQWDARLA FT RRLVMPLKDTSVTPNHLTTLRLLIGLAGAAALAAGGYGWANVGALLIVLSNFVDHTDGE FT LARISGKSSRLGHFYDLAADALVTIGLFVGMGLGVPADAHASLPAVPVWLGWVAGLAVA FT LIFFLRMRIEQRAGKAGTRQAFLAGFETEDVLYLLPLVTLLDGVTPFLLVAAIGAPLFA FT AWVALDYRRTMRRGTQTAAASHCGSAP" FT CDS complement(611818..612933) FT /transl_table=11 FT /locus_tag="RBRH_02819" FT /product="Potassium/proton antiporter rosB" FT /function="Potassium/proton antiporter rosB" FT /note="Potassium/proton antiporter rosB" FT /note="COG: Kef-type K+ transport system, predicted FT NAD-binding component" FT /note="Pfam: TrkA-N domain::PF02254" FT /db_xref="EnsemblGenomes-Gn:RBRH_02819" FT /db_xref="EnsemblGenomes-Tr:CBW77010" FT /db_xref="GOA:E5AV86" FT /db_xref="InterPro:IPR003148" FT /db_xref="InterPro:IPR006153" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:E5AV86" FT /protein_id="CBW77010.1" FT /translation="MAAGCSRACCSWWPAPVRASYFTLCVIVAAVGVAYGSARLFDVSF FT ALGAFFAGMMMRESEFSHRAADQTLPLRDAFSVLFFVSVGMLFDPHVLINAPLHVLGVV FT AIIMVGKTVAAVALVLAFRYPLNSALTVGASLAQIGEFSFILAGLGMSLGLLPKEGQDL FT ILAGSLISIALNSLVFAAIEPAQAWIRNRSSLARRMECREDPLAALPMTVPQAHLTGQV FT VIVGYGRVGRRVAQTLAMHRIPYVVAEQHRDIVEKLRAEQVPAVCGDASDPMVLVQAHV FT ARAGMLVVTLPDTFDVRKIVDTARTLNPSIEAVLCTDNDDEAALLESERVGTVFIGDSE FT LARGMTAHVLSRMTSAATGVGVDATSASGHL" FT CDS 613590..614378 FT /transl_table=11 FT /locus_tag="RBRH_02818" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02818" FT /db_xref="EnsemblGenomes-Tr:CBW77011" FT /db_xref="UniProtKB/TrEMBL:E5AV87" FT /protein_id="CBW77011.1" FT /translation="MRLLQKSGDKLTKALMIRELNVSMAIDVLEMAGITHKNDARWAGR FT APCPARRVKLPSHLNQGSSMELHEQIDAVQRLIDRLASAVPAAPAAPAASAAPAASATS FT ATSATSATSATSATSATSATSATSAASAASAASATSATPADSTKETANDPTPPQLHFNR FT PSQNEIVVTLGEHSVTLGPADISAIIEELAIARASMTPEPPAALPPGWRFAATQDPAIA FT TQSRNNGSKLVVFRHTGYGWVPFTFTPNMVMNLLAALSAK" FT CDS 614900..615868 FT /transl_table=11 FT /locus_tag="RBRH_02817" FT /product="C4-dicarboxylate transport protein" FT /function="C4-dicarboxylate transport protein" FT /note="C4-dicarboxylate transport protein" FT /note="COG: Na+/H+-dicarboxylate symporters" FT /note="Pfam: Sodium:dicarboxylate symporter FT family::PF00375" FT /db_xref="EnsemblGenomes-Gn:RBRH_02817" FT /db_xref="EnsemblGenomes-Tr:CBW77012" FT /db_xref="GOA:E5AV88" FT /db_xref="InterPro:IPR001991" FT /db_xref="InterPro:IPR018107" FT /db_xref="UniProtKB/TrEMBL:E5AV88" FT /protein_id="CBW77012.1" FT /translation="MKKPLYKVLYVQVLFAIALGILLGHYYPQLAIQMKPLGDAFIKLI FT KLVIGPIIFCTVVSGIAGMQDMKKVGRVGGKALLYFEVVSTFALLIGLAATHILKPGVG FT LNVDPATLDSKAASIYVQKAHGQTTVDFLIHLIPDTFFSAFAQGDILQILLIAILFGSV FT LAHLGERGAKVSAFISSISQVFFGMVHLITKVAPLGAFGAMAFTIGKYGVGSLLPLLKL FT IGTFYLTSLLFVLVVLGTIARAVGFSIVRFLGYIKEELLIVLGTSSSEAALPHLMEKLE FT KLGCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATPY" FT CDS 615846..616181 FT /transl_table=11 FT /locus_tag="RBRH_04277" FT /product="C4-dicarboxylate transport protein" FT /function="C4-dicarboxylate transport protein" FT /note="C4-dicarboxylate transport protein" FT /note="COG: Na+/H+-dicarboxylate symporters" FT /db_xref="EnsemblGenomes-Gn:RBRH_04277" FT /db_xref="EnsemblGenomes-Tr:CBW77013" FT /db_xref="GOA:E5AV89" FT /db_xref="InterPro:IPR001991" FT /db_xref="UniProtKB/TrEMBL:E5AV89" FT /protein_id="CBW77013.1" FT /translation="MHRRPHTDLTWGQQLTLLAVAMLTSKGASGVTGAGFITLAATLAV FT VPTIPLAGMVLILGIDRFMSECRALTNIIGNGVATVVVSAWEHELDRDKLKRVMRQPAS FT IEAEATA" FT CDS 616243..618132 FT /transl_table=11 FT /locus_tag="RBRH_02816" FT /product="C4-dicarboxylate transport sensor protein dctB FT (EC 2.7.3.-)" FT /function="C4-dicarboxylate transport sensor protein dctB FT (EC 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="C4-dicarboxylate transport sensor protein dctB (EC FT 2.7.3.-)" FT /note="COG: Signal transduction histidine kinase regulating FT C4-dicarboxylate transport system" FT /note="Pfam: His Kinase A (phosphoacceptor) FT domain::PF00512
Histidine kinase-, DNA gyrase B-, and FT HSP90-like ATPase::PF02518" FT /db_xref="EnsemblGenomes-Gn:RBRH_02816" FT /db_xref="EnsemblGenomes-Tr:CBW77014" FT /db_xref="GOA:E5AV90" FT /db_xref="InterPro:IPR003594" FT /db_xref="InterPro:IPR003661" FT /db_xref="InterPro:IPR004358" FT /db_xref="InterPro:IPR005467" FT /db_xref="InterPro:IPR009082" FT /db_xref="InterPro:IPR017055" FT /db_xref="UniProtKB/TrEMBL:E5AV90" FT /protein_id="CBW77014.1" FT /translation="MLRRTAVLLVLAAVIIASCVAAWSSARTHAIDRLREASAARAART FT SATLQAALDRYEPLPYLLSTHPLVQDALRQPNGEAVARANRYLEEIAQRSKASQAYLIT FT GDGLCVAASNWREPDSFVGMRYVFRPYFVAAVAGREDHFFGIGTRSHQAGYYISQPVSY FT NGTQIGVVVIKIDLSWFPPQDRSEPLFVTDANGIVILSSIPSWRYHTTRPLSNQASAWI FT RDTEQYSDEPLKPLPLTKVRTRAAGAELVRFGSGPPAPLYLQTEQPLSELGWQLTVLSP FT LDDVDARARAMTVATGLALLIAALLGFYWRLRRAKLREMEYGRRMLQSAYAELNQRVAE FT RTADLSAANEQLTREVSERTRAEAELRAAQDELVQASKLAALGQMAAGITHELNQPLAA FT LRTFSDNTRVLIERNALDAARENLQAIATLIDRMGRITNQLKLFVSKRRPRDAHAIVAQ FT ALRNALVMLRDKLAGIDVRVVSVHAGGKRAPFDLNALNTSPAVRCDDLRVEQALINLIG FT NAADALASHPTARIIIEVDTRPDVVAIAVIDNGPGIAADLLPRLFEPFFTTKEMGQGLG FT LGLAIAASIVRDAGGTLSVATARDKDRDATARGACFVMTLPRAYARSSQDAPA" FT CDS 618179..619531 FT /transl_table=11 FT /locus_tag="RBRH_02815" FT /product="C4-dicarboxylate transport transcriptional FT regulatory protein dctD" FT /function="C4-dicarboxylate transport transcriptional FT regulatory protein dctD" FT /note="C4-dicarboxylate transport transcriptional FT regulatory protein dctD" FT /note="COG: Response regulator containing CheY-like FT receiver, AAA-type ATPase, and DNA-binding domains" FT /note="Pfam: Bacterial regulatory protein, Fis FT family::PF02954
Response regulator receiver FT domain::PF00072
Sigma-54 interaction domain::PF00158" FT /db_xref="EnsemblGenomes-Gn:RBRH_02815" FT /db_xref="EnsemblGenomes-Tr:CBW77015" FT /db_xref="GOA:E5AV91" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR002197" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR025662" FT /db_xref="InterPro:IPR025943" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AV91" FT /protein_id="CBW77015.1" FT /translation="MTDGLQVLFIEDDELVRHANVQSLMLGGFDVTGYPSVEAALDAMH FT AAGASVPGAIVTDVRLPGASGLELLSLMRERAPDVPVIVVTGHGDISMAVQAMREGAYD FT FIEKPFSSERLADAVRRALERRALQLENRALRRELAAQRPDTVHIIGTSAAIDQVRTMI FT ANVAPTDAAVLINGETGTGKELIARALHEQSARRNRPFVAINCAALPESMFESEMFGYE FT QGAFTGATRRRVGKLEYASGGTLFLDEVESMPLALQAKLLRVLQDGVLERLGSNTPVHS FT DVRIIAAAKGNMNEHVAAGTFRRDLLYRLNVVTITLPPLSERREDIMPLFEHFVLDAAL FT RYQRPARVLTDAQRHALMQQDWPGNARELRNAADRFVLGIGLDDVRHAIRADNDAQPLK FT ERVEQFERALIAQALEAYGGAVSTAAERLQVGKATLYEKIKRYGLTTRGEA" FT CDS 619690..620703 FT /transl_table=11 FT /locus_tag="RBRH_02814" FT /product="Glycine betaine transport system permease FT protein" FT /function="Glycine betaine transport system permease FT protein" FT /note="Glycine betaine transport system permease protein" FT /note="COG: ABC-type proline/glycine betaine transport FT systems, permease component" FT /note="Pfam: Binding-protein-dependent transport system FT inner membrane component::PF00528" FT /db_xref="EnsemblGenomes-Gn:RBRH_02814" FT /db_xref="EnsemblGenomes-Tr:CBW77016" FT /db_xref="GOA:E5AV92" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:E5AV92" FT /protein_id="CBW77016.1" FT /translation="MHERWVHIGGPFHLPGRAGRFSGLGGALRPVLPPVVHGRHSARPA FT AIVAHATAQRATVQHVTALCRPPPACRASCPRVVRHCLCFRARAVSATHEENSTMTSRR FT AKLLSSFIVLTLIVTALVRAIGLDVLCKYHADLLYYTGAHLLLVGASIALALLTGIPAG FT ILLSRASNPRHAERLMQVLNVGNTVPSLAVLALALAVLGIGAAPAIVALWLASLLPIAR FT NAYEGMRAVPPAWREAARGLGMTSLQSMFKVELPNAMPIIIGGVRTALAINVGTAPLAF FT LIGADSLGTLIFPGIYLNDPAMLLLGAASTAALALALDALVAGIARAALARRGLAL" FT CDS 620723..621625 FT /transl_table=11 FT /locus_tag="RBRH_02813" FT /product="Glycine betaine-binding protein" FT /function="Glycine betaine-binding protein" FT /note="Glycine betaine-binding protein" FT /note="COG: Periplasmic glycine betaine/choline-binding FT (lipo)protein of an ABC-type transport system FT (osmoprotectant binding protein)" FT /note="Pfam: Substrate binding domain of ABC-type glycine FT betaine transport system::PF04069" FT /db_xref="EnsemblGenomes-Gn:RBRH_02813" FT /db_xref="EnsemblGenomes-Tr:CBW77017" FT /db_xref="GOA:E5AV93" FT /db_xref="InterPro:IPR007210" FT /db_xref="UniProtKB/TrEMBL:E5AV93" FT /protein_id="CBW77017.1" FT /translation="MTRLLKCVIAWLLASTALAGVIPAHAATLVVGGKNFTEQLLLAEI FT TSQYLRSRGYTVESRSGLGSVLMRSALENRQLDIVWDYTGTALIVYNRIHEKLDPQTAY FT RRVRDLDKPRGLVWLKPSALNNTYALAMPSERAKRDGIHTISQLAAKIQQDDPRKRHWF FT AMDAEFANRPDGLRPLQALYDLRLRRSDIKQMDSGLVYTALHNNQAMFGLVYTTDGRIK FT GFGITVLDDDLGFFPAYNATPVVRRDVLDQHPELAKQLDALSAQINSEVMSEMNKRVDI FT DEESISAVAADFLRTHALP" FT CDS 621639..622292 FT /transl_table=11 FT /locus_tag="RBRH_02812" FT /note="COG: ABC-type proline/glycine betaine transport FT systems, permease component" FT /note="Pfam: Binding-protein-dependent transport system FT inner membrane component::PF00528" FT /db_xref="EnsemblGenomes-Gn:RBRH_02812" FT /db_xref="EnsemblGenomes-Tr:CBW77018" FT /db_xref="GOA:E5AV94" FT /db_xref="InterPro:IPR000515" FT /db_xref="UniProtKB/TrEMBL:E5AV94" FT /protein_id="CBW77018.1" FT /translation="MDLMNYFSNNWQELASLTLQHLALVGTAVGCAILVGVPLGILINR FT CAWLAGPLLGCATIVLTLPSIALFGLMIPLLSRWGAGIGPAPAIVAVFLYSLLPIMRNT FT YLALRNVDPSIREAGTGIGMTRWQRLRLVELPLAVPVIIGGVRTAVVMNIGVMTIAAVI FT GAGGLGELVLRAISQSNMTRLVIGAVLVSVLAIVADLLLHALQRALTPKGVAKT" FT CDS 622289..623437 FT /transl_table=11 FT /locus_tag="RBRH_02811" FT /product="Glycine betaine transport ATP-binding protein" FT /function="Glycine betaine transport ATP-binding protein" FT /note="Glycine betaine transport ATP-binding protein" FT /note="COG: ABC-type proline/glycine betaine transport FT systems, ATPase components" FT /note="Pfam: ABC transporter::PF00005
CBS domain FT pair::PF00571" FT /db_xref="EnsemblGenomes-Gn:RBRH_02811" FT /db_xref="EnsemblGenomes-Tr:CBW77019" FT /db_xref="GOA:E5AV95" FT /db_xref="InterPro:IPR000644" FT /db_xref="InterPro:IPR003439" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR005892" FT /db_xref="InterPro:IPR017871" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AV95" FT /protein_id="CBW77019.1" FT /translation="MIELDHLTKTFTRKDGSAVRAVDAVSLTVAEGEICIFLGPSGCGK FT TTTLKMINRLIQPTGGRVLLNGEDTANVNEVELRRHIGYVIQQVGLFPNMTIEENITVV FT PRLLGWDKSRYRERATELMSMVALDPKLYLKRYPRELSGGQQQRIGVIRALAADPPVML FT MDEPFGAVDPINRESIQNEFFQMQRALKKTVIMVSHDIDEAIKLGDKVAVFRRGQLVQF FT DHPDTLLAHPKDEFVSAFVGHDSTLKRLLLVKASDAATHAQTVHVDTPLAQALSVMDDT FT DNRYVTVTDDARRALGYVSRRAAREGASTPARCGDKMREFATTVNAEDNLRVVLSKMFE FT VNSPWLPVVDPEGGYLGEITQDSIAEYLSSGRSRGVPTAAGM" FT CDS complement(624324..624824) FT /transl_table=11 FT /locus_tag="RBRH_02810" FT /product="Phosphohydrolase (MutT/nudix family protein)" FT /function="Phosphohydrolase (MutT/nudix family protein)" FT /note="Phosphohydrolase (MutT/nudix family protein)" FT /note="COG: NTP pyrophosphohydrolases including oxidative FT damage repair enzymes" FT /note="Pfam: NUDIX domain::PF00293" FT /db_xref="EnsemblGenomes-Gn:RBRH_02810" FT /db_xref="EnsemblGenomes-Tr:CBW77020" FT /db_xref="GOA:E5AV96" FT /db_xref="InterPro:IPR000086" FT /db_xref="InterPro:IPR015797" FT /db_xref="InterPro:IPR020084" FT /db_xref="UniProtKB/TrEMBL:E5AV96" FT /protein_id="CBW77020.1" FT /translation="MHRSRTRTRNWIVMPKQTSCGVVILNELGSVLLCHATETRHWDIP FT KGQPNPGEAPIDAALRETREETGLTLDAAALVELGAFSYRSDKELHLFATRVSTCDVDI FT RECVCTCLFPSYRNGKMIPEMDAFRWVQPTEVSRYTSASLTRLFETKLSLPALHRQLSG FT AAA" FT CDS complement(624839..627112) FT /transl_table=11 FT /locus_tag="RBRH_02809" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Glycogen debranching enzyme" FT /db_xref="EnsemblGenomes-Gn:RBRH_02809" FT /db_xref="EnsemblGenomes-Tr:CBW77021" FT /db_xref="GOA:E5AV97" FT /db_xref="InterPro:IPR008928" FT /db_xref="InterPro:IPR010401" FT /db_xref="InterPro:IPR012341" FT /db_xref="UniProtKB/TrEMBL:E5AV97" FT /protein_id="CBW77021.1" FT /translation="MKGSQLMQEPEPTAGGLAKLPEQGAETGGDDGVFIAPEHANVTSG FT RRYVLKSGDTFVVNDPNGDILGHDDGLFVNDTRVLSQLQLTFGGRAPSLLSSSVSSDNT FT AFTAHLTNRSLPPLGGGHTPQGVIHVERLRVLCGNVLNEAITLTHYGTEPAVVPLSLSF FT ASDFLDMFEVRGSPRGRRGTLATPYVDKGEVVFSYQGLDNVERIVRIAFSPAPDKLMPG FT RADYTLTLPSEACLSVYLQVTVVTRPINETAAPVPGPVSKPPAGLSGAGRAAVRAALAE FT SHRMMRDRRRASARLRSSNPLFNAWMERSFADLGLLTTDRDTGPYPYAGIPWFSTPFGR FT DAVMTSLQTLWVQPALARGVLRFLAAQQAREDSAFRDAAVGKIMHEMRKSEMAATGEVP FT FALYYGGVDTTPLFIVLAGAYLERTGDGALIDELWLALELAAQWIARVCDRNPFGLLDY FT QRAADSGLANQGWKDSHDSVFHSDGRIPDGPIALVEVQAYACAAFETMARLAQHRGSAT FT LAARYTTRAQALRERVEAMFWMPQEGFYGIALDGHGQLCRVLASNAGHLLAFGLPDKAR FT GEQVAHTLESALFYTGWGLRTLASGQPRFNPMSYHNGSVWPHDTALCARGMARYGEKDA FT AVRLLQALFEAAVHFDMRLPELFCGFTRRRGEPPTAYPVACLPQAWAAGSPFMMLEACL FT GVTVDAQREEIRIERPRLPEGIDWLEVGDLRVGSRTISLTFRRVGEQVVPAVDRGDARV FT IALL" FT CDS 627261..627455 FT /transl_table=11 FT /locus_tag="RBRH_02808" FT /db_xref="EnsemblGenomes-Gn:RBRH_02808" FT /db_xref="EnsemblGenomes-Tr:CBW77022" FT /db_xref="GOA:E5AV98" FT /db_xref="InterPro:IPR000524" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AV98" FT /protein_id="CBW77022.1" FT /translation="MSARPHPLTEHDIEQWIAAISSGQYPVGTKLPAGRVLAQIHGVSQ FT AVICDVAGGLQAEGFVDTR" FT CDS complement(627452..627583) FT /transl_table=11 FT /locus_tag="RBRH_02807" FT /db_xref="EnsemblGenomes-Gn:RBRH_02807" FT /db_xref="EnsemblGenomes-Tr:CBW77023" FT /db_xref="UniProtKB/TrEMBL:E5AV99" FT /protein_id="CBW77023.1" FT /translation="MPRLPATLFGHIAKPMRSGMAMPVQLERYPRADVRERIVPPAP" FT CDS complement(627869..629035) FT /transl_table=11 FT /locus_tag="RBRH_02806" FT /product="Outer membrane porin protein 32 precursor" FT /function="Outer membrane porin protein 32 precursor" FT /note="Outer membrane porin protein 32 precursor" FT /note="COG: Outer membrane protein (porin)" FT /note="Pfam: Gram-negative porin::PF00267" FT /db_xref="EnsemblGenomes-Gn:RBRH_02806" FT /db_xref="EnsemblGenomes-Tr:CBW77024" FT /db_xref="GOA:E5AVA0" FT /db_xref="InterPro:IPR001702" FT /db_xref="InterPro:IPR002299" FT /db_xref="InterPro:IPR023614" FT /db_xref="UniProtKB/TrEMBL:E5AVA0" FT /protein_id="CBW77024.1" FT /translation="MKRLVLSAISLGVLAATSAAHAQSSVTLYGVIDESITFLHNQGGK FT NQWSTVSGNLQGSRWGLKGAEDLGGGLKAIFQLENGFNPNNGRLGQSGREFSRQAYVGL FT QNDVYGSVTLGRQYVPDTDLVQSITGDNYFGSGFATPGDVDNYDNSVRVNNSVKYTSPV FT WAGFQFEGLYALGNQAGSFGDRRAWGAALAYTNGPIAVAASYQYYNGGKVTNGVRDFSD FT STTTATNTTTDSIFNGPVNGAYTSAASLKIARVAGQYTIGPVNVGASYSNAQYTADSAS FT SFGQTQKYNTGNAFATYQATPALLTGIGYSYTKGSGNASAKYNQVSLGADYSLSKRTDV FT YLVSAWQKATGQQDGAGSQAQASISSYGFAGANGGAQEYVALGLRHRF" FT CDS complement(629506..630093) FT /transl_table=11 FT /locus_tag="RBRH_02805" FT /product="Potassium-transporting ATPase C chain (EC FT 3.6.3.12)" FT /function="Potassium-transporting ATPase C chain (EC FT 3.6.3.12)" FT /EC_number="3.6.3.12" FT /note="Potassium-transporting ATPase C chain (EC 3.6.3.12)" FT /note="COG: K+-transporting ATPase, c chain" FT /note="Pfam: K+-transporting ATPase, c chain::PF02669" FT /db_xref="EnsemblGenomes-Gn:RBRH_02805" FT /db_xref="EnsemblGenomes-Tr:CBW77025" FT /db_xref="GOA:E5AVA1" FT /db_xref="InterPro:IPR003820" FT /db_xref="UniProtKB/TrEMBL:E5AVA1" FT /protein_id="CBW77025.1" FT /translation="MIMNTLLRPVLVLFVALTVITGIVYPAAVTAIAQAIFPIQANGSL FT IEKDGKLIGSALIGQQFDRNDYFWGRLSATTPNPYNAQSSSGSNLGPTNPALAHEVKAR FT LAALHEADPTNTAPVPVDLVTSSGSGLDPDISPAAAAYQAPRVARARGLSQARVDELIA FT RHTTGRQFGLLGEPRVNVLKLNLALDQIKPAH" FT CDS complement(630188..632326) FT /transl_table=11 FT /locus_tag="RBRH_02804" FT /product="Potassium-transporting ATPase B chain (EC FT 3.6.3.12)" FT /function="Potassium-transporting ATPase B chain (EC FT 3.6.3.12)" FT /EC_number="3.6.3.12" FT /note="Potassium-transporting ATPase B chain (EC 3.6.3.12)" FT /note="COG: High-affinity K+ transport system, ATPase chain FT B" FT /note="Pfam: E1-E2 ATPase::PF00122
haloacid FT dehalogenase-like hydrolase::PF00702" FT /db_xref="EnsemblGenomes-Gn:RBRH_02804" FT /db_xref="EnsemblGenomes-Tr:CBW77026" FT /db_xref="GOA:E5AVA2" FT /db_xref="InterPro:IPR001757" FT /db_xref="InterPro:IPR006391" FT /db_xref="InterPro:IPR008250" FT /db_xref="InterPro:IPR018303" FT /db_xref="InterPro:IPR023214" FT /db_xref="InterPro:IPR023299" FT /db_xref="UniProtKB/TrEMBL:E5AVA2" FT /protein_id="CBW77026.1" FT /translation="MTNVNPSPAHRADNLGQARTAVHSMFDPVLLKPAIVDAFKKLAPR FT TQLRNPVMFCVYVGSILTTVLWIAALAGQAEAPAGFILAIALWLWFTVLFANFAEALAE FT GRSKAQAASLRSAKHNVMAKKLNEPHPKAPIRIITSTDLRRGDVVLVEAGDTIPADGEV FT IEGVASVDESAITGESAPVIRESGADFSSVTGGTRVLSDWIVVRVSVNPGEAFLDRMIA FT MVEGAKRQKTPNEIALTILLVALTLVLLFATATLLPFSMFSISAMKSGHVVTITVLVAL FT LVCLIPTTIGGLLSAIGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITLGNR FT QASAFMPAPGVSEQELADAAQLASLADETPEGRSIVVLAKQRFNIRERDMASLHAQFLG FT FTAQTRMSGVDLPEREIRKGAADAIQQYVQAHAGRFPQEVRAAVDDVARRGSTPLVVAQ FT RQLGAGGQARVLGVIELKDIVKGGIKERFAELRKMGIKTVMVTGDNRLTAAAIAAEAGV FT DDFLAEATPETKLATIRAYQADGRLVAMTGDGTNDAPALAQADVAVAMNTGTQAAKEAG FT NMVDLDSNPTKLIEIVEIGKQMLMTRGSLTTFSIANDVAKYFAIIPAAFATTYPQLHVL FT DVMRLTSPSSAILSAVVFNALIIVFLIPLALKGVKYRPLGAASLLRRNLLIYGLGGIVL FT PFPFIKLIDMAITALGWA" FT CDS complement(632340..634148) FT /transl_table=11 FT /locus_tag="RBRH_02803" FT /product="Potassium-transporting ATPase A chain (EC FT 3.6.3.12)" FT /function="Potassium-transporting ATPase A chain (EC FT 3.6.3.12)" FT /EC_number="3.6.3.12" FT /note="Potassium-transporting ATPase A chain (EC 3.6.3.12)" FT /note="COG: K+-transporting ATPase, A chain" FT /note="Pfam: Potassium-transporting ATPase A FT subunit::PF03814" FT /db_xref="EnsemblGenomes-Gn:RBRH_02803" FT /db_xref="EnsemblGenomes-Tr:CBW77027" FT /db_xref="GOA:E5AVA3" FT /db_xref="InterPro:IPR004623" FT /db_xref="UniProtKB/TrEMBL:E5AVA3" FT /protein_id="CBW77027.1" FT /translation="MNAHSLLQAVLFIIVLIALALPLGRYMCGVLDGSSVLVRKLGRPL FT EHGLYRVAGVDPQAEMSWKHYALAVLLFNALGAVVVYGLLRLQQWLPANPQGLGAMPPD FT AAFNTAVSFVTNTNWQNYSPESSVSYLTQLAGLAVQNFLSAATGIAVVVALIRGFARHT FT ARTIGNFWVDLTRVTLYILAPLAIVVSLVLVSQGVLQNLKPYQQVSTLQVTTYPVPRTD FT AQGNPVKDAHGNVVMQDAKVDKQTLAMGPVASQEAIKMLGTNGGGFFNANSAHPFENPT FT PLSNFVQILSILIIPAGLCVVFGRMVGDRRQGYAVLAAMTIAFAVACFAEISAEQSGNP FT LFASLHVDQQASALQAGGNAEGKEVRLGIAQSGIFTVATTAASCGAVDNTHDSLTPLGG FT FVPLLLMQLGEVIFGGVGSGLYGMLVFALLAVFVAGLMIGRTPEYVGKKIESFEIKMVA FT LVVLLTPFLVLVGTSIGVLSPLGVAGIANPGPHGFSEVLYAFSSAANNNGSAFGGLSVN FT TPFYNVLLAIAMWFGRFGTIVPVLAVAGSLASKKRIATTPGTLPTHGPLFVVLLLGTLV FT LVGALTYVPSLALGPIVEQLMMIAGH" FT CDS complement(634145..634372) FT /transl_table=11 FT /locus_tag="RBRH_02802" FT /note="Pfam: F subunit of K+-transporting ATPase FT (Potass_KdpF)::PF09604" FT /db_xref="EnsemblGenomes-Gn:RBRH_02802" FT /db_xref="EnsemblGenomes-Tr:CBW77028" FT /db_xref="GOA:E5AVA4" FT /db_xref="InterPro:IPR011726" FT /db_xref="UniProtKB/TrEMBL:E5AVA4" FT /protein_id="CBW77028.1" FT /translation="MPWRINGEHNNGPHLPRRHRPVPGAVHGAGDRLRQAAPHTWRPLM FT MAWMTWLAGIATLLVLVYLVYALLRAEDLE" FT CDS 634994..635368 FT /transl_table=11 FT /locus_tag="RBRH_02800" FT /db_xref="EnsemblGenomes-Gn:RBRH_02800" FT /db_xref="EnsemblGenomes-Tr:CBW77029" FT /db_xref="UniProtKB/TrEMBL:E5AVA5" FT /protein_id="CBW77029.1" FT /translation="MPRACFIVAMPLRRFVPILISSLLLCGCIAQTPPPPSVHPNALLE FT GIQRYEQVNARIANERLLIDVRVTRGDYTAAAGADLKRRLDDVQRDAARIASQHDGGLD FT ADTQRALNERLTAISGAIAR" FT CDS 635532..635765 FT /transl_table=11 FT /locus_tag="RBRH_02799" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02799" FT /db_xref="EnsemblGenomes-Tr:CBW77030" FT /db_xref="UniProtKB/TrEMBL:E5AVA6" FT /protein_id="CBW77030.1" FT /translation="MRDCWLLFYGATTNMSNKEHISRDKKEEAIDKSVEDTFPASDPPA FT TGGVTKIVPDEQPSHGSQDDKENPPAQPSGKN" FT CDS complement(635880..636374) FT /transl_table=11 FT /locus_tag="RBRH_02798" FT /product="CBS domain containing protein" FT /function="CBS domain containing protein" FT /note="CBS domain containing protein" FT /note="COG: FOG: CBS domain" FT /note="Pfam: CBS domain pair::PF00571" FT /db_xref="EnsemblGenomes-Gn:RBRH_02798" FT /db_xref="EnsemblGenomes-Tr:CBW77031" FT /db_xref="GOA:E5AVA7" FT /db_xref="InterPro:IPR000644" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:E5AVA7" FT /protein_id="CBW77031.1" FT /translation="MRHVRCSTLKAIVHSYSRRLSMHRVQEIMSRDVVHISPSDTIRHA FT AELMDQYDIGVLPVCESRKLTGMVTDRDLAVRALAAGKELDSPVSEVCTPQVEWCMEDD FT DLDAVQKRMADAQLRRMPVINRQKELVGVLSLGDVATRSVGASHDEVANTLEGVSQTRH FT H" FT CDS 636366..637190 FT /transl_table=11 FT /locus_tag="RBRH_02797" FT /product="Uracil DNA glycosylase superfamily protein" FT /function="Uracil DNA glycosylase superfamily protein" FT /note="Uracil DNA glycosylase superfamily protein" FT /note="COG: Uracil-DNA glycosylase" FT /note="Pfam: Uracil DNA glycosylase superfamily::PF03167" FT /db_xref="EnsemblGenomes-Gn:RBRH_02797" FT /db_xref="EnsemblGenomes-Tr:CBW77032" FT /db_xref="InterPro:IPR005122" FT /db_xref="InterPro:IPR005273" FT /db_xref="UniProtKB/TrEMBL:E5AVA8" FT /protein_id="CBW77032.1" FT /translation="MPHARIRGPTITSPLRDCFLQSTGKNAWRVHGIWSTATRDRRHAS FT CKRVARSFVMTERMMTTRKPTTQEHGKIEIEPHQQPQGLDDCRRCALWHDASQPVPGEG FT PAHAPIMMVGEQPGDQEDRQGRPFVGPAGVLLDDALREAGVARDDVYVTNAVKHFKWEP FT RGKRRMHKTPAQREIEACHYWLDREFDTVAPAVVVALGATALKAVLQDRTVTLQRSLGQ FT TIEYGGHFVIPTYHPSFALRAPDEPTRQRAYAQIVDALRRAGKLAQQLEQQG" FT CDS complement(637296..637655) FT /transl_table=11 FT /locus_tag="RBRH_02796" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_02796" FT /db_xref="EnsemblGenomes-Tr:CBW77033" FT /db_xref="GOA:E5AVA9" FT /db_xref="InterPro:IPR002559" FT /db_xref="UniProtKB/TrEMBL:E5AVA9" FT /protein_id="CBW77033.1" FT /translation="MPPGKRSANRRSAGCARGGFEAIVHDLWEMLRICDGRKAQPSAII FT LDSRILQSTPQSGARAGYDSAKRRKGFKIHLPVNMLGQLLALHVTLANKQDRAQVEQLA FT RAIQLRRRTTLSTLV" FT CDS 637881..638012 FT /transl_table=11 FT /locus_tag="RBRH_02795" FT /db_xref="EnsemblGenomes-Gn:RBRH_02795" FT /db_xref="EnsemblGenomes-Tr:CBW77034" FT /db_xref="UniProtKB/TrEMBL:E5AVB0" FT /protein_id="CBW77034.1" FT /translation="MSSTPPIQEGSSGRKRGNNYVVHIYAINSLENLVHLCSTFSRS" FT CDS 638434..638886 FT /transl_table=11 FT /locus_tag="RBRH_02794" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Signal transduction histidine kinase" FT /note="Pfam: Domain of unknown function DUF29::PF01724" FT /db_xref="EnsemblGenomes-Gn:RBRH_02794" FT /db_xref="EnsemblGenomes-Tr:CBW77035" FT /db_xref="InterPro:IPR002636" FT /db_xref="UniProtKB/TrEMBL:E5AVB1" FT /protein_id="CBW77035.1" FT /translation="MSETNMGTRYEQDVVAWANEQAALLRSGKLSAIDVEHIAEEIEDV FT GKSEQRELASRMSVLLAHLLKWQFQPSRRSKSWQFTIRTQRKEVAYVLNEAPSLCGKFS FT DAAWLDIVWSKARSLASNETGLDLDVFPAGLLWSVDDVLSQEFYPE" FT CDS complement(638998..639342) FT /transl_table=11 FT /locus_tag="RBRH_02793" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives" FT /db_xref="EnsemblGenomes-Gn:RBRH_02793" FT /db_xref="EnsemblGenomes-Tr:CBW77036" FT /db_xref="UniProtKB/TrEMBL:E5AVB2" FT /protein_id="CBW77036.1" FT /translation="MACLSRCRWTSSEAALRGSGVACSNVAATLARPTDWRDRRTSWAT FT GDAGLVGEIRLIIAELSSYGYRQVWGVLRQARGVKTMKRAYVAFMLKPTWPGCASSRHC FT SRALQRKVSS" FT CDS complement(639575..639685) FT /transl_table=11 FT /locus_tag="RBRH_02791" FT /db_xref="EnsemblGenomes-Gn:RBRH_02791" FT /db_xref="EnsemblGenomes-Tr:CBW77037" FT /db_xref="UniProtKB/TrEMBL:E5AVB3" FT /protein_id="CBW77037.1" FT /translation="MFLISNKREVMEVLAGWGGAPAAVSVKEAGSGAGEF" FT CDS complement(639696..639941) FT /transl_table=11 FT /locus_tag="RBRH_02790" FT /db_xref="EnsemblGenomes-Gn:RBRH_02790" FT /db_xref="EnsemblGenomes-Tr:CBW77038" FT /db_xref="UniProtKB/TrEMBL:E5AVB4" FT /protein_id="CBW77038.1" FT /translation="MSNLPSNVTRHVDASMVEQLLCSGASGVSIGKLFEQFLPLARERL FT KICVALFRVFVIESWEMRVIEQPHESPDTVCHLKYR" FT CDS complement(640104..641678) FT /transl_table=11 FT /locus_tag="RBRH_02789" FT /product="Histidine ammonia-lyase (EC 4.3.1.3)" FT /function="Histidine ammonia-lyase (EC 4.3.1.3)" FT /EC_number="4.3.1.3" FT /note="Histidine ammonia-lyase (EC 4.3.1.3)" FT /note="COG: Histidine ammonia-lyase" FT /note="Pfam: Phenylalanine and histidine FT ammonia-lyase::PF00221" FT /db_xref="EnsemblGenomes-Gn:RBRH_02789" FT /db_xref="EnsemblGenomes-Tr:CBW77039" FT /db_xref="GOA:E5AVB5" FT /db_xref="InterPro:IPR001106" FT /db_xref="InterPro:IPR008948" FT /db_xref="InterPro:IPR024083" FT /db_xref="UniProtKB/TrEMBL:E5AVB5" FT /protein_id="CBW77039.1" FT /translation="MNNMLEITGERIRASDIARVAYDFDIHVRLGQKACESIVASRKLL FT DDLLLQGKVIYGVNTSMGGFVKYLIPEKYATQTQENLIAAVATNVGPYFDDSVVRATML FT TRINSLARGVSAISLENIQKFVEIFNKGICPCIPQKGSLGTSGDLGPLAAIALALTGKW FT KVRYRGEIMSASDALRKTNIEPLRLSYKEGLALINGTSAMTGLACLMVSDVEKLIKSYE FT SITALALETLKGKRKVFSPLVHEEKPHRGQQASAANIYNALADSNMISSEDDVSKNLRS FT QLFDNVIDSVADQIEDAYSLRCTPQIIGPIRDAVDYVKCVVENELNSSNDNPLVIPKHG FT DVYHNGHFHGQYISMAMDHLSIALVTLSNLSDRRIDRFMDKNNSNGLPPFLCANEQGIR FT LGLMGGQFMSASLASENRSLCVPVSIHSLPSTADFQDIVSLGLVAARRAQEIFNNTVYV FT ISFELLCACQAADIRGADKLGTHTAMLYNSVRSFLPFFEKDESLTPYLENIAMFIRNEM FT AQSLGGD" FT CDS complement(641904..646127) FT /transl_table=11 FT /locus_tag="RBRH_04314" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /db_xref="EnsemblGenomes-Gn:RBRH_04314" FT /db_xref="EnsemblGenomes-Tr:CBW77040" FT /db_xref="GOA:E5AVB6" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001031" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AVB6" FT /protein_id="CBW77040.1" FT /translation="MKRRAGELEMTLATIWTELLGVECVGRHDSFFALGGHSLLAVRLM FT NRVRALGAEMPLTSLFASPTLAAFAAAVSAQLNQQTSALPEITPVSREGDLPLSFAQQR FT LWFLAQLDGVSDTYHMPFALRVRGPFDRAAWQQALNALFARHEALRSTFVSVDGQPQVR FT LLPADTGVPLHWHDLRGVPDADVQLARLSHSEARAPFDLVHGPLIRSCGIQLTDDEHVL FT LLTKHHIVSDGWSIGVLVRELSALYATRVGAPAEPLPALAIQYPDYAAWQRQWLSGERL FT EDQSDYWRATLADAPVLLELPTDRPRPAQQSFAGAHVPVQIDAQTTRVLKQLSAEHGTT FT LFMTVLAAWSAVLARLSGQDDLVIGTPSANRGHREIEPLIGFFVNTLALRVDLSGEPNT FT SELLKRVRRTTLDAQAHQDLPFEQVVEIVQPPRRLNHTPLFQVLFAWQSNEIGQWRLPG FT LDVTSANLDYDMVRFDLEMHLYEAGDEIIGALCYASALFDPATIERHVGYLTTMLQAMA FT ACSQQPVATLQMLGADERQLLLQTWNATTAPYPAYQCVHQLFEAQVERSPDATALVYEA FT QTLSYAQLNARANCLAHRLIELGAKPDARVAICVERSPAMVVGLLAIMKAGGACVPLDP FT AYPCERLAHILNDAAPTILLADATGRATLGEAALACRSVLELDVPLDQAAPNPRVAELT FT PRHLAYVIYTSGSTGTPKGVMIEHVQITRLFEVTKSKGISNEDQVLIDRQRGYSLTPAD FT RVLQKAPFNFDVSIWEFFWTLLNGATLVVAAPDAHKEPVALIDLIARQRITTVHFVPSM FT LSIFLDTEGVQRCTSVKHLICGGEALSGVTARLCQTLLPDVQVHNLYGPAENPIGTTFW FT TCPAACAEDTIPIGRPIANTQVYLLDVHGQPVPLGTVGELYLSGVGVARGYLNRPELTA FT ERFVPNPFSDAPDARMYKTGDLARYRPDGNLEYLGRNDEQVKIRGFRIEPGEIKASLVQ FT HPQVRDAVVLVRGEGIDKQLVAYVVADADEKLVDTLRAHVAASLPDYMVPVAFVRLDVL FT PLTPNGKLDRRALPEPDLAPTQYRIPRTPHEQTLAELFTEVLNLPRVGIDDSFFDLGGH FT SLLAMRLIDRIRKVLKVDLTIRTVFEAPTVAGLAQRLAQLNGVQESSFSVLLPLKPKGS FT RPPLFCMHPGFGLSWSYISLSSFLDSDQPLYGVQARGFDGARPLPSTINDMVSDYLEQI FT RQIQPEGPYYLLGWSLGGIVAHSMAVQLEQQGEKVALLALLDSRPGSYFVNKEGEIDQE FT MVNAALADHYGDEFIKSMSKEFLENAYEIAKNNPRILKDFCPAVYAGNAVFFRATRTEV FT EDDVLISPDVWKPYVLGNIEVYDVHCSHGEMLRQEPATVIGEILARKLNEPVDKHIQGE FT TDAVQ" FT CDS complement(646042..659544) FT /transl_table=11 FT /locus_tag="RBRH_02787" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: AMP-binding enzyme::PF00501
Condensation FT domain::PF00668
Methyltransferase FT domain::PF08241
Methyltransferase FT domain::PF08242
Phosphopantetheine attachment FT site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_02787" FT /db_xref="EnsemblGenomes-Tr:CBW77041" FT /db_xref="GOA:E5AVB7" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR013217" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AVB7" FT /protein_id="CBW77041.1" FT /translation="MVVGLLAIMKAGGAYVPLDPAYPSERLTHILADTAPAIALADTAG FT QSALGDTVLASLTVLDPNVLPERAATNPQVPELTAHHLAYVIYTSGSTGTPKGVMVEHA FT QIAYLFDVTQLNDAQKENQASINHPVWMQQAYGLTPGDRVLQKAPFTFDVSVWECFCTL FT LNGATLVVAAPGVHKDPSALMELMIRQRITTVHFVPSMLGMFLSTDGAQRCTAVKRLLC FT TGEALTSTHVRLCQRLLPHAQLHNLYGPTEATIGVAAWTCPAEYSEDTIPIGRPIANNR FT LYLLDRHGQPVPLGATGELYISGASVVRGYLNGPDLTAERFLLDPFSDREGARMYKTGD FT LARYRPDGNLEFLGRNDHQVKIRGLRIELGEIKTCLVRHPQVREAVVLALGEGIDKRLV FT AYVVAEPDQQLAHALRAYLTARLPEYMVPAAFVRLDALPLTPNGKLDRRALPEPDASAL FT AQQAYEAPQGELETTLATIWTELLGVERVGRHDSFFALGGHSLLVVRLMNRVGALLGAD FT VPLTSLFASPTLAAFAAVVSAQLNQQTSALPEITPISREGGLPLSFAQQRLWFLAQLDG FT VSGTYHIPLVLRVRGPFDRTAWQQALDALLARHEALRSTFVSVDGQPQVQLLPAGTGVP FT LHGHDLRGVPDADAQLSRLSADEARAPFDLTRGPLMRACVIQLADDEHVLVLTQHHIVS FT DGWSFGVLVYELSALYAANVGAQADPLPALTIQYPDYAAWQRQWLSGERLQTQSDYWRA FT TLADAPVLLELPTDRPRPAQQSFAGAHVPVQIDASTTQALKRLSAEHGTTLFMTVLAAW FT SAVLARLSGQDDLVIGTPSANRGHAAIEPLIGFFVNTLALRVNLEGEPTTAQLLERVRR FT TTLDAQAHQDLPFEQVVEIVQPMRRLNHTPLFQVMFAWQSSETGQWHLPGLEVTPEELK FT YDIARFDLELHLYEAGEEIIGSLHYASALFDSATVERHVGYLTTMLQAMAACPQQPVAT FT FQMLGADERQLLLQTWNATATPYPAHQCIHQLFEAQVQRSPDATALVYEEQTLSYAQLN FT ARANRLAHRLIELGVKPDARVAICVERSPAMVVGLLAILKAGGAYVPLDPAYPSERLAH FT ILADAAPMIVLADAVGCAVLGEVALASCTVIDPNELPSLAHTNPSISGLTARDLAYVIY FT TSGSTGKPKGVMIEHRNVVNFLVSMSSSPGMSSHDRLLAVTSISFDIAGLELYLPMSHG FT AAVVIASRREVTDPSILQKLIKEHEISLMQATPATWRVLLEQSKHMPSLTALCGGEALP FT SSLSIRLRDATKVTWNLYGPTETTIWSSIYCIAEHQDAVGPTTPIGRPIANTQIYLLDT FT YGQPVPLGAVGELYIGGAGVARGYLNRPELTAERFVPNPFSDTPDARMYKTGDLARYQN FT SGNLNFVNRADHQVKIRGYRIEPGEVEAVLQRHPAVAQAAVIAREDRFGDKNLVGYVVL FT RNISIESDPAAEKHQVNEWKSVYDAYYSNEQDYPFGEDFSVWKSSYDGQPIPLVDMQAW FT RANAVERIRELQPRRVLEIGVGTGLLLAHLAPHCEAYWGTDFSAPSIETLRAQLAQQPE FT LASHVQLRTQAAHVTEGLPAGYFDTVVINSVVQYFPSVSYLTDVLRQAMDLLVPGGSVF FT IGDVRNLSLLNCFTTAVQLHQADSATDDRSSLERRIKQALLAEKELLLAPAFFSALLDR FT IDTIAAVDIELKRSDYHNELSRYRYDVVLRKGPVNTLSLAQAPQLRWGRGVVEMDALQT FT LLATERPAQLRITGVPNARLALEMEAMQALEHSDDISLIQRQLMTGNAQAIGLEPEDFS FT ALGESLGYWVGTTWSEHDVHACLDVVFVQASEMAQAVPTDVYLRPSDDDQTSPFRYANQ FT PTRFDPFADVRRYVATQLPDYMVPAAFVRLDALPLTPNGKLDRCALPAPDADALAHQAY FT EAPQGELETTLATIWAELLGIERVSRHDSFFALGGHSLLAVRLMNRVRALGAEMPLTSL FT FASPTLAAFAAAVSAQLNQSVNALPEITPISREGSLPLSFAQQRLWFLAQLDEASANYH FT IPLVLRMRGPFDRAAWQQALDALFVRHEVLRSTFVNIEGQPQVQLLPADTGVPLRWHDL FT REVPDADAQLSRLTADEARTPFDLACGPLMRACVIQLADDEHVLMLTKHHIVSDGWSFG FT VLVRELSTLYAASVGAQADSLPPLAIQYLDYAAWQRQWLSGERLQTQSDYWRATLADAP FT VLLELPTDRPRPAQQSFAGAHVPVQIDASTTQALKRLSAEHGTTLFMTVLTAWSAVLAR FT LSGQDDLVIGTPSANRGHAAIEPLIGFFVNTLALRVDLSGEPNTSELLKRVRCTTLDAQ FT AHQDLPFEQVVEIVQPPRRLNHTPLFQVMFAWQSNEIGQWSLPELDVKPGELEYDMVRF FT DLEMHLYEAGEQITGSLHYASALFDPTTIERHVGYLKTMLQAMATCPQQPVATLQMLGP FT DERQLLLQTWNATQREYPSHQCVQQLFEEQVARTPETTALVYKDQVLSYAQLNAEANRL FT AHRLVDLGVEPGHYVATLLERSIDLVVAQLAILKAGAAYVPIDPRAPTERQSWVMSDCA FT AQLLLTNAHTEVAATRPTALLRLDLSDKAQTEHFPTTCPQPAGRSVDTAYVMYTSGSTG FT MPKGVLVPHRAIARLVINNGYVDVGADDRIAFAANPAFDASTFEVWAPLLNGAAAVVMD FT HDTVLTPALFAQTLREQRISVLWLTVGLFNQMAVELGPVFTQLKALIVGGDALDASVVG FT QVLRERPPQQLINGYGPTESTTFATTYRITAVPKGNVNIPIGRPIANTQVYLLDAHGQP FT VPLGAVGELYIGGAGVAHGYLNRPELSAERFVRDPFTDTPDARMYKTGDLARYLPDGNL FT EFVGRNDEQVKIRGFRIEPGEIEACLVQHEQVRDAVVLVRGESINKRLVAYVVAEPNEV FT LVSELRTHVAARLPEYMVPAAFVRLDALPLTPNGKLDRRALPEPDAGALAHHVYEAPRG FT QLETTLAQIWAELLEVERVGRHDSFFALGGHSLLAVQLIERLRRRGLGLSVRALFDMPT FT LSALAQSLGQHREVIVPPNAITLDTTTLTPQMLPLIDLTQADIDRIVEQVPGGVANIQD FT IYALSPLQDGILFHHLLAADGDPYLLFFQKVFADRKKLDCYLDAVQQVVNRHDILRTAF FT IWEDISTPAQVVWRDAPLWIMELTLDPAEGPILKQLTERFNTRRYRIDLTQAPLMHFVI FT ARDSDGRWLLVELVHHLINDHSTLEVMNKEVQIFIDGRGDTLPPAQPFRNSIVQARLGM FT SEEEHVCFFTDMLANVDKPTLPFGLADVHCDGSQITEAHRALPQELNDRLRAQARRLGV FT SLASLCHLAWAQVLARVSGQQQVVFGTVLFGRMQAGDGADSAMGLFVNTLPMRVDLHSH FT AEYSVRDTHARLAALLEHEHASLALAQRCSGVPAGMPLFSALFNYRHNAMPLAESPTID FT GVELLSAEERTNYPVTLSINDFQQALSLSCQVVQPIDPNRVCGYMQRALESLVEALEHA FT HDKPVQQLEVMPEDERTLLLETWNMTQRDYPSHRCVYQLFEEQVATTPEAIAIIFKEQS FT ISYAELNAQANRLAHRLIRLGVVAQTPVAVLMQRSPERVVAALAVIKAGGVYMPLNEQW FT PDTRLHTLLSETRAPIVLTDHALQARCAALSTHVIVVDADASLDDEPSDNPAVVCSPEQ FT LAYLMYTSGSTGQPKGVAIVHRTVRYMALDRRLSEVRDCVLLHSSHAFDVSMYELWTPL FT LCGGQVVIVPPGELDVRVLQETIRAHQVSALWLTAGLFQVMAEGDLSYLRSVRQLTVGG FT DIVSSAAAQRVLEHCPALRLINGYGPTETTIATGHLLEGPYQAQASIPIGTPLDNARAY FT VLDACLRPVPVGVVGELYIAGEGVARGYFNRPGLSAERFIANPFDASGTRVYRTGDLAY FT WRSDGALEFIGRADQQVKVRGFRVELGEIEAVLQHHPAVAQAAVIAREDQGGSQQLVGY FT IVLDQVPVERDFATEAEQVEAWQKVYDTYYKDDADYAFGENFNIWKSSYDGQPIPLSDM FT QAWRADAVARIRELQPRRVLEIGVGTGLLLAHLAPHCEVYWGTDFSAPSIETLRTQLAQ FT RPELASHVQLRTQAAHVTEGLPTDYFDTIVINSVVQYFPSASYLMDVVRQAMELLVPGG FT SVFIGDVRNLSLLNCFTTAVQLHQADSATDDRSSLGRRIKQALLAEKELMLAPAFFSAL FT PNRVDTIAAVDIELKRGDYHNELSRYRYDVVLRKGPVNTLSLAQAPQLRWGQGVVEIDT FT LQTLLATERPAQLRITGVPNARLALEIEAMQALENGDDISAIKRQLITGNAQAIGLEPE FT DFSALGESLGYWVGSTWSEHDAHACMDIVFVKASEMAQAMPTAVYLPPSDDGQSSLFNY FT ANQPASFDQFADVRRYVATQLPDYMVPAAFVRLDALPLTPNGKLDRRALPAPDDDALAH FT QAYEAPRRRARDDACDNLDGVARCRVCRSA" FT CDS complement(659600..671902) FT /transl_table=11 FT /locus_tag="RBRH_04279" FT /product="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /function="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /EC_number="6.3.2.-" FT /note="Non-ribosomal peptide synthetase modules (EC FT 6.3.2.-)" FT /note="COG: Non-ribosomal peptide synthetase modules and FT related proteins" FT /note="Pfam: Methyltransferase FT domain::PF08241
Methyltransferase FT domain::PF08242
AMP-binding FT enzyme::PF00501
Condensation FT domain::PF00668
Phosphopantetheine attachment FT site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_04279" FT /db_xref="EnsemblGenomes-Tr:CBW77042" FT /db_xref="GOA:E5AVB8" FT /db_xref="InterPro:IPR000873" FT /db_xref="InterPro:IPR001242" FT /db_xref="InterPro:IPR006162" FT /db_xref="InterPro:IPR009081" FT /db_xref="InterPro:IPR010071" FT /db_xref="InterPro:IPR013217" FT /db_xref="InterPro:IPR020806" FT /db_xref="InterPro:IPR020845" FT /db_xref="InterPro:IPR025110" FT /db_xref="UniProtKB/TrEMBL:E5AVB8" FT /protein_id="CBW77042.1" FT /translation="MMSISVTPLTYPLSTAQTEIWLAQQLYPDSPAYIIGQYTVIEGVV FT DPALFEAALRQVIHEADSLRLYFVETDEGIQQYVGSLAWSLSRVDLSAEADSQAAAQAW FT MRADYEQPLDILQGPLFHYALLKTASDQVLWYQRYHSIMMDGVGMHLIAQRVAQVYSAM FT CEGAKPAPCTFRSVSQLLKKNAQYRNSAQWARDETYWLKRCANWPEPVVYAGQLASASH FT LHLCHTADFVQSDSQGIDTFESSAIDLVQLVTAAMAAYLHRLTGVQDVVLGVPATVCPS FT MGRCVPGRVSNILPVRLTVRPSTSLSALKDQVAKKIHQGLRHQRYPIDALRHVLGLTPT FT QRLLSSLLDVGVVDNHLLFGASSSTSHFLATGSIESLLVVAHAQPDSPMLRIALDANRA FT FDTASELTTPQYGFLTFIRALNAEPIRPISGVDWLNAAQQQRLLVEWNTTAQPVPDATL FT PELFEKQVERTPDATALVCVDQTLSYAELNAQANRLAHRLIRLGVVAETPVAVLMQRSS FT ERVVAALAVIKAGGVYMPLNEQWPDTRLHTLLSETRAPIVLTDHALQARCAVLSTHVIA FT VDADASLDDEPSDNPAVVCSPEQLAYLMYTSGSTGQPKGVAIVHRTVRYMALDRRLSEV FT RDRVLLHSSHAFDVSMYELWTPLLCGGQAVIVPPGELDVRVLQETIRAHQVSALWLTAG FT LFQVMAEGDLSYLRSVRQLTVGGDIVSSVAAQRVLEHCPALRLINGYGPTETTIATGHL FT LEGPYQAQASIPIGTPLDNARAYVLDACLRPVPVGVVGELYIAGEGVARGYFNRPELSA FT ERFIANPFDASGTRLYRTGDLAYWRSDGALDFIGRADQQVKVRGFRVELGEIEAVLQHH FT PAVAQAAVIAREDQGGSQQLVGYIVLDQGPVERDFATEAEQVEAWQKVYDTYYKDDADY FT AFGENFNIWKSSYDGQPIPLSDMQAWRADAVARIRELQPRRVLEIGVGTGLLLAHLAPH FT CEAYWGTDISAPVIEALKLQVAQHAELAARVELRTQAAHITEGLPQGYFDTIVINSVVL FT HFPNADYLLDVLRQAMALLAPGGALFVGDVPDLRLFECFTSAVQLYQADPSTDDYASLR FT RRIKQSQLARKELRLAPAFFSTLHRAIDEIAAIDIQLKHGDYHNELSRYRYDVVLRKGS FT VNTLPLAHAPQLHWAEATTLEAVKTHLATERPACLRIVGVPNMRVACELEATQALNNAD FT CDLELIQHRLKTGHAQTTAPTVEDFYALGESLGYWVGVTWSEHTAPACIDIVLVQARDM FT ACAVPTDLYLPPSSSSGQTPHAYANNPTSLDQFADIRQYVATRLPEYMVPAVFMRLDTL FT PLTPNGKLDRRALPAPDSALLGQLYEAPQGELETTLAAIWAELLGVERAGRQDSFFALG FT GHSLLAIRMIERLRRFGLTVSVRTLFDSPTLSALAESLGQHREVTVPPNVITPDNTTIT FT PQMLPLIDLAQADIDQIVERVPGGAANIQDIYALSPLQDGILFHHLLATDGDPYLRMVQ FT KSFENREELDRYLNAVRQVVDRHDILRTAFVWEGLSVPAQVVWRHAPLSITELVLDPAQ FT GPVIEQLTHRFNPRRHRIDLTQAPLMHFVLAQDSDGRWLLLELVHHLIDDHATLEVMHT FT EVQAFLEGRGDTLPPAQPFRNLVAQARLGVSQEAHERFFTDMLADVDEPTLPFGLTGVH FT RDGAEVTEAQRRLPQALNKQLRAQARRQGVSVASLFHLAWAQVLARASGQQRVVFGTVL FT FGRMQGGDGAGSAMGPFINTLPLRVELDSSVEHSVRDMQARLAALLEHEHASLALAQRC FT SGVPAGMPLFSALFNYRHNAARPVEGQPVDSASLLNVEGRTNYPLTLSVDDADQALRLS FT VQVVRPFDANRVCGYMQQALESLAEALEYAPNLPVWQLEVLPREERTLLLQTWNATMTS FT YPAHECIHQLFEAQVERSPDAIALVYEEQTLSYAQLNARANRLAHRLIDLGIQPGNYVA FT TLLERSIDLVVAQLAILKAGAAYVPIDPRAPTERQSWIMSDCAAQLLLTDAHTEVAASA FT STALLRLGSPDKEDAEHTPTTCPQPACCSLDTAYVMYTSGSTGMSKGVLVPHRAIARLV FT INNGYVDVEADDRVAFAANPAFDASTFEVWAPLLNGAAAVVMDHDTVLTPALFAQTLRE FT QRISVLWLTVGLFNQMAVELGPVFPQLKALIVGGDALDASVVGQVLRETPPQQLINGYG FT PTESTTFATTYRITAVPKGNVNIPIGRPIANTRIYLLDAHGQPVPLGAVGELHIGGAGV FT AHGYLNRPELTAECFVRDPFSNEPDARMYKTGDLARYLPDGNLEFVGRNDEQVKIRGFR FT IEPGEIEACLVQHEQVRDAVVLVRGESINKRLVAYVVAEPNEALVSELRTHVAARLPEY FT MVPAAFVRLDALPLTPNGKLDRRALPEPDAGALAHHVYEAPRGELETTLAQIWAELLEV FT ERVGRHDSFFALGGHSLLAVRLMNRVGALGADVPLAALFASPTLAAFAAVVSAQLNQQT FT SALPEITPVSREGGLPLSFAQQRLWFLAQLDEVSANYHIPLVLHVHGSLNRDAWQQALG FT ALFARHEALRSTFVSVEGQPQVQLLPAGTGVPLHWHDLRGVPDADAQLSRLTADEVHAP FT FDLARGPLMRACVIQLADDNYQCVLTQHHIVSDGWSLDVLIRELSALYAASVGEQAVPL FT PSLAIQYPDYAAWQRQWLSGERLQTQSDYWRTTLADAPVLLELPTDRPRPAQQSFAGAH FT VPVQIDASTTQALKRLSAEHGTTLFMTVLAAWSAVLARLSGQDDLVIGTPSANRGHAAI FT EPLIGFFVNTLALRVDLSGEPNTSELLKRVRCTTLDAQAHQDLPFEQVVEIVQPPRRLN FT HTPLSQVMFAWQSNEIGQWSLPELDVKPGELEYDMVRFDLEMHLYEAGEGITGSLHYAS FT ALFDPATIERHVGYLKTMLQAMAACPQQPVATLQMLGADERQLLLQTWNTTTAFYPAHQ FT CIHQLFEAQVQRSPDATVLVYEEQTLSYAQLNARANRLAHRLIELGVKPDTRVVLCVER FT SPAMVVGLLAILKAGGAYVPLDPAYSSERLTHILADTAPTIVLADAAGCAALGDAVRSS FT CTVVDPNRLPEAADTNPSVSGLKAHDLAYVIYTSGSTGTPKGVMVEHAQVVRLFDATHS FT WYGFNEHDTWCLFHSFAFDFSVWELWGALRYGGKLVIVPHHIARSAQAFHQLVCEQGVT FT VLNQTPSAFKAFIASQAQSALSDQLRYVIFGGEALEPAILQAWYATRDERRPQLVNMYG FT ITETTVHVTYRALRQQDSEQAGNPIGVRIPDLKIYLLDAHGQPVPLGAVGELYIGGAGV FT ARGYSNRPELTAERFVRDPFSDAPDARMYKTGDLARYLPDGNLEFVGRNDEQVKIRGFR FT IEPGEIEACLMQHEQVRDAVVLVRGESVDKRLVAYVVAEADEQLASTLRTHVATHLPEY FT MVPAAFVRLDALPLTPNGKLDRRALPEPDAGALAHHAYEAPQGELETTLATIWAELLGI FT ERVGRHDSFFALGGHSLLAVRLMNRVRALGTDVPLATLFASPTLAAFAAAVSAQLNQQT FT SALPEITPVSREGDLPLSFAQQRLWFLAQLDGINGTYHIPLVLRARGPFDRAAWQQALD FT ALFARHEALRSTFVSVEGQPQVRLLPADTGVPLHWHDLRGVPDADVQLARLSHSEARAP FT FDLVHGPLIRSCGIQLTDDEHVLLLTKHHIVSDGWSIGVLVRELSALYATRVGAPAEPL FT PALAIQYPDYAAWQRQWLSGERLEDQSDYWRATLADAPVLLELPTDRPRPAQQSFAGAH FT VPVQIDAQTTRVLKQLSAEHGTTLFMTVLAAWSAVLARLSGQDDLVIGTPTANRGHAAI FT EPLIGFFVNTLALRVDLEGEPTTMQLLERVRRTTLDAQAHQDLPFEQVVEIVQPPRRLN FT HTPLFQVLFAWQSNETGQWRLPGLDVTSGELEYDIARFDLEMHLYEAGEEIIGSLHYAS FT ALFDPATIERHVGYLTTMLQAMAACPQQPVATLQMLGADERQLLLQTWNATAAPYPAYP FT CIHQLFEAQVERTPDATALVYEAQTLRLCAAQCTGEPSRASAH" FT CDS complement(672716..672808) FT /transl_table=11 FT /locus_tag="RBRH_02786" FT /db_xref="EnsemblGenomes-Gn:RBRH_02786" FT /db_xref="EnsemblGenomes-Tr:CBW77043" FT /db_xref="UniProtKB/TrEMBL:E5AVB9" FT /protein_id="CBW77043.1" FT /translation="MLFCSDFVGFEEGKKLWLLEITIYSVFASQ" FT CDS 673345..674259 FT /transl_table=11 FT /locus_tag="RBRH_02783" FT /product="Hypothetical cytosolic protein" FT /function="Hypothetical cytosolic protein" FT /note="Hypothetical cytosolic protein" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: Putative transposase, YhgA-like::PF04754" FT /db_xref="EnsemblGenomes-Gn:RBRH_02783" FT /db_xref="EnsemblGenomes-Tr:CBW77044" FT /db_xref="InterPro:IPR006842" FT /db_xref="InterPro:IPR010106" FT /db_xref="UniProtKB/TrEMBL:E5AVC0" FT /protein_id="CBW77044.1" FT /translation="MKRSSTMTPHDALFKQFLTHPETARDFLSLHLPTQWLAQCDLDTL FT RLESGSFVEEDLRAYYSDVLWSLQTRQGDGYVYALIEHQSRPERHMAFRLMRYAIAAMQ FT RYLEAGHDQLPLVIPMLFYHGQVSPYPYSMRWLDSFEVPELASQLYAGGFPLVDVTVIP FT DDEIITHRRMAMLELLQKHIRQRDLATLVEQLASLLLAGYTTHEQLVSLMHYMLQWGDT FT TDPERFIRELALRSPQHEEVLMTIAQKLEQKGLERGRMLGREEGQKEAALKIARTLLAN FT GLERETVRRMTGLSEAEMKQICH" FT CDS complement(674370..674597) FT /transl_table=11 FT /locus_tag="RBRH_02782" FT /db_xref="EnsemblGenomes-Gn:RBRH_02782" FT /db_xref="EnsemblGenomes-Tr:CBW77045" FT /db_xref="UniProtKB/TrEMBL:E5AVC1" FT /protein_id="CBW77045.1" FT /translation="MVAQGSWRWRERVAGSGRNTTETLGCAADCDPHACIIHVPVWAGG FT DTRFGVIRDAAFTNTGFTLTSAAISAFAAR" FT CDS 674703..675245 FT /transl_table=11 FT /locus_tag="RBRH_02781" FT /product="Transposase" FT /function="Transposase" FT /note="Transposase" FT /note="COG: Transposase and inactivated derivatives, IS5 FT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_02781" FT /db_xref="EnsemblGenomes-Tr:CBW77046" FT /db_xref="InterPro:IPR008490" FT /db_xref="UniProtKB/TrEMBL:E5AVC2" FT /protein_id="CBW77046.1" FT /translation="MDPKTPVPEGDLFRQPLREQIDLKHPLVQLAELIDWDRLSTAMGA FT NFVSQRDRPATSPRLIAGLLYLQHAFGLSDKDAVWQWLENPYWQVSTGQTYLQNRLPFD FT PSSLTRWRKRLDEAGVEELLVETIEAAKRAHVIKTSSLKRVIVDTTVMEKAIAHPSDSR FT LLERCRAQKQSRSRRAY" FT CDS complement(675247..675510) FT /transl_table=11 FT /locus_tag="RBRH_02780" FT /db_xref="EnsemblGenomes-Gn:RBRH_02780" FT /db_xref="EnsemblGenomes-Tr:CBW77047" FT /db_xref="UniProtKB/TrEMBL:E5AVC3" FT /protein_id="CBW77047.1" FT /translation="MSWTRRTVGSARGRRHGAGAAVRRPSLASAPGYLVSHGCRATGIR FT VVNRIEAIDHAVSLAARVPTQGRFINLSVRPCLEVRGQSHYG" FT CDS complement(675359..675559) FT /transl_table=11 FT /locus_tag="RBRH_04280" FT /db_xref="EnsemblGenomes-Gn:RBRH_04280" FT /db_xref="EnsemblGenomes-Tr:CBW77048" FT /db_xref="UniProtKB/TrEMBL:E5AVC4" FT /protein_id="CBW77048.1" FT /translation="MTRVGIPVDACSKPRAGELDATNGWLGAWTPTRRRRGGATPFAGE FT RARLSRFAWLSRHGHSRRQSD" FT CDS 675583..677709 FT /transl_table=11 FT /locus_tag="RBRH_02779" FT /product="Phospholipase D (EC 3.1.4.4)" FT /function="Phospholipase D (EC 3.1.4.4)" FT /EC_number="3.1.4.4" FT /note="Phospholipase D (EC 3.1.4.4)" FT /note="COG: FT Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin FT synthases and related enzymes" FT /note="Pfam: SNARE associated Golgi FT protein::PF09335
Phospholipase D Active site FT motif::PF00614" FT /db_xref="EnsemblGenomes-Gn:RBRH_02779" FT /db_xref="EnsemblGenomes-Tr:CBW77049" FT /db_xref="GOA:E5AVC5" FT /db_xref="InterPro:IPR001736" FT /db_xref="InterPro:IPR015414" FT /db_xref="UniProtKB/TrEMBL:E5AVC5" FT /protein_id="CBW77049.1" FT /translation="MHTRSTHGLLEVGRNCDSLCHADRFSVLIDAAVYFSALREAIRGA FT QHTVFIVGWDINSRMKLVPQGAADGFPEPLGAFLQAVASANRRLRIYVLAWDFAMIYAF FT EREWVPVYSTGWRSHRRILFRMDNTHPRGASHHQKFVVVDDRLAFVGGLDLTRARWDTP FT AHAANDPWRRNPDGSPYNPFHDVHTVFDGEAARAIGQLARGRWRRACGKALAIRADRNL FT GGTDPWPSSVPVDVHNVVLGIALTAPPYRNERGVQHIRALTVDIIEATQHNLYIENQYL FT TAAVVRDALSRRLGDPHAPDVAAVVPRNHSGWLQEATMGALRARLHRALTRADRHGHYR FT LWCPHIDGLRTGCLNVHSKLMISDNERLCVGSANLNNRSMVLDTECNVVLDANGSDRVR FT AVIASIRNRLLAEHLDVSPEAVAAALQHHGRLNSAIDALRHHARTLMPLDPTIAPELEA FT LVPVSAWADPEVPVEADALVRQFLDDDQGARSAARLLLLGALALALATLAALWRFTPAG FT QVLSVANVVHWGERLAALPLAPAIVLLGYVVASLAAVPITLLIAATGLVFGTWPGAVYA FT LVGSMLAAAATYYVGVGLGRDAVRRLAGSRANRLSERLGKRGLLTILVLRLVPVAPFSI FT VNLVAGASHIGICDFLLGTLLGMAPGAVLTVTFAHQLIASIRRPDAGSLALLIGIGAAL FT VALSILLHKLLKKH" FT CDS 677706..678527 FT /transl_table=11 FT /locus_tag="RBRH_02778" FT /product="Endonuclease/Exonuclease/phosphatase family FT protein" FT /function="Endonuclease/Exonuclease/phosphatase family FT protein" FT /note="Endonuclease/Exonuclease/phosphatase family protein" FT /note="COG: Metal-dependent hydrolase" FT /note="Pfam: Endonuclease/Exonuclease/phosphatase FT family::PF03372" FT /db_xref="EnsemblGenomes-Gn:RBRH_02778" FT /db_xref="EnsemblGenomes-Tr:CBW77050" FT /db_xref="GOA:E5AVC6" FT /db_xref="InterPro:IPR005135" FT /db_xref="UniProtKB/TrEMBL:E5AVC6" FT /protein_id="CBW77050.1" FT /translation="MTTMAYSELRIATYNIHGAGGRWRQRSTQRIAGVVAELDADIIAL FT QEVPLNGASNAPGVLDDLQHATGMEAVAGPTLQTERGDYGNAVLSRLPIRAARTLDLSF FT TRREPRGALDADIEYADGVLRVVATHLGLSAIERSAQVRTLLAAFDSSALPVILLGDIN FT EWFVHGRALRALVGHFRRAPAPRTFPARWPILSLDRIWVHPGEWLIDVQVHRSALARVA FT SDHLPLIARIRATGNGTRPLEVAGVAAPMGLQDSATRTGEDPTGDIRSLPR" FT CDS complement(678544..679350) FT /transl_table=11 FT /locus_tag="RBRH_02777" FT /product="Succinate dehydrogenase iron-sulfur protein (EC FT 1.3.99.1)" FT /function="Succinate dehydrogenase iron-sulfur protein (EC FT 1.3.99.1)" FT /EC_number="1.3.99.1" FT /note="Succinate dehydrogenase iron-sulfur protein (EC FT 1.3.99.1)" FT /note="COG: Succinate dehydrogenase/fumarate reductase, FT Fe-S protein subunit" FT /db_xref="EnsemblGenomes-Gn:RBRH_02777" FT /db_xref="EnsemblGenomes-Tr:CBW77051" FT /db_xref="GOA:E5AVC7" FT /db_xref="InterPro:IPR001041" FT /db_xref="InterPro:IPR004489" FT /db_xref="InterPro:IPR009051" FT /db_xref="InterPro:IPR012675" FT /db_xref="InterPro:IPR017896" FT /db_xref="InterPro:IPR017900" FT /db_xref="InterPro:IPR025192" FT /db_xref="UniProtKB/TrEMBL:E5AVC7" FT /protein_id="CBW77051.1" FT /translation="MNRPLWVGSAAPAWEWLLRTIVFPLLDFPERVAMTQRRIIDVFRY FT DPDRDERPRMQRYEIEPQPEDRMLLDVLGRLKALDETLAYRRSCREGICGSDAMNINGV FT NGLACLTNMQSLPVHIQLRPLPGLPVVRDLIVDMTSFFNQYHSVKPYLINETPPPERER FT LQTPQERDQLDGLYECILCACCSSACPSYWWNPDKFVGPAGLLQAYRFIVDSRDEATGE FT RLDNLEDPYRLFRCRTIMNCADVCPKGLNPAAAIGHIRSMLARRAL" FT CDS complement(679506..680267) FT /transl_table=11 FT /locus_tag="RBRH_02776" FT /product="4'-phosphopantetheinyl transferase (EC 2.7.8.-)" FT /function="4'-phosphopantetheinyl transferase (EC 2.7.8.-)" FT /EC_number="2.7.8.-" FT /note="4'-phosphopantetheinyl transferase (EC 2.7.8.-)" FT /note="COG: Phosphopantetheinyl transferase" FT /note="Pfam: 4'-phosphopantetheinyl transferase FT superfamily::PF01648" FT /db_xref="EnsemblGenomes-Gn:RBRH_02776" FT /db_xref="EnsemblGenomes-Tr:CBW77052" FT /db_xref="GOA:E5AVC8" FT /db_xref="InterPro:IPR008278" FT /db_xref="UniProtKB/TrEMBL:E5AVC8" FT /protein_id="CBW77052.1" FT /translation="MTEDATHITMTTLLRPGGRWPDDVMLWHVRVPLAPTAWNRLQAWL FT SDDEQQQALRYRRDEDRLRFAATRAVLRTLLARHTGGVPLSLRFSSGPFGRPELDGYGD FT TLSFNVTHAGQHAFIALSDRRCVGVDIECIERVLDWQALLGTVCTDAEQRALRMSGHVH FT GAHGFFRCWTAKEAVLKALGVGIGYGLQQVSVDPFAQGVQRVDAPARGAWGDITALQLH FT WIDDVAGYAGCIAFGPPGSVSAHPRQAPTSG" FT CDS complement(680264..680539) FT /transl_table=11 FT /locus_tag="RBRH_02775" FT /db_xref="EnsemblGenomes-Gn:RBRH_02775" FT /db_xref="EnsemblGenomes-Tr:CBW77053" FT /db_xref="UniProtKB/TrEMBL:E5AVC9" FT /protein_id="CBW77053.1" FT /translation="MAPRRLTTTNSEDFGWKRLLNASTHRPDAGHQTGSGAWPIRNPYK FT ISSRAFHQTGFDSRPGRLHRLQLGHKRKVPVAALRRAVTFSPAHKR" FT CDS complement(680765..681718) FT /transl_table=11 FT /locus_tag="RBRH_02774" FT /product="Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" FT /function="Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" FT /EC_number="4.1.3.4" FT /note="Hydroxymethylglutaryl-CoA lyase (EC 4.1.3.4)" FT /note="COG: Isopropylmalate/homocitrate/citramalate FT synthases" FT /note="Pfam: HMGL-like::PF00682" FT /db_xref="EnsemblGenomes-Gn:RBRH_02774" FT /db_xref="EnsemblGenomes-Tr:CBW77054" FT /db_xref="GOA:E5AVD0" FT /db_xref="InterPro:IPR000138" FT /db_xref="InterPro:IPR000891" FT /db_xref="InterPro:IPR013785" FT /db_xref="InterPro:IPR027167" FT /db_xref="UniProtKB/TrEMBL:E5AVD0" FT /protein_id="CBW77054.1" FT /translation="MTEDRSDPVAKPRSNVPGLPGWVKIVEVGPRDGLQAEKVQVPTDV FT KVELLDRLSAAGFANIEAASFVSPKWVPQMADGADVMARIQRRAGTLYSALTPNMQGLE FT AALAARVDEVVIFGAASEAFSQRNINCSIAESLARFAPVAKAAKEAGLRLRGSISCSLG FT CPYQGDVAVDAVVDVVTRMRDLGCDEIDIADTIGVGTANRVLEVAEAVSSVFPLECIAG FT HFHDTYGQALANIYAGLQAGITIFHSSVAGLGGCPYAKGATGNVATEDVLYLLHGLGIE FT TGVDLNAVVAAGDFISRAIDKPNGARAGRALLANTV" FT CDS complement(681715..683733) FT /transl_table=11 FT /locus_tag="RBRH_02772" FT /product="Methylcrotonyl-CoA carboxylase biotin-containing FT subunit (EC 6.4.1.4)" FT /function="Methylcrotonyl-CoA carboxylase biotin-containing FT subunit (EC 6.4.1.4)" FT /EC_number="6.4.1.4" FT /note="Methylcrotonyl-CoA carboxylase biotin-containing FT subunit (EC 6.4.1.4)" FT /note="COG: Acetyl/propionyl-CoA carboxylase, alpha FT subunit" FT /note="Pfam: Biotin carboxylase C-terminal FT domain::PF02785
Biotin-requiring FT enzyme::PF00364
Carbamoyl-phosphate synthase L chain, FT ATP binding domain::PF02786
Carbamoyl-phosphate synthase FT L chain, N-terminal domain::PF00289" FT /db_xref="EnsemblGenomes-Gn:RBRH_02772" FT /db_xref="EnsemblGenomes-Tr:CBW77055" FT /db_xref="GOA:E5AVD1" FT /db_xref="InterPro:IPR000089" FT /db_xref="InterPro:IPR001882" FT /db_xref="InterPro:IPR005479" FT /db_xref="InterPro:IPR005481" FT /db_xref="InterPro:IPR005482" FT /db_xref="InterPro:IPR011053" FT /db_xref="InterPro:IPR011054" FT /db_xref="InterPro:IPR011761" FT /db_xref="InterPro:IPR011764" FT /db_xref="InterPro:IPR013815" FT /db_xref="InterPro:IPR013816" FT /db_xref="InterPro:IPR016185" FT /db_xref="UniProtKB/TrEMBL:E5AVD1" FT /protein_id="CBW77055.1" FT /translation="MFKKILIANRGEIACRVAATCRRLGIHSVAVYSDADAKAKHVSAC FT DEAVHIGAAPTAESYLRIERIIDAAQRTGAQAVHPGYGFLSENEAFAQACAAAGIEFIG FT PPVSAIAAMGSKAAAKALMQAAAVPLVPGYHGEDQDPARLQREADAIGYPVLLKASAGG FT GGKGMRVVERREEFAAALASCQREAASSFGDDRVLVEKYLVHSRHVEVQVFADKHHNAV FT YLFDRDCSVQRRHQKVLEEAPAPGLSDDTRRAMGAAAVAAARAVDYVGAGTVEFIMAPG FT GEFYFIEMNTRLQVEHPVTERVTGLDLVEWQLRVAAGEKLPLQQHALHVSGHAIEARIY FT AENPARGFLPSTGTLLHLRMPDAVEFSVGAQGGPASRAPVRIDSGVRQGDMITPYYDPM FT IAKLIVHGVDRGDALARLSRALREIEIVGPHTNIEFLHRISTSEPFTHAKLDTGLIERH FT HAALFARREKPVGEALALATAALLARERDTSPWSVLSHWRLNGPYTQVIEWRDLERAGD FT ARLAVRFQCDANGAVLELNGKALPFAWWGGDGAHELNMVLGVRRITGRVFIDRDTFHVF FT LRGDAFAFEWQNLLAHAAHAEHGEGRLTAPMPGKVIAVLVEPGALVNKGTPLIMMEAMK FT MEHTIEAPAAGKVEQILYAVGDQVDDGAQLLTLEVTS" FT CDS complement(683806..684609) FT /transl_table=11 FT /locus_tag="RBRH_02771" FT /product="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /function="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /EC_number="4.2.1.18" FT /note="Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" FT /note="COG: Enoyl-CoA hydratase/carnithine racemase" FT /note="Pfam: Enoyl-CoA hydratase/isomerase family::PF00378" FT /db_xref="EnsemblGenomes-Gn:RBRH_02771" FT /db_xref="EnsemblGenomes-Tr:CBW77056" FT /db_xref="GOA:E5AVD2" FT /db_xref="InterPro:IPR001753" FT /db_xref="InterPro:IPR014748" FT /db_xref="InterPro:IPR018376" FT /db_xref="UniProtKB/TrEMBL:E5AVD2" FT /protein_id="CBW77056.1" FT /translation="MRGGEAMQYDTLTLGCEDTLATVTLNRPQVRNAFNETMIAELTSV FT FGMLGQRGEIRAIVLAANGVAFCAGADLNWMRKMAGYSDDENRADACMLARMLATIYRC FT PKPVVARVNGDVYAGGMGLISASDIVVAQENARFCLSEARLGLIPATIAPYVIRVIGER FT AARRYFTTAEPFDGTTALRLGLVSELVPQVALDETVRRLADALVANGPAAVAESKRLVQ FT DIAGRPLTDEWMDETAERIARVRASAEGREGVASFLEKRAPRWRM" FT CDS complement(684636..686243) FT /transl_table=11 FT /locus_tag="RBRH_02770" FT /product="Methylcrotonyl-CoA carboxylase carboxyl FT transferase subunit (EC 6.4.1.4)" FT /function="Methylcrotonyl-CoA carboxylase carboxyl FT transferase subunit (EC 6.4.1.4)" FT /EC_number="6.4.1.4" FT /note="Methylcrotonyl-CoA carboxylase carboxyl transferase FT subunit (EC 6.4.1.4)" FT /note="COG: Acetyl-CoA carboxylase, carboxyltransferase FT component (subunits alpha and beta)" FT /note="Pfam: Carboxyl transferase domain::PF01039" FT /db_xref="EnsemblGenomes-Gn:RBRH_02770" FT /db_xref="EnsemblGenomes-Tr:CBW77057" FT /db_xref="GOA:E5AVD3" FT /db_xref="InterPro:IPR000022" FT /db_xref="InterPro:IPR011762" FT /db_xref="InterPro:IPR011763" FT /db_xref="UniProtKB/TrEMBL:E5AVD3" FT /protein_id="CBW77057.1" FT /translation="MPVLETKLNPRSDAFRANEAAQQARVADLREKIAALAQGGGQAAR FT DKHLARGKLLPRERIAQLLDPGTPFLELSQLAAYGMYGGDAPGAGIITGIGRIAAQECV FT IVCNDPTVKGGTYYPMTVKKHVRAQEIAQENRLPCLYLVDSGGANLPNQDEVFPDRDHF FT GRIFYNQANLSAQGIAQIAVVMGSCTAGGAYVPAMSDESIIVKDQGTIFLGGPPLVKAA FT TGEVVTAEDLGGGDVHTRLSGVADHLAQNDAHALAIARRIVGNLNRVKPQSLALREPKP FT PRYDARELYGVIPTDTRKPFDVHEVIARLVDDSVFDEFKARYGTTLVTGFAHLWGHPVG FT IVANNGILFSESALKGAHFIELCCQRRIPLIFLQNITGFMVGRKYENEGIARHGAKMVT FT AVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRMLWMWPNARISVMGGEQAACVLATVR FT RDGIEAKGGTWSAEDEEAFKVPIRAQYEHQGHPYYASARLWDDGVIDPAQTRDVLGLSL FT SAAMNAPIGEARFGVFRM" FT CDS complement(686256..687521) FT /transl_table=11 FT /locus_tag="RBRH_02769" FT /product="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /function="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /EC_number="1.3.99.10" FT /note="Isovaleryl-CoA dehydrogenase (EC 1.3.99.10)" FT /note="COG: Acyl-CoA dehydrogenases" FT /note="Pfam: Acyl-CoA dehydrogenase, C-terminal FT domain::PF00441
Acyl-CoA dehydrogenase, C-terminal FT domain::PF08028
Acyl-CoA dehydrogenase, middle FT domain::PF02770
Acyl-CoA dehydrogenase, N-terminal FT domain::PF02771" FT /db_xref="EnsemblGenomes-Gn:RBRH_02769" FT /db_xref="EnsemblGenomes-Tr:CBW77058" FT /db_xref="GOA:E5AVD4" FT /db_xref="InterPro:IPR006089" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR013786" FT /db_xref="UniProtKB/TrEMBL:E5AVD4" FT /protein_id="CBW77058.1" FT /translation="MLLNSMPGCRRRCTGRRYCRVVCRSEEKMRHIPGLQFPLGEDIEM FT LRKSVAHFAAKEIAPRAADVDRTDQFPVDLWKKFGDLGVLGMTVSAEYGGVNMGYLAHM FT VAMEEISRACASIGLSYGAHSNLCVNQIHRNGNEAQKRKYLPKLVSGEHVGALAMSEPN FT AGSDVVSMRLRADKKRDRYVLNGTKTWITNGPDCDTLVVYGKTDLEAGARGMTAFIVEK FT GTKGFSVAQKLDKLGMRGSHTGELVFEDVEVPHENVLGQVGGGVKVLMSGLDYERAVLA FT GGPTGIMRACLDAVVPYIHDRKQFSQSIGEFQLIQGKVADMYTTLQACRAYLYAMGSQL FT DKLGSEHVRQMRKDCAGVILYTAEKATWMAGEAIQILGGNGYLNAFPVGRLWRDAKLYE FT IGAGTSEIRRILIGRELFAETM" FT CDS 687600..688385 FT /transl_table=11 FT /locus_tag="RBRH_02768" FT /product="Transcriptional regulator, TetR family" FT /function="Transcriptional regulator, TetR family" FT /note="Transcriptional regulator, TetR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: Bacterial regulatory proteins, tetR FT family::PF00440" FT /db_xref="EnsemblGenomes-Gn:RBRH_02768" FT /db_xref="EnsemblGenomes-Tr:CBW77059" FT /db_xref="GOA:E5AVD6" FT /db_xref="InterPro:IPR001647" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR011075" FT /db_xref="InterPro:IPR013570" FT /db_xref="InterPro:IPR015893" FT /db_xref="InterPro:IPR023772" FT /db_xref="UniProtKB/TrEMBL:E5AVD6" FT /protein_id="CBW77059.1" FT /translation="MSDAHIMIDSPTVMNDPITGPPAPTSGRPPLPRDTATRRVPAGAK FT SQQRVRQILSVGRDVFSERGYEHATTAEIAQRVGIAEATVFSYFSSKRELCARVISDWY FT DEIIEATERGLPRDGSVRQQFAFIVRTHLRLMLLNGTGLCSLVLSEGRTKHHELSETFM FT QLQRRYTKPLMDVLAHGQRLGQIRRDVPLRLLRSMIFGPMEHVLWDATLTKRATDIEAT FT AEQLIDMLWSALQPSHTEWAALVQFRDDVEQALERLPAR" FT CDS 688520..688711 FT /transl_table=11 FT /locus_tag="RBRH_02767" FT /db_xref="EnsemblGenomes-Gn:RBRH_02767" FT /db_xref="EnsemblGenomes-Tr:CBW77060" FT /db_xref="UniProtKB/TrEMBL:E5AVD5" FT /protein_id="CBW77060.1" FT /translation="MRNERCVFPSRLSCQLLARAQPDGTYQPYIVIARCSDGEWLVNPF FT FPPTLRLPTRDAAIEHCR" FT CDS 688772..689632 FT /transl_table=11 FT /locus_tag="RBRH_02766" FT /db_xref="EnsemblGenomes-Gn:RBRH_02766" FT /db_xref="EnsemblGenomes-Tr:CBW77061" FT /db_xref="UniProtKB/TrEMBL:E5AVD7" FT /protein_id="CBW77061.1" FT /translation="MRKRTSAQWSSEMKYTLIGVFDNRNDAMRAEHALAEAGFPHPDIK FT IHDASRSARPLSENQEQAEMATHAEPAPTAPRNGTAAAHTVHDTPSPLGTKLSAPMARD FT AETPAGANELPGHLSWESIEHWLAAVFRHRRFPSQAARYRQASRDGSALVSVDVYAHLQ FT VPVARDTLLSAGARCVDSHITPPQNDDVLTGRTARPDASCAEPTPPHDPDKDDDHNVAR FT SLTDELGLTDPLAGHCRRPLNRPSAQAGNADATRGASRVAPASDGWHRLKASIRHGWNR FT IVGHR" FT CDS complement(689718..690326) FT /transl_table=11 FT /locus_tag="RBRH_02765" FT /db_xref="EnsemblGenomes-Gn:RBRH_02765" FT /db_xref="EnsemblGenomes-Tr:CBW77062" FT /db_xref="UniProtKB/TrEMBL:E5AVD8" FT /protein_id="CBW77062.1" FT /translation="MDVAVLQISRHRRPIVAATIAVAALAWLGACAPVAGPSDAGPTDA FT ASLRAGFGHGGQPSSAAPATAPTLAAASGTEAASSNAAKGQHGLARDIVVGGDLGYHVT FT LKMTPPAQVCDADAFVDGVRTGYITTWNGLVAASGGALGNGAMHRPVFDPAPVAPSEER FT YRLQWKGGPEPANACAAYGYQIGKVMGTRQAYIDARGAS" FT CDS 690811..692055 FT /transl_table=11 FT /locus_tag="RBRH_02764" FT /product="D-beta-hydroxybutyrate permease" FT /function="D-beta-hydroxybutyrate permease" FT /note="D-beta-hydroxybutyrate permease" FT /note="COG: H+/gluconate symporter and related permeases" FT /note="Pfam: Citrate transporter::PF03600" FT /db_xref="EnsemblGenomes-Gn:RBRH_02764" FT /db_xref="EnsemblGenomes-Tr:CBW77063" FT /db_xref="GOA:E5AVD9" FT /db_xref="InterPro:IPR004680" FT /db_xref="UniProtKB/TrEMBL:E5AVD9" FT /protein_id="CBW77063.1" FT /translation="MFICSSSARARRAAPHRRNPYRIRLAVPGASCYPASSGVAASRSI FT SQDIGTHYCRRLRCMVPIGVDMSFLIVIAALTFLMFAAYRGYSVILFAPVAALGAVLLT FT DPSAVAPVFSGIFMEKLVGFIKLYFPVFLLGAVFGKVIELSGFSESIVAVAIQYIGRSR FT ANAVIVAVCALLTYGGVSLFVVVFAVYPFAAELYRQSNIPKRLIPGAIALGAFSFTMDA FT LPGTPQLPNIIPTTFFKTTAWAAPALSMVGAAFILVVGLAYLEWRRRAALKRGEGYGTS FT LVNEPEHVELANLPHPALAIAPRGARGGGQLRANRTASTMVRRRAHRQRRGLPGHRRTT FT EYTAQKRGRGLGRRRGDTARHLAGRHHRVRARVTAIHRRQQGRGQRRVVGFAQYRIGIR FT VWRRDCNPPRFRGRQ" FT CDS complement(692401..692886) FT /transl_table=11 FT /locus_tag="RBRH_02763" FT /product="dehydrogluconate dehydrogenase, cytochrome c FT subunit (EC 1.1.99.4)" FT /function="dehydrogluconate dehydrogenase, cytochrome c FT subunit (EC 1.1.99.4)" FT /EC_number="1.1.99.4" FT /note="dehydrogluconate dehydrogenase, cytochrome c subunit FT (EC 1.1.99.4)" FT /note="COG: Cytochrome c, mono- and diheme variants" FT /db_xref="EnsemblGenomes-Gn:RBRH_02763" FT /db_xref="EnsemblGenomes-Tr:CBW77064" FT /db_xref="GOA:E5AVE0" FT /db_xref="InterPro:IPR009056" FT /db_xref="UniProtKB/TrEMBL:E5AVE0" FT /protein_id="CBW77064.1" FT /translation="MAEAVQHSFSHMTDADLTAIATYLHTVPAVRGDARRARHGWGSPA FT RDVTALRGVAPDAARDPARLYLGNCATCHHASGQGTPDGYYPPLLHNSTVGATNPTNLI FT QVILHGVQRNAAGNEVSMPGFAQDLTNAQIAALVNYVTRQFGNPAVSVTERDVAKLR" FT CDS complement(692789..693298) FT /transl_table=11 FT /locus_tag="RBRH_02762" FT /note="COG: Beta-glucosidase-related glycosidases" FT /db_xref="EnsemblGenomes-Gn:RBRH_02762" FT /db_xref="EnsemblGenomes-Tr:CBW77065" FT /db_xref="InterPro:IPR024651" FT /db_xref="UniProtKB/TrEMBL:E5AVE1" FT /protein_id="CBW77065.1" FT /translation="MNRDTVDQAAATVHSGARRAWLQKTLACVAAGLVGSPLLRAAAQG FT NDALLDAFMTVSRALTGKATLPRDVGGRLAEALQKKTPDLAQRVQQLAGALASGKLNDA FT QTALALRILQAWYVGEVDGMVVIYEQALIGCRTHGRGGAAQLLAYDRRGPDCDRDVPAH FT GAGRAR" FT CDS complement(693492..693890) FT /transl_table=11 FT /locus_tag="RBRH_02761" FT /product="Outer membrane porin protein 32 precursor" FT /function="Outer membrane porin protein 32 precursor" FT /note="Outer membrane porin protein 32 precursor" FT /note="COG: Outer membrane protein (porin)" FT /db_xref="EnsemblGenomes-Gn:RBRH_02761" FT /db_xref="EnsemblGenomes-Tr:CBW77066" FT /db_xref="InterPro:IPR023614" FT /db_xref="UniProtKB/TrEMBL:E5AVE2" FT /protein_id="CBW77066.1" FT /translation="MSLRSARRPGERERGAGAHNTYFGLRGDEDWGTGLHAIFKLESGF FT NLNNGQYSESGSIFNRQAYVGLRNDQYGALTLGRQYDSVVDYLAPLSAAGSGYGNNLAG FT HPFDNDNLDNTFSIKNAVKYTSPNYYGV" FT CDS complement(693853..695055) FT /transl_table=11 FT /locus_tag="RBRH_02760" FT /product="Alkylated DNA repair protein alkB" FT /function="Alkylated DNA repair protein alkB" FT /note="Alkylated DNA repair protein alkB" FT /note="COG: Alkylated DNA repair protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02760" FT /db_xref="EnsemblGenomes-Tr:CBW77067" FT /db_xref="GOA:E5AVE3" FT /db_xref="InterPro:IPR005123" FT /db_xref="InterPro:IPR027450" FT /db_xref="UniProtKB/TrEMBL:E5AVE3" FT /protein_id="CBW77067.1" FT /translation="MRATRNGKRILRRRGHGRDAVNSKKPARWPHGAVLRWRCSVGGQA FT LWTDARTESWLRHRRRLPAAWAVAATRAPAGCGASTWRRARWCSACDVGCGAQSRPSSI FT ALSISSNACWASSSSCSAASKVVSAKPDGRPSPSGGNCFCSAANALCTPRVAVTTRCMA FT RVSAARICSTDMVCILNGWDKRDTIRAYASFRRSMLDLFDDVPKPDIDWYPNCLTPAVA FT AHSLRQLTHEVAWRQDWINTPRGRIPLPRLTAWQGDPDAVYVYSGIRNVPARWTPTVLV FT LRRIVERVAATRFNSVLLNRYRHGKDGMGWHADDEASLGQQPIIGSLSLGAARTFELRH FT NATGAVHALRLTSGSLLVMRGRTQAEWKHRVPKTAALVAERLNLTFRWVEPTQRTAAGR FT A" FT CDS complement(694985..695407) FT /transl_table=11 FT /locus_tag="RBRH_02759" FT /product="Immunity protein" FT /function="Immunity protein" FT /note="Immunity protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02759" FT /db_xref="EnsemblGenomes-Tr:CBW77068" FT /db_xref="InterPro:IPR016410" FT /db_xref="UniProtKB/TrEMBL:E5AVE4" FT /protein_id="CBW77068.1" FT /translation="MGVRHQASPVFVLRHGAGSTIVSIMRITIIQLIQALAALLLYFAP FT SIVADRRKRPDTLMLALFNVCLGWTVLGWLLALHWALGPVARALDAGELTVRRRTLTMR FT MLSNSLTQRARRTDARDAQREADIKAARARARRGEF" FT CDS 695386..697359 FT /transl_table=11 FT /locus_tag="RBRH_02758" FT /product="Undecaprenyl-phosphate-4-amino-L-arabinose--lipid FT A 4-amino-L-arabinosyltransferase (EC 2.4.2.-)" FT /function="Undecaprenyl-phosphate-4-amino-L-arabinose--lipi FT d A 4-amino-L-arabinosyltransferase (EC 2.4.2.-)" FT /EC_number="2.4.2.-" FT /note="Undecaprenyl-phosphate-4-amino-L-arabinose--lipid A FT 4-amino-L-arabinosyltransferase (EC 2.4.2.-)" FT /note="COG: 4-amino-4-deoxy-L-arabinose transferase and FT related glycosyltransferases of PMT family" FT /db_xref="EnsemblGenomes-Gn:RBRH_02758" FT /db_xref="EnsemblGenomes-Tr:CBW77069" FT /db_xref="GOA:E5AVE5" FT /db_xref="UniProtKB/TrEMBL:E5AVE5" FT /protein_id="CBW77069.1" FT /translation="MPGAERPSRDDQACDSQFDKPTGRLAVCSSLPPVNLAVETGSTIS FT QRCMKSKPIRPPQQAAPGTPPGAPTPDALSATGPWAARALALRRTVLIVLAALLYLLPG FT ILGHAPWKQDETYSFGMIQSFLHGKDWIVPLNAGQPFMEKPPLYYWVAALVAGSLSRWL FT PLHDGARLTTVLCGAVTLLVLAAWSRLRARDNGHTGGAAAPECRDPWQATLITLSLFSG FT TLIMVKHAHDLFTDVALVTGTVCALYGLYRIALRMQAGHGAAFADVAWFGIGTGIAQMT FT KGLFIPGVLALTAAVLPALTPACRSRRYVAAVVAAVGLSMPFFLIWPALLAHRSPELFV FT AWFWDNNVGRFLGFSVDRLGSDNDHAVVLRALLIGAIPSGPLALYALARGGWRKITEPA FT TSIALIFCVFGIGLLSLSATARVLYLLPFVAPLAVLGADGVAQLPAALRRGWSTLSLVL FT FTAFGALAWFVWAVMMRPIAAHGAARWLQKWLPLDYVVPFQPPAVAIAIALCVAWFAAC FT RYARRLGPAQAPFVWCAGVTLAWGLVFTLLLPWLDRAKSYTPVFEQLATSLHADWRSGD FT CMVSVGLGESQAPMLEYVTGIVHRPVPPDAAASSACRWLIVQDDMLMPDAGYEGWKRVW FT QGARQGDTHERLRVFVRDDTRS" FT CDS 697536..698897 FT /transl_table=11 FT /locus_tag="RBRH_02757" FT /db_xref="EnsemblGenomes-Gn:RBRH_02757" FT /db_xref="EnsemblGenomes-Tr:CBW77070" FT /db_xref="InterPro:IPR001810" FT /db_xref="UniProtKB/TrEMBL:E5AVE6" FT /protein_id="CBW77070.1" FT /translation="MDLDINDALNAVKSAVYATDGRYSVQAAAAPPRPARTDHVVCSTA FT LPAPASRTTYDDLPPEVIQQIASHLSYDDIAQLSALNQRSYRILRERRLAWHSCQQIDT FT VVDLASLQQLLDQTQDIQFEPSLRLDSIVALWYRLPRLPAAEQPEAFKRLFRAADGIPG FT HSHVVQQAMIISIVQYAPQQRVELFDFAQAIAEQHRNGHQSLWASLASTLSCLPLWPSQ FT FAARYQALLGRLPSLGQTQQAELIAVLAKQLSALRDGNHGAALDVSTEYGILQDWTRRL FT PPSLQGAPVGALAAAVSELSDAQRPFRYADMQQLALRLPSDQLMIALQPLLLGLATLPT FT ARHAHELSTLESTLLRASPPVRIQAVHQLIETTPRLHGTLSWQIWQRALRLLDGGGTDG FT VDALKVLEAARRDGVINMLGKGQREDAVMETMDFIQRNHLTKQASAALLACLMP" FT CDS complement(699166..700983) FT /transl_table=11 FT /locus_tag="RBRH_03515" FT /product="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /function="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /EC_number="1.2.4.-" FT /note="Acetoin dehydrogenase E1 component beta-subunit (EC FT 1.2.4.-)" FT /note="COG: Carboxypeptidase C (cathepsin A)" FT /db_xref="EnsemblGenomes-Gn:RBRH_03515" FT /db_xref="EnsemblGenomes-Tr:CBW77071" FT /db_xref="GOA:E5AVE7" FT /db_xref="UniProtKB/TrEMBL:E5AVE7" FT /protein_id="CBW77071.1" FT /translation="MVTIMKMELNKCLRRLIKPSRACSSAMAIAVALSMTACGGGGGES FT GVGDAIGGGQPDTRTATALHASVLSKKPVSVPSERSLSMPVAAYHQMQHGDETLDLAAT FT AGMVPIEGAPDDAQIVYVAYTQRDVEPSSRPITFFFGDSVRDDPLRSTGYLLLASVGPI FT VGELSGQGNWDRYDNLSTLLDVSDLVFVHPTQSGCHGDFWGNLQAGRAAMHFIDTYLDT FT NQRRGSPVYLVTHGARVAGHAIDLLKTRPHGFAGMAFISPTLGPDGRAEHREPPVEISW FT ELGVQWLIHLDDDLGFDVARHLPAEFDRLTRSPYSGADDVRRCANEPFWVQRSEASPWS FT ANRLVEAVPAGDAPRLFIAYGSDVQKQAFSSELSRLNAPPALANRIKVESYRGFPEGDS FT RRDLFYLDDVSRMRLRIGLRWLYASRDDAAVDGLSHNEKPSRMTERSGAWLQERDGGLE FT LGMMEDTTRDPLADSVSEQYEESGISTPSQLNRDWIDQLSSPFAEDLSEDECLERACKL FT SFALLQEAENCLQMDATGHLTRRHSIDNVFAQDDGASNLPRASVSESTASNHGDARRRG FT SRLTPIRVVPELAAQRWHNLPTPPASPEK" FT CDS complement(701186..701278) FT /transl_table=11 FT /locus_tag="RBRH_04281" FT /db_xref="EnsemblGenomes-Gn:RBRH_04281" FT /db_xref="EnsemblGenomes-Tr:CBW77072" FT /db_xref="UniProtKB/TrEMBL:E5AVE8" FT /protein_id="CBW77072.1" FT /translation="MYYTNKNGVRDFIGSYISPESLYKQRLFLY" FT CDS 701600..703387 FT /transl_table=11 FT /locus_tag="RBRH_03516" FT /product="Probable sensor protein hoxX (EC 2.7.3.-)" FT /function="Probable sensor protein hoxX (EC 2.7.3.-)" FT /EC_number="2.7.3.-" FT /note="Probable sensor protein hoxX (EC 2.7.3.-)" FT /note="COG: Enoyl-CoA hydratase/carnithine racemase" FT /note="Pfam: Enoyl-CoA hydratase/isomerase FT family::PF00378
Formyl transferase::PF00551" FT /db_xref="EnsemblGenomes-Gn:RBRH_03516" FT /db_xref="EnsemblGenomes-Tr:CBW77073" FT /db_xref="GOA:E5AVE9" FT /db_xref="InterPro:IPR001753" FT /db_xref="InterPro:IPR002376" FT /db_xref="InterPro:IPR005793" FT /db_xref="InterPro:IPR009188" FT /db_xref="InterPro:IPR011034" FT /db_xref="InterPro:IPR015518" FT /db_xref="UniProtKB/TrEMBL:E5AVE9" FT /protein_id="CBW77073.1" FT /translation="MLDIATLSGGRLDILLFASAYNGMVQRVHRELVTLEHRVCIELSP FT DPDTMLARAKQVDPDLIICPFLKHRIPDTVWRAWPCLVVHPGIEGDRGPSALDWAITHQ FT QSEWGVTLLQANAEMDGGDVWGTHQFAMRRASKGSIYRRDVIPGAVKLIRQALADFADP FT RFRARAQDYARPSVKGRPHVLMRQDARRIDWSTDDTDTIVNRIHAADGFPGVRDEIHGQ FT PVYLFGAVADTGIAHEATPGAWLGQRHGAVCRATRDGAVWIKQMKAGGRGPGSDIKLPS FT MLALRAAFDGAAWLEQLPELDSPAVEDIRIHVEHRVAYVEFDFHNGAMSTSQCTRLTHA FT LDALSRRHDVRVIVLMGGNDFWSNGIHLHCIEASPDPAGESWRNINAINDLVRTILLTE FT RKITIAALRNNAGAGGAIMPLACDFVLARRGVVLNPHYQTMGLYGSEYWTYLLPRRTGA FT ARAKALVDACLPVVADEALDMNLVDHVLPEDWTEYHALLLRHCQTIAQDERFSTYLNIK FT ARVRSMDERRKPLQAYRDEELQRMKAAFDDPGASYHALRHQFVHKIPCAATPPHLRGDV FT GMRQSHDTQRRREPSPVQA" FT CDS complement(703478..703663) FT /transl_table=11 FT /locus_tag="RBRH_03517" FT /db_xref="EnsemblGenomes-Gn:RBRH_03517" FT /db_xref="EnsemblGenomes-Tr:CBW77074" FT /db_xref="UniProtKB/TrEMBL:E5AVF0" FT /protein_id="CBW77074.1" FT /translation="MRATAAASTLHGSSGEIACTFSVGLDERCDADTLATLKARADAAL FT YLTQGDGSQSHGDGRL" FT CDS 703815..704168 FT /transl_table=11 FT /locus_tag="RBRH_04282" FT /db_xref="EnsemblGenomes-Gn:RBRH_04282" FT /db_xref="EnsemblGenomes-Tr:CBW77075" FT /db_xref="UniProtKB/TrEMBL:E5AVF1" FT /protein_id="CBW77075.1" FT /translation="MRNLFRPLAILLAVMMSLHGIAYAFEFTPGATPAVRTHGARVAAS FT ETAYATQATAQPQRAHDSDRCGCPHGRLCCVDAARSWAPAPGHAGCGRSNAGHDGPPRH FT ASRRRSPTSDVTA" FT CDS 704033..705433 FT /transl_table=11 FT /locus_tag="RBRH_03519" FT /product="Hypothetical protein" FT /function="Hypothetical protein" FT /note="Hypothetical protein" FT /note="COG: Predicted acyltransferases" FT /db_xref="EnsemblGenomes-Gn:RBRH_03519" FT /db_xref="EnsemblGenomes-Tr:CBW77076" FT /db_xref="GOA:E5AVF2" FT /db_xref="InterPro:IPR002656" FT /db_xref="UniProtKB/TrEMBL:E5AVF2" FT /protein_id="CBW77076.1" FT /translation="MLRRRGSIMGARARPCRVWAVQCWPRRPATPRITSSLAYVGRNCI FT TATRGGNGMKKTFDGLDLLRFLLAVYLTLYHTVYVTRYGAALPYRAWLGLGGFATSSFF FT LLSGFILAHVYLGQQPGVLRGGAKRFFINRLTNLYPVHWISLALFLTVGVAGVNPLNRF FT SLMTLDRQAGGFEYLDSMTTLAIIVATVWMLQAWQPLYEAINPPSWSLSALLFFYACFP FT WLAPRLLSLRRPGLAWAMLWLGYLTLPVVFAMQHWYAPASVGFLYTNPLVRLPEFAAGI FT LLYGLYRERSVDWLCATPARRAATLAFVALSFIGGVKALEHGGFGWQYIVHNGALLPSQ FT AALILVCAHVTMPAAAARLATRLGNAALSLFAIHLPLFLIFTKLGKLLAIGMDPLQCVQ FT QFTACVKASRDVVPSMALYPAYLIGTVIAAVVFQERIVVPLRNALRSRLSREPLQHRAA FT GPSGGQAG" FT CDS 705576..705845 FT /transl_table=11 FT /locus_tag="RBRH_03520" FT /product="Acyl carrier protein" FT /function="Acyl carrier protein" FT /note="Acyl carrier protein" FT /note="COG: Acyl carrier protein" FT /note="Pfam: Phosphopantetheine attachment site::PF00550" FT /db_xref="EnsemblGenomes-Gn:RBRH_03520" FT /db_xref="EnsemblGenomes-Tr:CBW77077" FT /db_xref="InterPro:IPR009081" FT /db_xref="UniProtKB/TrEMBL:E5AVF3" FT /protein_id="CBW77077.1" FT /translation="MIPEHPMKNELRQIIQEVAHLELSVDRLSDSDDLYEAGLSSLNTI FT QLMLAIEKHFNIEIPDRMLNRHLFQSIDSLAEAVSQLQRDVQSA" FT CDS 705842..707095 FT /transl_table=11 FT /locus_tag="RBRH_03521" FT /product="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /function="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /EC_number="1.3.99.2" FT /note="Acyl-CoA dehydrogenase, short-chain specific (EC FT 1.3.99.2)" FT /note="COG: Acyl-CoA dehydrogenases" FT /db_xref="EnsemblGenomes-Gn:RBRH_03521" FT /db_xref="EnsemblGenomes-Tr:CBW77078" FT /db_xref="GOA:E5AVF4" FT /db_xref="InterPro:IPR006091" FT /db_xref="InterPro:IPR009075" FT /db_xref="InterPro:IPR009100" FT /db_xref="InterPro:IPR013786" FT /db_xref="UniProtKB/TrEMBL:E5AVF4" FT /protein_id="CBW77078.1" FT /translation="MSAIQSANGGEPVHTIALSELDARPPDADEHALDKAATAVAQIAA FT RFADAVDREARFPSKAIDAMREHRLLGAMVPVELGGMGASLAAVASACRILGHACSSAA FT MIYAMHQIEVICVLEHAMSVPWHRGFLRQVAEHEWLLASATSEDGVGGNLRNSRCAIEP FT DGDGTFTLHKLTPTISYGAYADAILATARRSPDAPAAEQVLVTILKDDTTLTRRSGWDT FT FGMRGTCSEGFVLKSRGRQEQVFPAPFGEIAERTMVPASHILWSSLWTGIASDAFSRAH FT RYFRTQAQDKPTGASPAGSRIAEALGLLQAMQGRIDSALHVHARAGTSATRSWSETMAD FT AAQINTLKTYVSITALQVVMHAVMICGMAAYKNGTPFTLSRHIRDLYSAPLMINNDRID FT ANTASLLLAQRPASLERE" FT CDS 707095..708060 FT /transl_table=11 FT /locus_tag="RBRH_03522" FT /product="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /function="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /EC_number="6.1.1.11" FT /note="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /note="COG: Seryl-tRNA synthetase" FT /db_xref="EnsemblGenomes-Gn:RBRH_03522" FT /db_xref="EnsemblGenomes-Tr:CBW77079" FT /db_xref="GOA:E5AVF5" FT /db_xref="UniProtKB/TrEMBL:E5AVF5" FT /protein_id="CBW77079.1" FT /translation="MVDVTLQNPPAHAADIDDRHDVNALRDALVDAGLLIPMGVQGLYG FT RSEVFENVIGAIDALVTRLGADQHAEVLRFPPAMNRTDFEHSEYLKGFPQLAGTVHSFC FT GSEHEHQRVLQCLDRGEDWTEFQKPTYVVMTPAACYPAYPVIARRGALPPQGRTLDLFS FT YCFRHEPSPDATRMQLFRMREYVRLGTPNQILAFRTEWIERGKRMMALLALPHEVDLAN FT DPFFGRGGRIAASSQREQNLKFEMLVPIESDTRLTACLSFNYHMDHFGLLWGIKTSDAD FT VAHTGCVGFGMERLALGLFKHHGFDVQAWPEPVRNALWRS" FT CDS 708021..709166 FT /transl_table=11 FT /locus_tag="RBRH_03523" FT /product="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /function="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /EC_number="6.1.1.11" FT /note="Seryl-tRNA synthetase (EC 6.1.1.11)" FT /note="COG: Seryl-tRNA synthetase" FT /note="Pfam: Domain of unknown function (DUF1839)::PF08893" FT /db_xref="EnsemblGenomes-Gn:RBRH_03523" FT /db_xref="EnsemblGenomes-Tr:CBW77080" FT /db_xref="GOA:E5AVF6" FT /db_xref="InterPro:IPR014989" FT /db_xref="UniProtKB/TrEMBL:E5AVF6" FT /protein_id="CBW77080.1" FT /translation="MAGTGTQRAVEKLMSDVVSPMAVSDALTRLASPMKLPRDPANYCP FT HALHNSTMVWKQTNCYVDLWIELLSQWDFEPHAMLPFTVTQDFEGDQFTFFKVPLEDLE FT RLYGIVVQEHAIFEPLPYHIDQQVRRGNVMLVEVDAWHLPDTRGLSYHREHTKTTIGID FT AIDLQAGEIGYFHNAGYYRAAGDDYRGLFSIGSSASLVPYVECAKRRFEPLRGPALQEA FT VLSLLARRFKRRPASSPIAAFRAALAKDAAVIASRSLSYFHSYSFNTLRQLGANFELLG FT RCLRWLGAPNANGTDGTGAFSACVAACDTIASEAMVLEFRLARACARRNEDRCESTLEI FT IEHAYESLIDELGVRLGGNDVLPRLQRDSNAARPDTPSPLQ" FT CDS 709163..711745 FT /transl_table=11 FT /locus_tag="RBRH_03524" FT /product="Beta-mannosidase (EC 3.2.1.25)" FT /function="Beta-mannosidase (EC 3.2.1.25)" FT /EC_number="3.2.1.25" FT /note="Beta-mannosidase (EC 3.2.1.25)" FT /note="COG: Beta-galactosidase/beta-glucuronidase" FT /db_xref="EnsemblGenomes-Gn:RBRH_03524" FT /db_xref="EnsemblGenomes-Tr:CBW77081" FT /db_xref="GOA:E5AVF7" FT /db_xref="InterPro:IPR006102" FT /db_xref="InterPro:IPR008979" FT /db_xref="InterPro:IPR013781" FT /db_xref="InterPro:IPR013812" FT /db_xref="InterPro:IPR017853" FT /db_xref="InterPro:IPR028369" FT /db_xref="UniProtKB/TrEMBL:E5AVF7" FT /protein_id="CBW77081.1" FT /translation="MNPQPAPAGRSTAGLGPGHERAASPMWRLCTIAANAATRPRDLPP FT ADASEWIDAPVPGTVGQALAAANRLTPLDASRLGEYDHWYRLPLRRGGARLIRFDGLAG FT IAQIWLNDTLLLQSTNMFVSQQVRIDPLPEDSALYLCFRSLARYLDTMPAPRRARWRTR FT LVDAPALRAVRISLFGHMPGWFPRIEPIGPWGAVAVIDTDADTAAQIVHHTLNASIEGC FT DGIVDATITFAAPVLGHLDAILDCEGHHVHLQRHDPFTLRARLTVPNARRWWPHTHGEP FT ARYAVSLHLGGTTVALGYVGFRTIEVTRGHDGQGFALSVNALPVFVRGACWSTADPLGL FT RVSAHDYHTWLTLARDAGFNMIRVGGTMIYEDDAFYASCDELGLLVWQDFMFANFDYPC FT TAADFVTSVTLEASQFLARTAGRPSLAVLCGGSEIAQQASMVGLSDEQRDMPLTASLLA FT ELAATHRRDVPYVSDTPSGQVLPFYPRTGISHYYGVGAYLRPLDDARRAAVRFASECLA FT FAHVPADATLAAIGSPSVHEPAWKMAVPRDPGAPWDFDDVRDHYLRELYRQDPTRLRGQ FT DPSRYLELSRAVLADVVSETLVEWRRTASSCAGALLWQFQDVMPGAGWGIVDAFRRPKS FT AWYALKHVLQPQQVCLCDEGLNGLDVHVFNDSAAPLRGRLELVALRDATVPVARARCDL FT HIEPHDALQVSAAQCLGRFFDFTYAYRFGPREHDTVIASLYDHDNRLLAQSFYFPERTA FT PAVFERGDIGLSASLEQRDGQWWVNVGTRASARYVQITAPGLLPKDDWFHLAPGANVSV FT PLLPEPTLLHPLASFHSGTPHLDTHDGPGTIEIRAVNSNKIIRLRKPS" FT CDS 711742..713592 FT /transl_table=11 FT /locus_tag="RBRH_03526" FT /product="Alpha/beta hydrolase" FT /function="Alpha/beta hydrolase" FT /note="Alpha/beta hydrolase" FT /note="COG: Beta-galactosidase/beta-glucuronidase" FT /db_xref="EnsemblGenomes-Gn:RBRH_03526" FT /db_xref="EnsemblGenomes-Tr:CBW77082" FT /db_xref="GOA:E5AVF8" FT /db_xref="UniProtKB/TrEMBL:E5AVF8" FT /protein_id="CBW77082.1" FT /translation="MIPITFDDCVGWLHKGHSPRGVVLCAAVGHEGLWTHKLMRALAER FT LAREGIWALRFDYPCCGDSAGDDLDSGRFDKSIASIGRAVHALRAHAQLTDVTLVGLRA FT GAAMALLACTMDTPEAMQVDALVALSPVVRGRTYMREVTMVERQWLDTTPPVVQQAHAA FT EPCLSVLGHRYPADFVAALRAIDLCAAVGSAASLPYSVLLIDTDRGDSAVLQTALQARG FT VQATVQPFPEFATTLVEGIRSRLPLATIEASVAWIATRQMHDAPVAQPIPEPAASLRTT FT GAHLVLSDATEHTVQIGTAPLIGTLCRPATPTPGRSGMPALLFATTASNPRSADARLAV FT RLARQLAAHGIASLRVDVSGVGDSGACVLDDQSVVPYSGQAVADVIAAADWLAEQGYRD FT VVALGICSGAYASLQAASRSAAVTGIIVINLPRFIWPAGLTLADAIAQQTNSARGYLAS FT ARDPQKWKSLLRRRRDLRPIVKALVRLTAAKLRVPAMRLLERAGWYPPAHSERGLMHAL FT ARRGVNALLIYGEFDPGLDELSRHFGPAHRAFRRQRQIDVHTIAQLDHSVYGTQGADAI FT IELCIRTLMHWRAAPNSISGLHRPAPATAPRSATASMHAQ" FT CDS 714139..714486 FT /transl_table=11 FT /locus_tag="RBRH_03527" FT /db_xref="EnsemblGenomes-Gn:RBRH_03527" FT /db_xref="EnsemblGenomes-Tr:CBW77083" FT /db_xref="UniProtKB/TrEMBL:E5AVF9" FT /protein_id="CBW77083.1" FT /translation="MDTVKNAIQWWKTNYLSRRGELAYLTGFFASPSHFYRTGVVSQEP FT RMLSPHEFATLMLIKHSPDQIDLSRAELGTLLERQLVVLHDQACGGRSPQLTRVGQSIL FT DACSRVRFSAS" FT CDS complement(714523..714696) FT /transl_table=11 FT /locus_tag="RBRH_04283" FT /db_xref="EnsemblGenomes-Gn:RBRH_04283" FT /db_xref="EnsemblGenomes-Tr:CBW77084" FT /db_xref="UniProtKB/TrEMBL:E5AVG0" FT /protein_id="CBW77084.1" FT /translation="MRLSKPTDRDWRDERSNPFAHVGKTLPANPNSVLIPDFCAATNYS FT VVTIFTDMFLGR" FT CDS complement(714845..715777) FT /transl_table=11 FT /locus_tag="RBRH_03528" FT /product="Transcription regulator FNR" FT /function="Transcription regulator FNR" FT /note="Transcription regulator FNR" FT /note="COG: cAMP-binding proteins - catabolite gene FT activator and regulatory subunit of cAMP-dependent protein FT kinases" FT /note="Pfam: Bacterial regulatory proteins, crp FT family::PF00325
Cyclic nucleotide-binding FT domain::PF00027" FT /db_xref="EnsemblGenomes-Gn:RBRH_03528" FT /db_xref="EnsemblGenomes-Tr:CBW77085" FT /db_xref="GOA:E5AVG1" FT /db_xref="InterPro:IPR000595" FT /db_xref="InterPro:IPR001808" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR012318" FT /db_xref="InterPro:IPR014710" FT /db_xref="InterPro:IPR018490" FT /db_xref="UniProtKB/TrEMBL:E5AVG1" FT /protein_id="CBW77085.1" FT /translation="MGRRSPAVPGGGRMRHAVAFTVQDAIHAAGTSIICAMILSIAEHH FT AGPHADANATHRANAASCHSVHHIDERVALDSGESKQRDVSRCSSCALRNLCLPPELSS FT DDIEQFHQVVSTKRLVRRGDALHRCDDPFRHIFAIKTGSFKTVTVLRDGREQVTGFYLP FT GDALGLDGVCSDRHRWDAIALEDSLVCTVSFARLEAFCHRQPVMQRHLHRMLSGEIVRE FT SGLSVWLGTMNAAERVAAFLLNLSKRFAVRGYSPNEFQLRMTRAEMGSYLGLKLETVSR FT ILSGFSRAGLVDTQGRNIRILDAAALAAV" FT CDS complement(716335..718392) FT /transl_table=11 FT /locus_tag="RBRH_03529" FT /product="Phosphoglycerol transferase MdoB and related FT proteins, alkaline phosphatase superfamily" FT /function="Phosphoglycerol transferase MdoB and related FT proteins, alkaline phosphatase superfamily" FT /note="Phosphoglycerol transferase MdoB and related FT proteins, alkaline phosphatase superfamily" FT /note="COG: Phosphoglycerol transferase and related FT proteins, alkaline phosphatase superfamily" FT /note="Pfam: Sulfatase::PF00884" FT /db_xref="EnsemblGenomes-Gn:RBRH_03529" FT /db_xref="EnsemblGenomes-Tr:CBW77086" FT /db_xref="GOA:E5AVG2" FT /db_xref="InterPro:IPR000917" FT /db_xref="InterPro:IPR017849" FT /db_xref="InterPro:IPR017850" FT /db_xref="UniProtKB/TrEMBL:E5AVG2" FT /protein_id="CBW77086.1" FT /translation="MMRSLRFARSALLVLMTGSVSFEAFRIAYLFYYGGAAQVFDNGAE FT VLHALWIGWRFDLRVLSIAILVVLLPVFVVTKWRPLKRAAGLLQRLSIAAILLCVNLGC FT ACQFYYYDFYGSPFNPMVFGLLGADPWGMLAAARSQYPVVRCALLMAVFTALQMWIILR FT LSGSARAERNEQAQPRERMRCVLDSTVLVVLLLGLARGGLGESALDSHDAEISSRGWVN FT DSVRNAAQALYDAYVDRRSQARIDEDPACQLARYGFRSTDELARAVGAPSGAPPDLESV FT VFRRTPENRFLAAHPPHVVFALMESWGAHPLEFSTASTDLAGVMAEHLQSDYLFRNVFP FT ARLGGHAALEALLLNSPVSPLTQGDQGFVTYSTSAALPFKAKGYRTVFVYGGCGAWRSV FT ARTMRRQNFDEVYDMAAIIGRYPDAKRTIWGVYDEYLFRFAFDLLATRDALGQKIFLFV FT MSTTNRPPHTVPSHYLPPPLDLSDMRRHFAADFDKGSRMVQTYQYATHQLGMFVSRVEA FT APFGSKTIVAATGDHNMHGLFRYQRPEQSRELYRVPGFFRVPPQYRPRFVPDLERYAGH FT ADFFPTLYHLALSDARYPAFGHSLFAPAAPAEQFAVIGFKTMFSRDGAMMPLVGEPAAF FT RWQRPTYALVPDEAPSALLREQAVRARARIALADWYVRYQVIRARTGEGY" FT CDS complement(718412..719329) FT /transl_table=11 FT /locus_tag="RBRH_03530" FT /note="COG: FOG: EAL domain" FT /note="Pfam: EAL domain::PF00563" FT /db_xref="EnsemblGenomes-Gn:RBRH_03530" FT /db_xref="EnsemblGenomes-Tr:CBW77087" FT /db_xref="InterPro:IPR001633" FT /db_xref="UniProtKB/TrEMBL:E5AVG3" FT /protein_id="CBW77087.1" FT /translation="MRCNHRMSVAATGDAVLWRRLTRVTGERMIMDMQNSLRRELDIYT FT RRSKALAEAAWIDASRVIDLIVRDGLDVRYIPKIAASDLQCVGFEAQARLKGTTGRAGT FT DNFLGCLERTGIVSPVDVWLCEEVEQAIGRWAQREMYPAVSIKLHPDTIACGPALDEVI FT KALRYLNVEIELGAGVPLAKDSTLSCVGRLRDSGAKVIIDDFGAGYTNYQRLAGTHFDS FT IKLDKNLVCGSDGARGRVVLASVCALCRKLGLKVIAAGIETRDQLEIARTLNIDFFQGP FT YFGLELSWDEASEYFAMQRVRHTA" FT CDS complement(719360..720412) FT /transl_table=11 FT /locus_tag="RBRH_03531" FT /product="Transcriptional regulator, AraC family" FT /function="Transcriptional regulator, AraC family" FT /note="Transcriptional regulator, AraC family" FT /note="COG: Transcriptional regulator containing an amidase FT domain and an AraC-type DNA-binding HTH domain" FT /note="Pfam: Bacterial regulatory helix-turn-helix FT proteins, AraC family::PF00165" FT /db_xref="EnsemblGenomes-Gn:RBRH_03531" FT /db_xref="EnsemblGenomes-Tr:CBW77088" FT /db_xref="GOA:E5AVG4" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR018060" FT /db_xref="InterPro:IPR025628" FT /db_xref="UniProtKB/TrEMBL:E5AVG4" FT /protein_id="CBW77088.1" FT /translation="MLMHWLLPKIVXTGHMGYLRHTELLEEVRGEVGXAKASTDRVVVI FT FLYESFSLADVAAVADVLSVANRVLERSNEWRNRYVVRLMSTRGGVMASTSGIRVWTDG FT LDARYFGASTDTVLIAGGPGARAASEDFGLVGWLRKIGPSTRTVCAVGEGSMVLEAAGV FT PAWPEQSLRRIRSSPKPGPASGCVSDCYRSNDGFFTAMSLVSRDYSQEVVRDVAEFLMP FT RCARRVIEWMGHPTAAVSDTIRAAARRLQSGCERALSISDAARAAAMSERNFLRRFKLE FT MGITPSEFLLRCRLEKACELLVRSDLPVDKIARRTGLGSGVRLATLFRKRMFTSPTSYR FT NAARRRMDQP" FT CDS complement(720692..721051) FT /transl_table=11 FT /locus_tag="RBRH_04284" FT /product="Cell surface protein" FT /function="Cell surface protein" FT /note="Cell surface protein" FT /note="COG: Autotransporter adhesin" FT /note="Pfam: YadA-like C-terminal region::PF03895" FT /db_xref="EnsemblGenomes-Gn:RBRH_04284" FT /db_xref="EnsemblGenomes-Tr:CBW77089" FT /db_xref="InterPro:IPR005594" FT /db_xref="UniProtKB/TrEMBL:E5AVG5" FT /protein_id="CBW77089.1" FT /translation="MTPACPSGRQVANAELSTSRGGTHSTDAVNKAQLDEAVARVDGDA FT SAGIASAMAVAGLPQPTSAGRSIATASSASYXGRPGMAFGVSHVTSDDRWVIKLAASAN FT GRGYFGAVAAGGFQW" FT CDS complement(720960..722117) FT /transl_table=11 FT /locus_tag="RBRH_03532" FT /product="Cell surface protein" FT /function="Cell surface protein" FT /note="Cell surface protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_03532" FT /db_xref="EnsemblGenomes-Tr:CBW77090" FT /db_xref="UniProtKB/TrEMBL:E5AVG6" FT /protein_id="CBW77090.1" FT /translation="MHSEVRRHTFRLHPDPRSSAYKGSRMSEVMRGFGYARPTLMQQIA FT FGCRSNYFIFRVSGNLRMVGIAAGIALSQAVAAADNVYVNNNGIGPFDPAFSSVARDVA FT DYRSVAPLSPAVSPVPRRLQSSSQCSLTSAGPQSNNENRKSPATLKSPQILPHVSSELD FT QDFDRMDRKIAELIKEGQAQWAAIEMAAPERAEPDFPSSSHVRPAQLYDLGERASMMAE FT AAGLVKEALSNWEEASQQSETIRQQSAAETHMKNVYAHLFERAKARMAAASPVPTEDGS FT VVNTSSHAGLPEIGHSDSDQHSELVRYPDSDRPAPSESTSDSEPTHYALRRELLHSLVT FT ELSTAPLRLPPGISIDDARVSVGAPGSERRIVNVARWHPLHRRSQ" FT CDS 722915..723067 FT /transl_table=11 FT /locus_tag="RBRH_03534" FT /db_xref="EnsemblGenomes-Gn:RBRH_03534" FT /db_xref="EnsemblGenomes-Tr:CBW77091" FT /db_xref="UniProtKB/TrEMBL:E5AVG7" FT /protein_id="CBW77091.1" FT /translation="MRHKPKRQRYKANGWPVVIEPRAYQHETLDDQVNPTPCNLLRTPP FT DAKSA" FT CDS 723110..723694 FT /transl_table=11 FT /locus_tag="RBRH_03535" FT /note="Pfam: Bacterial type III secretion protein FT (HrpB1_HrpK)::PF09613" FT /db_xref="EnsemblGenomes-Gn:RBRH_03535" FT /db_xref="EnsemblGenomes-Tr:CBW77092" FT /db_xref="InterPro:IPR013394" FT /db_xref="UniProtKB/TrEMBL:E5AVG8" FT /protein_id="CBW77092.1" FT /translation="MAGALSLSAYHRQGRRRVIGDTSSPITHCDIAMNALSSVRRASYL FT NCSDKTVGALLRLFALGMASVPSEDLDDLLLALRVLKPSSTQVDFSEANLRVRQSDWIG FT ALRVLKSIEARHQGGAACAALIACCLYHLRDTEWRRYVELVLEDGNPIALSVVATFLKL FT DMRPGGHTSEVDSDDHEHIRVQIERAVACAR" FT CDS complement(723840..724079) FT /transl_table=11 FT /locus_tag="RBRH_03537" FT /db_xref="EnsemblGenomes-Gn:RBRH_03537" FT /db_xref="EnsemblGenomes-Tr:CBW77093" FT /db_xref="UniProtKB/TrEMBL:E5AVG9" FT /protein_id="CBW77093.1" FT /translation="MIGTRHTDAQDRHIMNGFNTSMPDRGSMAMALTGSEQXVLASKVA FT STNIRQTTFAGVTCPAPVSKNVDRRTVLRVSLVF" FT CDS 724062..724160 FT /transl_table=11 FT /locus_tag="RBRH_03538" FT /db_xref="EnsemblGenomes-Gn:RBRH_03538" FT /db_xref="EnsemblGenomes-Tr:CBW77094" FT /db_xref="UniProtKB/TrEMBL:E5AVH0" FT /protein_id="CBW77094.1" FT /translation="MTRADHRRIQTDSGVHVNELLDAGADDSWSRR" FT CDS 724145..724414 FT /transl_table=11 FT /locus_tag="RBRH_03539" FT /product="Transcriptional regulatory protein" FT /function="Transcriptional regulatory protein" FT /note="Transcriptional regulatory protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_03539" FT /db_xref="EnsemblGenomes-Tr:CBW77095" FT /db_xref="GOA:E5AVH1" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:E5AVH1" FT /protein_id="CBW77095.1" FT /translation="MVAPLKFRVLILRIRFANQGLTRQHRPQGNNILAYPPYRLDRRSW FT LVTLSERRLNLTPREFACAWLLFSRYGRYVSRTHMAGAVWCHAA" FT CDS 724984..725874 FT /transl_table=11 FT /locus_tag="RBRH_03540" FT /product="transcriptional regulatory protein" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_03540" FT /db_xref="EnsemblGenomes-Tr:CBW77096" FT /db_xref="GOA:E5AVH2" FT /db_xref="InterPro:IPR001789" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011006" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="UniProtKB/TrEMBL:E5AVH2" FT /protein_id="CBW77096.1" FT /translation="MGIAILTGNKGLFQFIEACFEADDEPCQQFVDDVALARAAYREEF FT HAILVDSAVGINPLRPFLARRACYADRRAPLIVIGALEDRASIVHVLDAGADDVVLTPI FT DPRELLLRVHLAIRRFNVTRRTDHAGVIECGPYRLDPNTCIVRINGDAVRLTPREFAIA FT WLLFSHYGEYVSRRQIAGAVWSSSEDIVGRTLEQHIYKLRKKLELHGTHGLRLRTMYAH FT GYRIESIEADTATSAMIGGPLEAPLATAHMSLDDEKVLRRHDGVNPTVECVLETRHEWQ FT CPASVAPLLEFNDAR" FT CDS complement(725851..727788) FT /transl_table=11 FT /gene="sctC" FT /locus_tag="RBRH_03541" FT /product="type III secretion outer membrane pore SctC" FT /db_xref="EnsemblGenomes-Gn:RBRH_03541" FT /db_xref="EnsemblGenomes-Tr:CBW77097" FT /db_xref="GOA:E5AVH3" FT /db_xref="InterPro:IPR003522" FT /db_xref="InterPro:IPR004846" FT /db_xref="InterPro:IPR005644" FT /db_xref="UniProtKB/TrEMBL:E5AVH3" FT /inference="protein motif:Pfam:PF00263" FT /inference="protein motif:Pfam:PF03958" FT /protein_id="CBW77097.1" FT /translation="MTTRKSMTTMNWMQTTRGVVSAGAGTMRKKLVCVACIASLALSAT FT PAFADDIPIRWHSRMVHVSVEGKDIKDVLRDFASSQGVPATISGDVHGKVTGRFDMPPQ FT RFLETLASTFGFVWFYDGTVLSISDASGVTRQVVQLQHASVDDLKAALDRLRITNPAFP FT LSYDDTRNTVLVNGPPQYVQLIAEVARRVDAAVARQAGSQVRIFSLKHAWAADHNVEVD FT GQRYVVAGVASVLSGLYHPESKSALGGSGDGPQSGFAKAYMRRVDPMADAGGNLGGTVA FT GGGTNGPTVLMPPLPDNMPTGTVSPGLAGLLGGIGSGSRTAGGGIAGLPGQGTGDYGGG FT AARYTAGFSNDLGPAADTASLPVIQADERTNSVLIRDLPERLAQYQSLIDALDVKPRLV FT EIEAHIIEVDDDALKQIGVDWRAHNSHVDLQTGNGLHSPSSYDGTLNPTFTSNSSDGTT FT VISTAPLGASLTAVLGNAGRYLLARVDALQSANLARIDASPKVATLSNAEAVMDHKTRF FT FVRVAGYTSADLYSVSTGVSLRVRPLVVEEDGRTRIKLEVHIEDGQVTNQLVDHIPVIT FT TSTINTEAFVGQNESLLIAGYRTDSSSNLETGIPLLSKIPLIGGLFRYRSDQRSHMERI FT FLLSPRIIEF" FT CDS complement(727846..729300) FT /transl_table=11 FT /gene="hrpB" FT /locus_tag="RBRH_03544" FT /product="regulatory protein HrpB" FT /note="HrpB Bacterial regulatory helix-turn-helix proteins, FT AraC family" FT /note="COG: AraC-type DNA-binding domain-containing FT proteins" FT /note="Pfam: Bacterial regulatory helix-turn-helix FT proteins, AraC family::PF00165" FT /db_xref="EnsemblGenomes-Gn:RBRH_03544" FT /db_xref="EnsemblGenomes-Tr:CBW77098" FT /db_xref="GOA:E5AVH4" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR018060" FT /db_xref="InterPro:IPR018062" FT /db_xref="UniProtKB/TrEMBL:E5AVH4" FT /inference="protein motif:Pfam:PF00165" FT /protein_id="CBW77098.1" FT /translation="MLITPYFPLAAALSSKNVPAEFMNKLIEANLTAAGGQASRWGEDE FT REDQQVAGLLQLHADMQMTLGIDDEAETSYRRAQRAVRECAHAVRAASCRNAGWQALFR FT CRLATALSCFVRLVDDAELDPLQRLEAQFGLVCALHELGQGRFLRDAIKQLIELAEEAP FT PEVAQRWQEVVLTLRLDIAVQRELRLSSQLGDHAYWLSGAVDERSLGSRDSGALIEALE FT TDAQRVQMPLLKQRIMYLRHLRLLSHGVRDAMMNIQQHLDWAARNGLSEYGRSTRIEIG FT LAALHAGAPQLAESVVESLNRVDYVSSTGRRQIDYLYCLAKIRQSQGKVNESMQYYTRY FT AVVSTQCLRDDSQALVSFSSRATPQTGQLDDISARLPAKYRRAYRYMQENLNRHDLSVR FT EIAAEVGVTERALQSAFKNFLGLSPTELIRRQRMERIRAELLSDSLESERSVLRIANKW FT GVQNRSTLVSGYRKEFQEAPSETLDR" FT CDS 729635..730357 FT /transl_table=11 FT /locus_tag="RBRH_03545" FT /product="conserved hypothetical protein" FT /note="type III secretion locus ORF3" FT /db_xref="EnsemblGenomes-Gn:RBRH_03545" FT /db_xref="EnsemblGenomes-Tr:CBW77099" FT /db_xref="InterPro:IPR021851" FT /db_xref="UniProtKB/TrEMBL:E5AVH5" FT /protein_id="CBW77099.1" FT /translation="MNPLTCLLKWARAHRVPSSGNDRQLTSRPAVHGQRATILVSGACA FT LGLAACAAPDVPPSNSTLPASLQAKPVEVLQEVFRVHGNETYVCQRNGNQLSWHATGTL FT ATLVDASRHSAGVISPGGYFIATDGSYVVTRLLAQEIISASTLPWQRLTAVHSSAEPGE FT AGRFANITSIQRVQTSGGLPPDPVCTVERTALYVPYSATYLFYRRGQPVTPGGAANDVA FT QQATEANCKLDMSACEVK" FT CDS 730857..731525 FT /transl_table=11 FT /locus_tag="RBRH_04315" FT /product="hypothetical protein" FT /note="type III secretion locus ORF4" FT /db_xref="EnsemblGenomes-Gn:RBRH_04315" FT /db_xref="EnsemblGenomes-Tr:CBW77100" FT /db_xref="UniProtKB/TrEMBL:E5AVH6" FT /protein_id="CBW77100.1" FT /translation="MPNELLRPIARLVPPEDRQNLLLTTRRFVPVIGEDVRSGMLAVKH FT VPKVKNFNQFKTALDEIQKFSRSCRQEPLLPLASQIEHLPEEDRENAFNKLFKAIGELM FT AVDQPSVLSNLASQICMLPPDKRSAAFRKIFDASDKLPARGRADVLSSLASRAVSSLPE FT SDQNTAIDDLHKAADALPARHRSKVQESLNAMQFVMMVDMQVNLMMQQLHMAFRPFGMG FT " FT CDS complement(731724..732536) FT /transl_table=11 FT /gene="sctT" FT /locus_tag="RBRH_03548" FT /product="type III secretion apparatus protein SctT" FT /note="COG: Type III secretory pathway, component EscT" FT /db_xref="EnsemblGenomes-Gn:RBRH_03548" FT /db_xref="EnsemblGenomes-Tr:CBW77101" FT /db_xref="GOA:E5AVH7" FT /db_xref="InterPro:IPR002010" FT /db_xref="InterPro:IPR006304" FT /db_xref="UniProtKB/TrEMBL:E5AVH7" FT /protein_id="CBW77101.1" FT /translation="MNGLLEIYGEYHEAIHGYLAMLTLCSERAFILFFMFPPTADGVLQ FT GVARNGVVLLFSSFIAYGQPASLFESMSGLMFVETFVREAIIGLALGFSASIVFWVAES FT AGTYIDDLTGYNNIQITNPVRSEQNTPTGTLLMQIATVAFWTLGGMPALLGVLYDSYNW FT WPLTSRTPVAENILQSFVLHQTDTLMQMTAKLATPIMFILLLVDLAFGFVAKSAQKLEV FT MQLSQPVKGALTVLILALFVGIFVEQVRGQLVLAGLGDYMRELAHGLR" FT CDS complement(732533..733054) FT /transl_table=11 FT /gene="sctO" FT /locus_tag="RBRH_03549" FT /product="type III secretion protein SctO" FT /note="type III secretion protein" FT /note="Pfam: Bacterial type III secretion protein FT (HrpB7)::PF09486" FT /db_xref="EnsemblGenomes-Gn:RBRH_03549" FT /db_xref="EnsemblGenomes-Tr:CBW77102" FT /db_xref="InterPro:IPR013392" FT /db_xref="UniProtKB/TrEMBL:E5AVH8" FT /protein_id="CBW77102.1" FT /translation="MRGSDRRITALRRAVIRRKRIEDELREMLAQQRDEQATLLHSCED FT KGTQIERERDVVRANEERIAQMMTGSSCFSIAEMQASMRYMDLVTDRIRVLQRELAALE FT QQYREKTDEISRTAQAIASNRGRIDVCERRIGVLRRKLDELASDIADEEAEEAALARAR FT NYIRSGTGRR" FT CDS complement(733065..734444) FT /transl_table=11 FT /gene="sctN" FT /locus_tag="RBRH_03550" FT /product="type III secretion cytoplasmic ATPase SctN" FT /db_xref="EnsemblGenomes-Gn:RBRH_03550" FT /db_xref="EnsemblGenomes-Tr:CBW77103" FT /db_xref="GOA:E5AVH9" FT /db_xref="InterPro:IPR000194" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR004100" FT /db_xref="InterPro:IPR005714" FT /db_xref="InterPro:IPR013380" FT /db_xref="InterPro:IPR020003" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AVH9" FT /inference="protein motif:Pfam:PF00006" FT /inference="protein motif:Pfam:PF02874" FT /protein_id="CBW77103.1" FT /translation="MNHVYNVGCTGEAEYEKALELDAHRLTDAIEKAILSTRAIARNGK FT VLEVIGTLVKVGGLDVTLGELCELRAADGSLLQHAEVIGFTRDVALLSPFSRLESISRS FT TRVIGLGRPLSVPVGEGLLGRVIDSLGQPIDGFGPIDANEERPIFADSPDPMSRRMIEY FT PLATGVRVVDSMMTLAEGQRMGIFAPAGVGKSTLLGMFARGAQCDVTVIALIGERGREV FT REFVELILGKEGMARSVVVCATSDRSSIERAKAAYVATAIAEYFRDRGQRVLLMMDSLT FT RFARAQREIGLAAGEPPARRGFPPSIFAELPRLLERAGMGATGSITALYTVLAEDESGS FT DPIAEEVRGILDGHMILSREIAARNQYPAIDVLGSLSRVMSQVMPREYVDAAARVRELL FT AKHREVEMLLQIGEYQPGGNPLADEAIAKIDAIRDFLGQRTDEWADPDDTQSRLFDLVR FT N" FT CDS complement(734441..735520) FT /transl_table=11 FT /gene="sctL" FT /locus_tag="RBRH_03551" FT /product="typeIII secretion cytoplasmic protein SctL" FT /note="similar to Ralstonia solanacearum type III secretion FT system protein HrpF" FT /db_xref="EnsemblGenomes-Gn:RBRH_03551" FT /db_xref="EnsemblGenomes-Tr:CBW77104" FT /db_xref="InterPro:IPR012842" FT /db_xref="InterPro:IPR018035" FT /db_xref="UniProtKB/TrEMBL:E5AVI0" FT /protein_id="CBW77104.1" FT /translation="MAIWLRSPYCLPETLAARVGADSDIIPAQEFGALMTIEQAYAQLE FT ADRRAAIERAEKEAAALISAARDAAQQIIDDAKREYEIAAERGYQEGEQRALSEWMERL FT ADLANGERRMQVRMRERLAQIVTVGVEQIVQVQHSDALFERALEVVDRIVEGAAYVRVV FT VSEVDHDKACVAFERLAARWREMGRPFPLTVVADRQLPAGSCICESDFGSIDASLATQL FT RAMRTAITRTLKRSLVEMEETGKGMDRVAQPDVRLPDDGDEDHLDDESHNAGDPQTRVS FT LMDDDVCADGAGDEQIWDDDLVGATNVEEDATDIGEDATDVEEDVADVDEDEGELDDDA FT DVASDEWGRFTRGESEHAP" FT CDS complement(735505..736212) FT /transl_table=11 FT /gene="sctK" FT /locus_tag="RBRH_03552" FT /product="type III secretion protein SctK" FT /note="putative type III secretion protein" FT /note="Pfam: Bacterial type III secretion protein FT (HrpB4)::PF09502" FT /note="weak match: TIGR02560: type III secretion protein FT HrpB4" FT /db_xref="EnsemblGenomes-Gn:RBRH_03552" FT /db_xref="EnsemblGenomes-Tr:CBW77105" FT /db_xref="InterPro:IPR013393" FT /db_xref="UniProtKB/TrEMBL:E5AVI1" FT /protein_id="CBW77105.1" FT /translation="MVAMSPFDRAAAALQAYDRNIRDAICWAHPSWLAGALGVDVRVAE FT TLRAELSSGPRTLLDKASFILCRASGVRMPSMASFLAPGAVMFDALPPEQGLRMLRVRA FT LLFRSAQIRHLIDKGSRMRLADWTGVPLDSIVQASFGAPDIAAFELGGTMLSLDEMDAQ FT TLALEGYFLVIRDEEGAAAMTTSRMLLRLALPRDAGPSRWLNGRVGGLDKQGTRNLITH FT LSAWLPEWKWLFG" FT CDS complement(736218..737015) FT /transl_table=11 FT /gene="sctJ" FT /locus_tag="RBRH_03553" FT /product="type III secretion cytoplasmic membrane protein FT SctJ" FT /note="COG: Type III secretory pathway, lipoprotein EscJ" FT /db_xref="EnsemblGenomes-Gn:RBRH_03553" FT /db_xref="EnsemblGenomes-Tr:CBW77106" FT /db_xref="GOA:E5AVI2" FT /db_xref="InterPro:IPR003282" FT /db_xref="InterPro:IPR006182" FT /db_xref="UniProtKB/TrEMBL:E5AVI2" FT /protein_id="CBW77106.1" FT /translation="MLTGQRTIVIRISRIVLALLVCLSLWGCHKELYNNLSEQDVNEMM FT VALLERGVDASKSTPDNGKTWSLSVEEAEIVRAMEVLRARGLPHAKYDDLGSLFKRDGL FT VSTPTEERVRFIYGLSQELSNTLSKIDGVVVARVQIVLPNNDPLALQAKPSSASVFIKY FT RPDSDVAALVPQIKTLVVHSVEGLTYEAVSVTAVPADPLDLSRMPKKQSYILPVVTAIL FT LLILLSTAWWLFRNGASDGRKLFGRIAGLLRGRSKQDGAASAP" FT CDS complement(737019..737432) FT /transl_table=11 FT /gene="sctI" FT /locus_tag="RBRH_03554" FT /product="type III secretion protein SctI" FT /note="similar to Ralstonia solanacearum type III secretion FT protein HrpJ" FT /db_xref="EnsemblGenomes-Gn:RBRH_03554" FT /db_xref="EnsemblGenomes-Tr:CBW77107" FT /db_xref="InterPro:IPR013391" FT /db_xref="UniProtKB/TrEMBL:E5AVI3" FT /protein_id="CBW77107.1" FT /translation="MFDPTWSSDMTQPLQMAGMETILGRAQDADKTMPSPEAVSRFQAL FT MQQADVAAPTTEPSGEMSALSRIVGTHDVQMEQVLNDVDALQHNMGNLSPGETAAASNL FT VMTRVANLQVETTVAMSLTTSTKGSIETLLKNQ" FT CDS complement(737432..738007) FT /transl_table=11 FT /gene="sctG" FT /locus_tag="RBRH_03555" FT /product="type III secretion protein SctG" FT /note="similar to Ralstonia solanacearum type III secretion FT protein HrpK" FT /db_xref="EnsemblGenomes-Gn:RBRH_03555" FT /db_xref="EnsemblGenomes-Tr:CBW77108" FT /db_xref="InterPro:IPR011990" FT /db_xref="InterPro:IPR013394" FT /db_xref="UniProtKB/TrEMBL:E5AVI4" FT /protein_id="CBW77108.1" FT /translation="MSISSQQYMKADKLIVGGLIEVVSLFLQVNFQAASGDTEDAEMVI FT DALRVMRPNALEFKALEGMLWISRGRWDDAVQALEEVLHERPGFLYAKALLALALFYRG FT DSAWQVLADEIDESDAGEDSRKLVRAMRARADLRMAMDAYRRTGNFVLPESCAEQMREL FT EQQGTAPEKSELTDAGTAFVPQANFLRL" FT CDS 738291..739373 FT /transl_table=11 FT /gene="sctU" FT /locus_tag="RBRH_03556" FT /product="type III secretion inner membrane protein SctU" FT /db_xref="EnsemblGenomes-Gn:RBRH_03556" FT /db_xref="EnsemblGenomes-Tr:CBW77109" FT /db_xref="GOA:E5AVI5" FT /db_xref="InterPro:IPR006135" FT /db_xref="InterPro:IPR006307" FT /db_xref="UniProtKB/TrEMBL:E5AVI5" FT /inference="protein motif:Pfam:PF01312" FT /protein_id="CBW77109.1" FT /translation="MSDEKTEEPTEKRLRDARRDGQVAKSTDLTDAAVMCASIAVLVAA FT ASMFTDAFRALIHTTLDFVTTNRSNTMLVASAFKLGRQSLTIIVPCVAATALCAFAALF FT AQVGFQISTKPVTPNPTAVNPASGIKRIFSLRTVVDMTKSLLKAALVACVMWYTIRGLI FT PLIATSLYQPLPELSRLFWTVLLKLFSAAALVFIVIAALDFKLQKFLFTRQMRMSKDEI FT KREYKQQEGDPQLKGERKRIAREWAQEAPPRLRVGLANALIVNPTHYAVAIRYAPEECP FT LPVVIAKGHDESAAELRRYAAQARVPIIGNPPIARALHRVKIDEPIPEALFEAVAAILR FT WVDSLGPRQTDSGNAATSTH" FT CDS 739393..741477 FT /transl_table=11 FT /gene="sctV" FT /locus_tag="RBRH_03557" FT /product="type III secretion inner membrane protein SctV" FT /note="COG: Type III secretory pathway, component EscV" FT /db_xref="EnsemblGenomes-Gn:RBRH_03557" FT /db_xref="EnsemblGenomes-Tr:CBW77110" FT /db_xref="GOA:E5AVI6" FT /db_xref="InterPro:IPR001712" FT /db_xref="InterPro:IPR006302" FT /db_xref="InterPro:IPR025505" FT /db_xref="UniProtKB/TrEMBL:E5AVI6" FT /protein_id="CBW77110.1" FT /translation="MSKALKLPAAGEIGVALVVVAIISLMILPLPTLLIDVLLACNIAV FT SVTLLMITMYVPDIVALSVFPSLLLFTTLYRLSLNIASTKSILLHADAGHIIEAFGQLV FT VGGNLVVGLVVFVIITTVQFIVIAKGSERVAEVGARFTLDALPGKQMSIDADLRANLLT FT ADEARRKRATLAIESQLHGGMDGAMKFVKGDAIAGLIITGINIIAGIAVGVAYHGMSAG FT EAANRFSVLSVGDAMVSQIPSLLLSVAAGVMITRVADERDAHPQSLGSEMGRQLSSSTR FT ALFFAAILLLGFAAVPGFPAPLFLLLSAMLAFCGYKLSHKRPLLDEYRSEPVASMQRAG FT SKGDASGILPRAPQFTPAVGVRIAPDLMPRLSAAALDQSFASERNQLQEELGLPFPGIT FT MWVGENTRASHFEILIHDVPYVTIELPPGKVMLPPRNGDLDATQADAVLAALHARAEPR FT GGLDGGAGPTWWMDEKAVPPKIQAWQAEHVIAHSAIALLRRHASLFLGIQEVQWILEQQ FT GNEYPGLVAEVQKAVPPQRIADVLRRLLEEQVPIRNMRTILESLLAWGTKEKDMLMLTE FT YVRGDLARFLAHRAAAGAGLLQAVLLDLPVEQHIRQAIKQTPTGNYLALAPDEVTFLVN FT KIQSLAGTDERDGVALVTSMDIRRYVRRMIENRISWLPVYSYQELGEHVELKPLGRVTA FT " FT CDS 741489..742115 FT /transl_table=11 FT /gene="hpaP" FT /locus_tag="RBRH_03558" FT /product="type III secretion associated protein HpaP" FT /note="similar to Ralstonia solanacearum type III secretion FT protein HpaP" FT /db_xref="EnsemblGenomes-Gn:RBRH_03558" FT /db_xref="EnsemblGenomes-Tr:CBW77111" FT /db_xref="InterPro:IPR013390" FT /db_xref="UniProtKB/TrEMBL:E5AVI8" FT /protein_id="CBW77111.1" FT /translation="MTSIRHRPVRIIARDSEHTAPVYGRRARPDYASLARRSRPTGTHE FT DTLPALHHGIASTGLALTYPSGQDADTSDDDSQSSEDGTADASSMVDKRLRKALQPVVA FT KILQTQDKVMDLVCKLTQEIAAFCGDRSINETGTWDAQLPLDASLLRNTTLNLTLSYST FT LSLRFDTDDDDTKQLLLAHAPMLERELGALMQAWDVPRQIQLTVW" FT CDS 742178..743380 FT /transl_table=11 FT /gene="sctQ" FT /locus_tag="RBRH_03560" FT /product="type III secretion apparatus protein SctQ" FT /note="TIGR02551: type III secretion apparatus FT protein,YscQ/HrcQ family" FT /db_xref="EnsemblGenomes-Gn:RBRH_03560" FT /db_xref="EnsemblGenomes-Tr:CBW77112" FT /db_xref="GOA:E5AVI7" FT /db_xref="InterPro:IPR001543" FT /db_xref="InterPro:IPR013385" FT /db_xref="UniProtKB/TrEMBL:E5AVI7" FT /protein_id="CBW77112.1" FT /translation="MIDPTVDLLPSDVGDARWRPRPLQPAVARAARLFCDNRLPDTLAR FT LCGIEQWTVTLESSSAPAMDLVGAARWTEPAWLEFAHPSGRLGIGFDLAHYPALELVTG FT TEDVSNSDRPHGDPALQLAIAHILVQPVLSALAAIGLKELRLAGLYRVHQHSGLPIRPS FT VDMPIARMTFVHHGRTHAVTVVPDAPLLQLIQHCLDQHATSAAQRPSPDSGHPLAEVRV FT PGRLIIGYKTLTVSTLDRLAPGDVILRAVSANAGPLIAGHHAPVHTTVAWGTPGLIRLH FT AQAEIGGQTLSILKDPYMTEHVDKSLANDTLTAEARDEAACIDQLELPIQLEIDTIALP FT LHEICALRAGYVLELPNPVDAVQIKLVTHGRTIGYAELVSVGDHLGIRILQMVQGNAPA FT Q" FT CDS 743322..744014 FT /transl_table=11 FT /gene="sctR" FT /locus_tag="RBRH_03561" FT /product="type III secretion inner membrane protein SctR" FT /note="COG: Type III secretory pathway, component EscR" FT /db_xref="EnsemblGenomes-Gn:RBRH_03561" FT /db_xref="EnsemblGenomes-Tr:CBW77113" FT /db_xref="GOA:E5AVI9" FT /db_xref="InterPro:IPR005773" FT /db_xref="InterPro:IPR005838" FT /db_xref="UniProtKB/TrEMBL:E5AVI9" FT /protein_id="CBW77113.1" FT /translation="MIISASESSKWCKAMLQPSELTSLMLIVLAISVVPLVAVVITSYT FT KIVVVLSLLRNALGAQQVPPNMVLNGIAILVSLYIMAPIGMAAAKQLENQPNAGTPSQS FT VVQAFSAAQEPFRAFLKQHANKREKRFFMRTATVIWPKEVADGLREDDFIVLAPAFTLS FT ELTDAFKIGFLLYITFVVIDLIIANVLLAMGLNQVMPTNVAIPFKLLLFVVMDGWSTLI FT HGLILTYR" FT CDS 744023..744286 FT /transl_table=11 FT /gene="sctS" FT /locus_tag="RBRH_03562" FT /product="type III secretion inner membrane protein SctS" FT /note="Type III secretion inner membrane protein SctS" FT /note="COG: Type III secretory pathway, component EscS" FT /note="Pfam: Bacterial export proteins, family 3::PF01313" FT /db_xref="EnsemblGenomes-Gn:RBRH_03562" FT /db_xref="EnsemblGenomes-Tr:CBW77114" FT /db_xref="GOA:E5AVJ0" FT /db_xref="InterPro:IPR002191" FT /db_xref="InterPro:IPR006306" FT /db_xref="UniProtKB/TrEMBL:E5AVJ0" FT /protein_id="CBW77114.1" FT /translation="MDINTLIRLTMHGMLLCMYVSLPIVSVAAAVGLAVSFLQAITSMQ FT DQALSHGVKLIAVTIVIVVGAPMSAAAVLRFANEVFQVAIPQ" FT CDS 744283..745182 FT /transl_table=11 FT /locus_tag="RBRH_03563" FT /product="hypothetical protein" FT /note="putative type III secretion protein" FT /note="type III secretion locus ORF19" FT /db_xref="EnsemblGenomes-Gn:RBRH_03563" FT /db_xref="EnsemblGenomes-Tr:CBW77115" FT /db_xref="UniProtKB/TrEMBL:E5AVJ1" FT /protein_id="CBW77115.1" FT /translation="MINIRKSAPTDHAGGPTGSPARQHVRTPVRRPRKAVLHRGSIVFA FT HSATAQANVQQVRKAAARARLLASIRASARLTRRRVRSRTSLLENEADESDDRAADTPA FT RITGIGQRDGSGGGGGQGRGQRDQKEGDVDAQSEVPCFRQSRTTRRAGISRLDAGPLHE FT LAQSGKTIASNDVMHVLIAKLRDLVDQSQRNPHASIDANIHHLMSKCLDLQARLAPEPL FT SLQHVIEMLVSIRQKPALASPQSHAGELNRGQRLNPMMPLIAFNALRPRTPSQLKRAKC FT YQALRIASTTTRHVDTLA" FT CDS 745336..746535 FT /transl_table=11 FT /gene="sctD" FT /locus_tag="RBRH_03564" FT /product="type III secretion protein SctD" FT /note="putative TypIII secretion protein" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /note="similar to Ralstonia solanacearum hrpW protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_03564" FT /db_xref="EnsemblGenomes-Tr:CBW77116" FT /db_xref="UniProtKB/TrEMBL:E5AVJ2" FT /protein_id="CBW77116.1" FT /translation="MKLLRILTGIHAGAQLKLVPGAYRLAADDDADIRLSDWTGAELVL FT TIDPQDTVHARRGAAPANGDNVNAHHAVTHDEPIEQHAKRPAQMLDQRTITPSSEVTQQ FT GKEPILLLDFVPMQFDDTVICVGPADSSWPSDVELLSTLLVKPDQDRREAKRARHRKIA FT GITLACTAVGMVIGLSALLMSAQDSRAARRRDINDLAQHINHLLAEQKLTELRAQVSGS FT VIRVTGMVQTPAEDVNTRELLQRAAAGLALRQYDVAEVDARSIAESLGIPGVQITYAGN FT GVFDVTAKVADPQQFRESLERVRHDLNGNVRTLRTHITTIDKNLLPSTYSEMIASDAIQ FT YAQAPDGTKHIYVAQQPNDQAEPPESGSIPPDNAPVPSGQDATGTAIQGTTSQSPQVSK FT " FT CDS 746551..746784 FT /transl_table=11 FT /gene="sctE" FT /locus_tag="RBRH_03015" FT /product="type III secretion protein SctE" FT /db_xref="EnsemblGenomes-Gn:RBRH_03015" FT /db_xref="EnsemblGenomes-Tr:CBW77117" FT /db_xref="UniProtKB/TrEMBL:E5AVJ3" FT /protein_id="CBW77117.1" FT /translation="MYEALEACAADFNDLPKIITDASKVKTIRSALDATARRIAEDTGE FT TEVDRDSLAKLYRGLLAASRIVAQLHEKRSTG" FT CDS 746831..747061 FT /transl_table=11 FT /gene="sctF" FT /locus_tag="RBRH_04285" FT /product="putative type III secretion pilus protein SctF" FT /note="putative function deduced from genomic context" FT /db_xref="EnsemblGenomes-Gn:RBRH_04285" FT /db_xref="EnsemblGenomes-Tr:CBW77118" FT /db_xref="UniProtKB/TrEMBL:E5AVJ4" FT /protein_id="CBW77118.1" FT /translation="MSVLNGVKHGSDAANTASALGHFGTSAAGGKLTSTAANAEMDQYS FT NMILETQLHAMKCQFIENLGEACKEVGSKQI" FT CDS 747135..747590 FT /transl_table=11 FT /gene="hpaB" FT /locus_tag="RBRH_03014" FT /product="type III secretion protein HpaB" FT /note="COG: Response regulators consisting of a CheY-like FT receiver domain and a winged-helix DNA-binding domain" FT /db_xref="EnsemblGenomes-Gn:RBRH_03014" FT /db_xref="EnsemblGenomes-Tr:CBW77119" FT /db_xref="GOA:E5AVJ5" FT /db_xref="InterPro:IPR010261" FT /db_xref="UniProtKB/TrEMBL:E5AVJ5" FT /inference="protein motif:Pfam:05932" FT /protein_id="CBW77119.1" FT /translation="MNGERYGELVRELCDVVGLADPEYVLETRTIEVQGYDVRLEYFEN FT DLDAIYLNFHFGTVTAGRTLNVFRLMLEANLLIYAQDQAQMGLDTDTGGIILIIRIPMD FT PDLDGEALADLLSHYAEHGHYWRRNIIESTDEMFEGIVAGDFTWLRA" FT CDS 747726..749420 FT /transl_table=11 FT /locus_tag="RBRH_03013" FT /product="Transcriptional regulator, LuxR family" FT /function="Transcriptional regulator, LuxR family" FT /note="Transcriptional regulator, LuxR family" FT /note="COG: Predicted ATPase" FT /note="Pfam: Transcriptional regulatory protein, C FT terminal::PF00486" FT /db_xref="EnsemblGenomes-Gn:RBRH_03013" FT /db_xref="EnsemblGenomes-Tr:CBW77120" FT /db_xref="GOA:E5AVJ6" FT /db_xref="InterPro:IPR000767" FT /db_xref="InterPro:IPR001867" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR016032" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AVJ6" FT /protein_id="CBW77120.1" FT /translation="MDHRHTYRERPASMSIQPAMMAIAFGRYQLILDPAQLNVDGKPAA FT IGSRSLTILRILLEANGRTVSTDELREKVWHNADVSVNSIQSKVAALRRALGGDEHLVA FT TVRGQGYRFTGEQRLVTLALEAPSGDGAVTAMGSASTAQAPPHHRVESAQANTFSEEVT FT GAPQTRATLMLPRGTTPFIGRHAEVSELLAVVPTARIVTLTGPAGIGKTRVALELVRRL FT GALYPHGVALVHCAPQQHVDAFARACIQAWHIEAYRGDAPGQYLHKWLKPRRMMLLIHD FT VDGLPIETTRYINRLIDEAPGVCVIATAKDAPGIYAEHVVRVSPLQTPSPSCGTSSLIP FT QCDALQLLFARLHILTSPRGAMQQRRPPTTAGSTWYADASPEAIAMAARVAALAEGMPL FT ALELAAFALAQRIRAGEPLETALATLADTMRLAASDISTSHASMAAPGAAAFLPLIGQC FT MAQLSPLEHVILRSLATFEHAVTHDAMLYRLKGAPQLASMPNGAVLDASLSKLIDSRLI FT RDIGIAGQAMLKVNEWLAANADAPFWCLNENTPGNPWHTSFDATSER" FT CDS 749486..752860 FT /transl_table=11 FT /locus_tag="RBRH_03012" FT /db_xref="EnsemblGenomes-Gn:RBRH_03012" FT /db_xref="EnsemblGenomes-Tr:CBW77121" FT /db_xref="UniProtKB/TrEMBL:E5AVJ7" FT /protein_id="CBW77121.1" FT /translation="MPADVIVSPSRGVMCTASPAVEHAGPKSNSEKALGSAARKPAATS FT RHTAPLDELRSKLGVHLRGKQPPASIGSTMPGRAVGSTMPARAIGVTPADRDTPGYSID FT TVGVLGVDEPRHWTRAQLLNHLVEANYPGPTLATAELAYQLHTSLDDGTGEVNAARVQL FT VLFAMHEAGLRDNTRAMMDSTMATMVLQQLRLLNFDQPFHDAPTPTGDARLPDQQLQAW FT RASWETARVLARTEEGFETLLKLRAEKCAPLSRSVDRDMLHVLLDSADRIDNHVRLTQP FT HDSHATPVHAAPDFDDPSPSGTDKRQQWLQGHLAMKGQDAKSTLLASQVFAIAKKFFDQ FT TEPPHSASGPTPEGRFASFIETLTPNEKEALFDWQQRFHESGRGTDKAKASGRLNNVRK FT VVTSIIGKLVPGEVAAFFNRRPGLHETDKAKASHRLNKFVSEVATRDREHYGSHLIQRI FT FGTMKAPMVAATRIKSGAGKATEESSAADAQASAPDYASAASTAGAAEPTRAASTAIQS FT ITTAVADASDRGWDALKRIVPSLRPGMAVEFSDGGALTVTTERVSASVTAAVSQATQAS FT PVPLPVVVPSINAKRSRKRKATVQMGCTEQHAWLFIGTAHATGRGAGAGVLVGASFPGS FT LVGGTVGVQFYDSEHARPRGILVQVARQPKADGSGYDDEAMEARMGHIIDTMMSLSPAG FT ATAESRGTREQCWNALAQSLVGARDVSVGWIDGTVDEKRHGSSTGPVASAGVPIGLPHP FT FGMSTSVSVPVSGKHVHNISTSRSDSGRMSTEKRHAERSIEVKVEVRVGASVSATLSSN FT PKSGISTGPSSKRLWDKQLYQAKVSLSRTLQSYQGKIEPRACFLDVDFLDATAYEYATR FT QLLDHNGDRDDAGIKAVRTYLEQKRAQSAKPLADQAASAVKNVLELGNGTRQTDSHIHR FT YALTDPAAEQINLLQAHFEQHYLRPWEAGLRERVSAKDLERMRQVLEAKREQILADPAS FT WRLASLVTRERSEAHESVPDLSPWVRGAATALLLVDANAGATRIDENEVVHHRFETDVN FT VKPLVDVSMSSGITFERLRRDGYHAFMGKPVAATKATKATKATKLPKLPKLPKLPKLPK FT LPKLPKGQGSKKASSQI" FT CDS complement(752925..753479) FT /transl_table=11 FT /locus_tag="RBRH_03011" FT /product="Transcriptional repressor PadR" FT /function="Transcriptional repressor PadR" FT /note="Transcriptional repressor PadR" FT /note="COG: Predicted transcriptional regulators" FT /db_xref="EnsemblGenomes-Gn:RBRH_03011" FT /db_xref="EnsemblGenomes-Tr:CBW77122" FT /db_xref="InterPro:IPR005149" FT /db_xref="InterPro:IPR011991" FT /db_xref="InterPro:IPR018309" FT /db_xref="UniProtKB/TrEMBL:E5AVJ8" FT /protein_id="CBW77122.1" FT /translation="MRLMSIQHALLTSLLEKPTSGYDLARRFDRSIGYFWHATHQQIYR FT ELARMATVGWVAAVDDPNDPARRKKCYQVLPTGRAELVRWILEPLDDGDRNCRQAFLVK FT LRAAAVVGPDGLGEELARLLEQWQARLDTYRNIEQRDFAAPVLSTKQRLQHAVLRYGIR FT AEETWIEWAHDVVALLRELGH" FT CDS 753456..753563 FT /transl_table=11 FT /locus_tag="RBRH_03010" FT /db_xref="EnsemblGenomes-Gn:RBRH_03010" FT /db_xref="EnsemblGenomes-Tr:CBW77123" FT /db_xref="UniProtKB/TrEMBL:E5AVJ9" FT /protein_id="CBW77123.1" FT /translation="MLDGHEPHFIRLATLATPHLMILTLRWLSLVRHLA" FT CDS 753570..753725 FT /transl_table=11 FT /locus_tag="RBRH_03009" FT /db_xref="EnsemblGenomes-Gn:RBRH_03009" FT /db_xref="EnsemblGenomes-Tr:CBW77124" FT /db_xref="UniProtKB/TrEMBL:E5AVK0" FT /protein_id="CBW77124.1" FT /translation="MTSHRLSRQNDNRRRCAACIVAPLRLHVPRHDNERRITAGMAHRQ FT IELLRQ" FT CDS complement(753772..754299) FT /transl_table=11 FT /locus_tag="RBRH_03008" FT /db_xref="EnsemblGenomes-Gn:RBRH_03008" FT /db_xref="EnsemblGenomes-Tr:CBW77125" FT /db_xref="UniProtKB/TrEMBL:E5AVK1" FT /protein_id="CBW77125.1" FT /translation="MVRRSGYPALASRPWPDPQQRGAAASRIVQQTAPSSSHRCGSRPR FT SMASINRQPASSSAPELSTEISVAWSGSAKTGRRSSRVANCAAVSRCAAVSRPRRVSCA FT ANLCEEFVACPCRCVHRACPVAANGIPSQQFKKARRGRARWANIACSSGTSLSSTVCDV FT QNDWMALRWLVY" FT CDS 754357..754830 FT /transl_table=11 FT /locus_tag="RBRH_03007" FT /product="RNA-binding protein, Hfq family" FT /function="RNA-binding protein, Hfq family" FT /note="RNA-binding protein, Hfq family" FT /db_xref="EnsemblGenomes-Gn:RBRH_03007" FT /db_xref="EnsemblGenomes-Tr:CBW77126" FT /db_xref="GOA:E5AVK2" FT /db_xref="InterPro:IPR001163" FT /db_xref="InterPro:IPR005001" FT /db_xref="InterPro:IPR010920" FT /db_xref="UniProtKB/TrEMBL:E5AVK2" FT /protein_id="CBW77126.1" FT /translation="MVPLRRVPYPSTSSGHAFGIDHYARSAQRMASESGRSQNDILNSA FT RKERKRVQIYLVNGIRVVGHVESFDQYVVMLRTPGGMQVIYKKAISTVQHDTPDSRAAR FT SSTSGRGAGPARGGPTSRMSVRPRAGAPTDTASRPVVVTRKRRVTIPNNNTGE" FT CDS complement(754990..756024) FT /transl_table=11 FT /locus_tag="RBRH_03006" FT /product="Aminocarboxymuconate-semialdehyde decarboxylase FT (EC 4.1.1.45)" FT /function="Aminocarboxymuconate-semialdehyde decarboxylase FT (EC 4.1.1.45)" FT /EC_number="4.1.1.45" FT /note="Aminocarboxymuconate-semialdehyde decarboxylase (EC FT 4.1.1.45)" FT /note="COG: Predicted metal-dependent hydrolase of the FT TIM-barrel fold" FT /note="Pfam: Amidohydrolase::PF04909" FT /db_xref="EnsemblGenomes-Gn:RBRH_03006" FT /db_xref="EnsemblGenomes-Tr:CBW77127" FT /db_xref="GOA:E5AVK3" FT /db_xref="InterPro:IPR006992" FT /db_xref="UniProtKB/TrEMBL:E5AVK3" FT /protein_id="CBW77127.1" FT /translation="MPHRLVMKLRIDMHSHFFPRITREEAARLDAAHAPWLNIDADGQH FT GMIMTGDQSFRPVYRALWDPRTRIAEMDERGIDIQMMCATPVMFGYRYDATAADEWARR FT MNDLALEMCAYAPDRLMALAQVPLQDVELACREATRAFHCGHRGVQIGNHLGSRDLDDE FT QLVTFLTHCANDGIPVLVHPWDMMTDGRMKKWMLPWLVAMPAETQLSMVSLILSGAFER FT IPASLKLCFAHGGGSFAFLLGRVQNAWENRDIVRENCPHPPLSYLNRFHVDSAVFDPRA FT LKMLVDTMGEDRVLLGSDYPFPLGEQLIGELVATHPELSDDAKSKILGQNALRFFGLSE FT PATV" FT CDS complement(756044..756640) FT /transl_table=11 FT /locus_tag="RBRH_03005" FT /product="3-hydroxyanthranilate 3,4-dioxygenase (EC FT 1.13.11.6)" FT /function="3-hydroxyanthranilate 3,4-dioxygenase (EC FT 1.13.11.6)" FT /EC_number="1.13.11.6" FT /note="3-hydroxyanthranilate 3,4-dioxygenase (EC FT 1.13.11.6)" FT /note="COG: Ribulose-5-phosphate 4-epimerase and related FT epimerases and aldolases" FT /note="Pfam: 3-hydroxyanthranilic acid FT dioxygenase::PF06052" FT /db_xref="EnsemblGenomes-Gn:RBRH_03005" FT /db_xref="EnsemblGenomes-Tr:CBW77128" FT /db_xref="GOA:E5AVK4" FT /db_xref="InterPro:IPR010329" FT /db_xref="InterPro:IPR011051" FT /db_xref="InterPro:IPR014710" FT /db_xref="UniProtKB/TrEMBL:E5AVK4" FT /protein_id="CBW77128.1" FT /translation="MRGVRHVGCAGVRRRYCASIEETNMLGYGKPFNFQRWIDEHMHLL FT QPPVGNQQVWQDSDLIVTVVGGPNHRTDYHDDPLEEFFYQLRGNAYLYLWIDGRKERVE FT LKEGDIFLLPPHVRHSPQRPEAGSACLVIERQRPPGLLDGFEWYCDACHHRVHRVEVQL FT KSIVTDLPPLFDAFYGSEDKRRCPQCGQLHAGKAA" FT CDS complement(756662..757135) FT /transl_table=11 FT /locus_tag="RBRH_03004" FT /product="2-aminomuconate deaminase (EC 3.5.99.5)" FT /function="2-aminomuconate deaminase (EC 3.5.99.5)" FT /EC_number="3.5.99.5" FT /note="2-aminomuconate deaminase (EC 3.5.99.5)" FT /note="COG: Putative translation initiation inhibitor, yjgF FT family" FT /note="Pfam: Endoribonuclease L-PSP::PF01042" FT /db_xref="EnsemblGenomes-Gn:RBRH_03004" FT /db_xref="EnsemblGenomes-Tr:CBW77129" FT /db_xref="GOA:E5AVK5" FT /db_xref="InterPro:IPR006175" FT /db_xref="InterPro:IPR013813" FT /db_xref="UniProtKB/TrEMBL:E5AVK5" FT /protein_id="CBW77129.1" FT /translation="MREDRINARNTENLMTESTSQGRVVPGKATPRGRFPHLQRAGDFL FT FVSGTSARRPDNTIVGASVDALGTVNLDIRAQTRAVIENIRDILCAEGANLSNLVDISA FT FLVNMNDFGGYNEVYGEFFDETGPTRTTVAVHQLPHPHLLIEIKAVAYAPRQR" FT CDS complement(757117..758607) FT /transl_table=11 FT /locus_tag="RBRH_03003" FT /product="2-aminomuconate 6-semialdehyde dehydrogenase (EC FT 1.2.1.32)" FT /function="2-aminomuconate 6-semialdehyde dehydrogenase (EC FT 1.2.1.32)" FT /EC_number="1.2.1.32" FT /note="2-aminomuconate 6-semialdehyde dehydrogenase (EC FT 1.2.1.32)" FT /note="COG: NAD-dependent aldehyde dehydrogenases" FT /note="Pfam: Aldehyde dehydrogenase family::PF00171" FT /db_xref="EnsemblGenomes-Gn:RBRH_03003" FT /db_xref="EnsemblGenomes-Tr:CBW77130" FT /db_xref="GOA:E5AVK6" FT /db_xref="InterPro:IPR015590" FT /db_xref="InterPro:IPR016160" FT /db_xref="InterPro:IPR016161" FT /db_xref="InterPro:IPR016162" FT /db_xref="InterPro:IPR016163" FT /db_xref="InterPro:IPR017628" FT /db_xref="UniProtKB/TrEMBL:E5AVK6" FT /protein_id="CBW77130.1" FT /translation="MNIESDTASSYPRLLRHYIDGEFVAGDVTFQDLSPVDGSQVALVC FT EADAQAVDRAVRAARAAQLAGWRDTTPAQRADWLYRIAQGIEAHFDAFVATEVADTGRP FT VAQARTLDVARGIANFRIFADLVRTANSEFFETHTSDGGELINYVTRKPLGVVGIISPW FT NLPLLLLTWKVAPALAMGNCVVAKPSEETPGSATLLAEVIHEVGLPRGVFNLIHGHGPN FT AAGEFLTRHSDISAITFTGESRTGSTIMKTVADGVKDISFELGGKNAAVVFADADFDAA FT VDGVAKSSFTNAGQVCLCSERVYVERPIFERFVAALKQKAQALRVGAPEDPATTMGPLI FT SQHHRDKVLSYFRLAVEEGANVVTGGDVPHFGDARDRGAFVNPTIWTGLPDTARCVTEE FT IFGPVCHVAPFDSEDEVISRVNHSAYGLAASIWTTHLTRGHRVARQIETGIVWVNAWFV FT RDLRTPFGGAKLSGIGREGGRHSLDFYSELTNICVKIG" FT CDS 759067..759213 FT /transl_table=11 FT /locus_tag="RBRH_03002" FT /db_xref="EnsemblGenomes-Gn:RBRH_03002" FT /db_xref="EnsemblGenomes-Tr:CBW77131" FT /db_xref="UniProtKB/TrEMBL:E5AVK7" FT /protein_id="CBW77131.1" FT /translation="MRKDEIVRYALQSPSALRKPPLKTGYTLLRPHAHARAPHQAYCVT FT TPS" FT CDS complement(759406..760041) FT /transl_table=11 FT /locus_tag="RBRH_03001" FT /db_xref="EnsemblGenomes-Gn:RBRH_03001" FT /db_xref="EnsemblGenomes-Tr:CBW77132" FT /db_xref="UniProtKB/TrEMBL:E5AVK8" FT /protein_id="CBW77132.1" FT /translation="MDSVVDAAGRVNRCLAGCGKVRVSRLWPAFGESMPIRTMLQHRDA FT RVHVSLMVLYIAISGFGVPRAHAGWCDHGVWVDAMLGSYHIDPDPSKHFEPFNPGIGVE FT CYFSPQWGATAGYFRNSIRRPSFYGGAIWAPECVHWGWFRVAAMGGVISGYNYGRWGMG FT HNRTVGPVLAPVLMTNYKRVGTNFILIPPIPSEKLPFTVGFQVKIRVD" FT CDS complement(760008..761057) FT /transl_table=11 FT /locus_tag="RBRH_03000" FT /product="Threonine 3-dehydrogenase (EC 1.1.1.103)" FT /function="Threonine 3-dehydrogenase (EC 1.1.1.103)" FT /EC_number="1.1.1.103" FT /note="Threonine 3-dehydrogenase (EC 1.1.1.103)" FT /note="COG: Threonine dehydrogenase and related FT Zn-dependent dehydrogenases" FT /note="Pfam: Alcohol dehydrogenase GroES-like FT domain::PF08240
Zinc-binding dehydrogenase::PF00107" FT /db_xref="EnsemblGenomes-Gn:RBRH_03000" FT /db_xref="EnsemblGenomes-Tr:CBW77133" FT /db_xref="GOA:E5AVK9" FT /db_xref="InterPro:IPR002085" FT /db_xref="InterPro:IPR002328" FT /db_xref="InterPro:IPR004627" FT /db_xref="InterPro:IPR011032" FT /db_xref="InterPro:IPR013149" FT /db_xref="InterPro:IPR013154" FT /db_xref="InterPro:IPR016040" FT /db_xref="UniProtKB/TrEMBL:E5AVK9" FT /protein_id="CBW77133.1" FT /translation="MRALAKLEAGPGLTLTRVKKPEIGHNDVLIRIGKTAICGTDLHIW FT KWDEWASKTIPVPMHVGHEYVGEIVAIGQEVRGFKVGDRVSGEGHITCGFCRNCRAGRR FT HLCRNTIGVGVNRAGAFADYLAIPAFNAFKIPDDIDDELAAIFDPFGNAVHTALTFNLV FT GEDVLITGAGPIGAMAAAIARHVGARNIVITDVNEYRLELAMKMGASRAVNVSHESLTQ FT VMRELGMTEGFDVGLEMSGAPSALVSMLEHMNHGGKIALLGIPPARTAIDWNHVIFKGL FT EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFPVEEYRSGFDAMLSGHSGKVILDW FT TASSMLRGV" FT CDS complement(761067..762671) FT /transl_table=11 FT /locus_tag="RBRH_02999" FT /product="2-amino-3-ketobutyrate coenzyme A ligase (EC FT 2.3.1.29)" FT /function="2-amino-3-ketobutyrate coenzyme A ligase (EC FT 2.3.1.29)" FT /EC_number="2.3.1.29" FT /note="2-amino-3-ketobutyrate coenzyme A ligase (EC FT 2.3.1.29)" FT /note="COG: 7-keto-8-aminopelargonate synthetase and FT related enzymes" FT /note="Pfam: Aminotransferase class I and II::PF00155" FT /db_xref="EnsemblGenomes-Gn:RBRH_02999" FT /db_xref="EnsemblGenomes-Tr:CBW77134" FT /db_xref="GOA:E5AVL0" FT /db_xref="InterPro:IPR001917" FT /db_xref="InterPro:IPR004839" FT /db_xref="InterPro:IPR011282" FT /db_xref="InterPro:IPR015421" FT /db_xref="InterPro:IPR015422" FT /db_xref="InterPro:IPR015424" FT /db_xref="UniProtKB/TrEMBL:E5AVL0" FT /protein_id="CBW77134.1" FT /translation="MSWAGGLYRVHIMACRCKQANQVDAECIGQVPGQRDREIGFIAFV FT AQSLNVGADTRRRDTIVAPRACRPFARDGMAYWRAWAGTCRGCLGGVNCSLYRTRIRYL FT NQFSKPECLDVSRLRAAACIGITRYPTSGVFMNDAYLSHVRTVLEQIRADGFYKSERVI FT ASPQSSSIALADGAQVLNFCANNYLGLADDPRIVKSAKDGLDRDGFGMASVRFICGTQS FT VHKQLEAALASFLHTDDAILYSSCFDANGGLFETLLTEDDAVISDELNHASIIDGIRLC FT KAKRFRYRNNNIDDLQAQLQAADAAGARFKLIATDGVFSMDGIIADLKAICDMADRYGA FT LVMVDDSHAVGFIGEHGRGTPEHCGVQDRVDIVTGTLGKALGGASGGYVAARAPIVELL FT RQRSRPYLFSNTLAPSIAYASLTVLELLRSDEGAALRRRVRENGAQFRRAMSSLGFTLI FT PGEHPIIPVMLGDAQLAGRMAEALLAQGVYVTGFSYPVVPKGRARIRTQMSAAHTPEQI FT EAAVDAFERVGRALNVI" FT CDS 762930..763070 FT /transl_table=11 FT /locus_tag="RBRH_02998" FT /db_xref="EnsemblGenomes-Gn:RBRH_02998" FT /db_xref="EnsemblGenomes-Tr:CBW77135" FT /db_xref="UniProtKB/TrEMBL:E5AVL1" FT /protein_id="CBW77135.1" FT /translation="MAYLRFLHGIVLFAPLLTSMLLFFSGQIVRISTICPTSPRTAEAI FT F" FT CDS complement(763259..763429) FT /transl_table=11 FT /locus_tag="RBRH_02997" FT /db_xref="EnsemblGenomes-Gn:RBRH_02997" FT /db_xref="EnsemblGenomes-Tr:CBW77136" FT /db_xref="UniProtKB/TrEMBL:E5AVL2" FT /protein_id="CBW77136.1" FT /translation="MLLRHSVCSPNVLDNVFSFDCVSGLSTSPLHLRLRLTIPCHRAVA FT YINKGEGFRDL" FT CDS complement(763776..764945) FT /transl_table=11 FT /locus_tag="RBRH_02996" FT /db_xref="EnsemblGenomes-Gn:RBRH_02996" FT /db_xref="EnsemblGenomes-Tr:CBW77137" FT /db_xref="InterPro:IPR021104" FT /db_xref="UniProtKB/TrEMBL:E5AVL3" FT /protein_id="CBW77137.1" FT /translation="MNDEDKQLIRDELENLKAQGTRRRELSLHACKRLFFDHAVRPTLA FT NVRELTGVGSASDIPKDIEFFWERVRDMSKVRIDAGVLPPALHSTAGELLRGLYDAALA FT TARDELAQERIGMQQTIAAAEQKVRDAQLLYEHARAELQRHHDAWTGAALKEGESAERL FT ATERAMAKRAHEQVVVLEGRLADSEAEISTLRDKVESLQTELKARTEHYAAEIKDAIAN FT AERRVKPLLVELDALRSAASSYQAGLREQSRKEFEHVQQLAAIKARADTLQNQLDTKSD FT EVDRLSRQIEQFRVQAGVPSALGKLVADLALAGRLTPEEIASIGTAVDGYVALPSTCAA FT CGDAELELYEHDERFELQCPACERTSGEAPSRLSAYNRFAAAVSPSLSG" FT CDS 766837..768183 FT /transl_table=11 FT /locus_tag="RBRH_02995" FT /product="Plasmid replication initiation protein" FT /function="Plasmid replication initiation protein" FT /note="Plasmid replication initiation protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02995" FT /db_xref="EnsemblGenomes-Tr:CBW77138" FT /db_xref="GOA:E5AVL4" FT /db_xref="InterPro:IPR000525" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AVL4" FT /protein_id="CBW77138.1" FT /translation="MATRVAKKKTDVVSPNSSELRKAVEAIAIQPKSGKITLLTRKLFN FT VLLAVAQQADESGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQK FT PGRKWGISTLIADAEILEDATTRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRSS FT AGLALYEICVRYLTNPSHLTMREPWQWWRPILSGTPDSEAGDEAKREYKYFKRDYLRPA FT IAEVNAVTNINVELIEHREGRRVSEIQFRVAERKQPMLALDEHPNVFDSTLVDRMVKLG FT IPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPAVRSAAALFKDALKKGYAPPVEEV FT PALQDKKVAGKEDPRARLMAEYAAYRRKQARELYDEQDDAGRDFARKSFEDEALPGLGA FT HLRDEWRKRGIASKIAETAFFDWLALKTWGEPTDGDLLAFTLNHARAVA" FT CDS complement(768222..769325) FT /transl_table=11 FT /locus_tag="RBRH_02993" FT /product="Chromosome partitioning protein parB" FT /function="Chromosome partitioning protein parB" FT /note="Chromosome partitioning protein parB" FT /note="COG: Predicted transcriptional regulators" FT /note="Pfam: ParB-like nuclease domain::PF02195" FT /db_xref="EnsemblGenomes-Gn:RBRH_02993" FT /db_xref="EnsemblGenomes-Tr:CBW77139" FT /db_xref="GOA:E5AVL5" FT /db_xref="InterPro:IPR003115" FT /db_xref="InterPro:IPR004437" FT /db_xref="UniProtKB/TrEMBL:E5AVL5" FT /protein_id="CBW77139.1" FT /translation="MKSSQLARGFQARPDTTTSEKRTALERLNAIDTWVKQPGSPDTSE FT PVAIAKKNGAPDPSGAVTPNTNESAAYRAWRTANGYTPGQVIELPLKAIKPSPFNPRHF FT YLKSSIAELAVNLAKQGQQQAIHVIPDHQNPGTFFVSDGGRRVRALKEANKENVRAIVV FT DLPIGIESYKLGYDLNVQRDSQTVFDNAIVWRRFLDEQHFQSQRELAEHLGIDESTVAV FT ALGIAKLPEAVMQEMVARPDRFGSNMAYQVARYHSAKGTDATLRLINKIVADDLSTRQV FT ADIIKGRAVSSDASKPLRRQRYAQRLEIKVGGATLGDLKSYGDDRLELKLKGLAREKRD FT ELLAQIEALLMPKTSDIDGRGANTADA" FT CDS complement(769349..770008) FT /transl_table=11 FT /locus_tag="RBRH_02992" FT /product="Chromosome partitioning protein parA" FT /function="Chromosome partitioning protein parA" FT /note="Chromosome partitioning protein parA" FT /note="COG: ATPases involved in chromosome partitioning" FT /note="Pfam: CobQ/CobB/MinD/ParA nucleotide binding FT domain::PF01656" FT /db_xref="EnsemblGenomes-Gn:RBRH_02992" FT /db_xref="EnsemblGenomes-Tr:CBW77140" FT /db_xref="InterPro:IPR002586" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AVL6" FT /protein_id="CBW77140.1" FT /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHERKKKVLVVDADGQNT FT LVHWSSAASEESSIPFPIVNLAEAGGQIHREIKKFVNDYDLIIVDCPPSITEKVSGVVL FT LAASIAVVPTSSSPADYWSSVGLVKLIQQAQTMNEDLKAVFLLNKTEEKRMLTRELKRA FT LEELGLPLLKTQIPTRECYKQAMALGQTVLQMSDRGAKLASAEIRACADEIAALLQ" FT CDS 771104..771460 FT /transl_table=11 FT /locus_tag="RBRH_02991" FT /product="Arsenate reductase family protein" FT /function="Arsenate reductase family protein" FT /note="Arsenate reductase family protein" FT /note="COG: Arsenate reductase and related proteins, FT glutaredoxin family" FT /note="Pfam: ArsC family::PF03960" FT /db_xref="EnsemblGenomes-Gn:RBRH_02991" FT /db_xref="EnsemblGenomes-Tr:CBW77141" FT /db_xref="GOA:E5AVL7" FT /db_xref="InterPro:IPR006659" FT /db_xref="InterPro:IPR006660" FT /db_xref="InterPro:IPR012336" FT /db_xref="UniProtKB/TrEMBL:E5AVL7" FT /protein_id="CBW77141.1" FT /translation="MITIYHHPRCSKSRAAYALLIDELAGREEVRTVEYLKTPPTLDEL FT KQLHALLGVPVRKMIRDNESAFAELGLGDTSLSEDALLKAVSEHPVLLQRPIVVRDSRA FT VIGRPPEQIATLFD" FT CDS complement(771887..773020) FT /transl_table=11 FT /locus_tag="RBRH_02989" FT /product="Mannose-6-phosphate isomerase (EC 5.3.1.8)" FT /function="Mannose-6-phosphate isomerase (EC 5.3.1.8)" FT /EC_number="5.3.1.8" FT /note="Mannose-6-phosphate isomerase (EC 5.3.1.8)" FT /note="COG: N-acyl-D-glucosamine 2-epimerase" FT /note="Pfam: N-acylglucosamine 2-epimerase (GlcNAc FT 2-epimerase)::PF07221" FT /db_xref="EnsemblGenomes-Gn:RBRH_02989" FT /db_xref="EnsemblGenomes-Tr:CBW77142" FT /db_xref="GOA:E5AVL8" FT /db_xref="InterPro:IPR008928" FT /db_xref="InterPro:IPR012341" FT /db_xref="UniProtKB/TrEMBL:E5AVL8" FT /protein_id="CBW77142.1" FT /translation="MNQPNYASATIDELQQHLASVILPLWTSWGFNDTLGLPYDVIAPP FT GQPALPPTRYRAMACARQLYVFSAAGWHDHADRLFESLRSRFMDATHGGWHYSIDAQGA FT PQETQKDLYTHAFIVFGCAEYFRHRGNREALDLLEATLHVIETRFATDAGLYNAVLSAD FT FRTIVTGPRQNPIMHLAEAYLSARDVQRDAWFSDALQRIAEQMIATFVHRPTGCIAELP FT IGCDAVRIEPGHQFEWFYLASSAPDVFGCSDLPNWLGSAYVFSLRHGVSPVTGGVCAAL FT DEHGHVTEPNERLWAQTEFARALATSQALRSTSDVQDAHVPLKTQLGRFKQRFLRDYGW FT IELIAQDGAVVRADMPSTTPYHMATMYHAVARLQEGP" FT CDS 773228..774022 FT /transl_table=11 FT /locus_tag="RBRH_02988" FT /product="5'-methylthioadenosine nucleosidase (EC 3.2.2.16) FT / S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" FT /function="5'-methylthioadenosine nucleosidase (EC FT 3.2.2.16) / S-adenosylhomocysteine nucleosidase (EC FT 3.2.2.9)" FT /EC_number="3.2.2.16" FT /note="5'-methylthioadenosine nucleosidase (EC 3.2.2.16) / FT S-adenosylhomocysteine nucleosidase (EC 3.2.2.9)" FT /note="COG: Nucleoside phosphorylase" FT /note="Pfam: Phosphorylase family::PF01048" FT /db_xref="EnsemblGenomes-Gn:RBRH_02988" FT /db_xref="EnsemblGenomes-Tr:CBW77143" FT /db_xref="GOA:E5AVL9" FT /db_xref="InterPro:IPR000845" FT /db_xref="InterPro:IPR010049" FT /db_xref="InterPro:IPR018017" FT /db_xref="UniProtKB/TrEMBL:E5AVL9" FT /protein_id="CBW77143.1" FT /translation="MNTVQESNVRPLGIMAALPEEIAPLIDEMRAAPDWRTVTLGRREY FT ALGTLRGMPCVMTLARVGKVAAATTATALIHQFGVDAIIFTGVAGGVARQVRVGDIVIA FT DALMQHDLDASPLFPRFEVPLLGVSRFGTDDSLSDALAVAAASFVRAHAMELVQRYRGV FT IDDVPRVHRGLVVSGDRFIADHAAREAVLAAAPDALAVEMEGAALAQVCHEYEVRCAVV FT RTISDAADAHAAVSFSTFLAEVASAYSAGVLQRFLAQPRGHQ" FT CDS complement(774600..775103) FT /transl_table=11 FT /locus_tag="RBRH_02987" FT /product="Ferric uptake regulation protein" FT /function="Ferric uptake regulation protein" FT /note="Ferric uptake regulation protein" FT /note="COG: Fe2+/Zn2+ uptake regulation proteins" FT /db_xref="EnsemblGenomes-Gn:RBRH_02987" FT /db_xref="EnsemblGenomes-Tr:CBW77144" FT /db_xref="GOA:E5AVM0" FT /db_xref="InterPro:IPR002481" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AVM0" FT /protein_id="CBW77144.1" FT /translation="MLNTPSRTLAALAAQAGPPVADVTQALQLAQAYCQERGESLTPLR FT QKVLSLLLQSGRATKAYTLLDEMRKIHPGAAPPTVYRALDFLQSVGLVHRIESINAFAV FT CHDLTHCRHGILIVCQSCGAVAEIDAPGVHHALVDKIESTGFTLARGELELKGLCAECT FT EKAV" FT CDS complement(775114..776742) FT /transl_table=11 FT /locus_tag="RBRH_02986" FT /product="Copper-exporting ATPase (EC 3.6.3.4)" FT /function="Copper-exporting ATPase (EC 3.6.3.4)" FT /EC_number="3.6.3.4" FT /note="Copper-exporting ATPase (EC 3.6.3.4)" FT /note="COG: Cation transport ATPase" FT /note="Pfam: E1-E2 ATPase::PF00122
haloacid FT dehalogenase-like hydrolase::PF00702" FT /db_xref="EnsemblGenomes-Gn:RBRH_02986" FT /db_xref="EnsemblGenomes-Tr:CBW77145" FT /db_xref="GOA:E5AVM1" FT /db_xref="InterPro:IPR001757" FT /db_xref="InterPro:IPR008250" FT /db_xref="InterPro:IPR018303" FT /db_xref="InterPro:IPR023214" FT /db_xref="InterPro:IPR023299" FT /db_xref="InterPro:IPR027256" FT /db_xref="UniProtKB/TrEMBL:E5AVM1" FT /protein_id="CBW77145.1" FT /translation="MLFGKWLETRAKRQTTAAIRALNALRPDTARVRIDGTERELPLSD FT VRVGMQVIVRPGERFPVDGHIVGGRTHANEAMLSGESLPVAKDEGDTVHAGSLNGEGAV FT VIETTGVGAQTMLAQIIQLVETAQAAKAPIQRLVDRVSAVFVPAIIAIALVTLCGWLLA FT GAPVQHAILNAVAVLVIACPCSLGLATPTAILAGTGVAARHGMLIKDAETLELAHRVNV FT IALDKTGTLTDGKPVVVAFDALEGTDEDALSIAAGVQQHSEHPLARAIVALAQQRQVAT FT AEARDTRAIAGRGIQATIGDAIFGIGSTRWLRELRITPDAALQARSDALQQVGNTVSWL FT VRVAPSPAPLALIAFGDTVRPSAQAALAQLAASGMRTLLMTGDNAGSAAALASAVGIAE FT VHADMSPQDKAAMIARLREQGNVVAMVGDGVNDAPALATADLGIAIGSGTDVAMHAAGI FT TLMRDDPALVADALDLSRRTYRKIWQNLFWAFVYNVVGVPLAALGWLNPMIAGAAMALS FT SVSVVGNALLLRRWRGSAARARRPM" FT CDS complement(776624..777646) FT /transl_table=11 FT /locus_tag="RBRH_04286" FT /product="Copper-exporting ATPase (EC 3.6.3.4)" FT /function="Copper-exporting ATPase (EC 3.6.3.4)" FT /EC_number="3.6.3.4" FT /note="Copper-exporting ATPase (EC 3.6.3.4)" FT /note="COG: Cation transport ATPase" FT /note="Pfam: Heavy-metal-associated domain::PF00403" FT /db_xref="EnsemblGenomes-Gn:RBRH_04286" FT /db_xref="EnsemblGenomes-Tr:CBW77146" FT /db_xref="GOA:E5AVM2" FT /db_xref="InterPro:IPR001802" FT /db_xref="InterPro:IPR006121" FT /db_xref="InterPro:IPR017969" FT /db_xref="UniProtKB/TrEMBL:E5AVM2" FT /protein_id="CBW77146.1" FT /translation="MGPEHAALGAVSTDGSPFDRIAGPRMGIVVVVLSCVADRRAVVSC FT HVVVRCRAVVSLRGVASSWDLDPPIMGRLILHPSCIVPDMMKASPTYTTSLDYTTSLDI FT EGMTCASCVTRVERALGKVPGVSHVTVNLATERASVTAGPNVAVPTLVAAVKKAGYDAH FT PTPETPVAAPHENAAQPLAAVIASALLTLPLLAPMINMLAGGAPSGEPISDMQAASGHG FT APSVPILLQAVLATVIQFVLGARFYRSGYKAVRALSGNMDLLVALGTSAAYGLVSLPMG FT DPSPWRSPPLFRSIRRRHHAGAVRQVARNPRQATDHRRDPCAECAAARYGARAHRRHRT FT " FT CDS 777632..777817 FT /transl_table=11 FT /locus_tag="RBRH_02985" FT /db_xref="EnsemblGenomes-Gn:RBRH_02985" FT /db_xref="EnsemblGenomes-Tr:CBW77147" FT /db_xref="UniProtKB/TrEMBL:E5AVM3" FT /protein_id="CBW77147.1" FT /translation="MFRAQLSSNENASSGFDDVSGIVLIRYSAGCVFGMLWRVSRVSPD FT CAQRIAIARPTRPTSG" FT CDS complement(777897..779111) FT /transl_table=11 FT /locus_tag="RBRH_02984" FT /product="Transcriptional regulators, LysR family" FT /function="Transcriptional regulators, LysR family" FT /note="Transcriptional regulators, LysR family" FT /note="COG: Transcriptional regulator" FT /note="Pfam: LysR substrate binding FT domain::PF03466
Bacterial regulatory helix-turn-helix FT protein, lysR family::PF00126" FT /db_xref="EnsemblGenomes-Gn:RBRH_02984" FT /db_xref="EnsemblGenomes-Tr:CBW77148" FT /db_xref="GOA:E5AVM4" FT /db_xref="InterPro:IPR000847" FT /db_xref="InterPro:IPR005119" FT /db_xref="InterPro:IPR011991" FT /db_xref="UniProtKB/TrEMBL:E5AVM4" FT /protein_id="CBW77148.1" FT /translation="MAGNFDFVGCIAPIALAHPAPLWSIAVMRILVATQCQINAYNPAT FT QFSATEQSVWLRADAAKLTTVSEMDRLQAMQVFTRVVESNSFSRAADTLDMPRASVTTI FT IQNLEAFLGVRLLQRTTRRLNLTPDGAAYYERCVRILADIAETEQLFHEGARNPRGKLR FT VDMPSSIGRLVVLPRLCEFHTRYPGIELMVGLGDKPVDLIQEGIDAVIRVGTLQDSTLV FT ARRVGVFQGVTCASPEYLKRHGEPRTLEELENHYAVNYFSSRTGRIIGWDFLVDGKPVT FT VKMKGAVAVNDADAYLNCGINGFGMIQPARFMALPYLQSGQLKEVLPQWKTQPMPISVV FT YPHNRHLSPKVRVFVDWIAEMFERCPLLSGQEDAEKRCAPTVATVGAQPAHRAEIGENE FT GELVL" FT CDS 779058..779993 FT /transl_table=11 FT /locus_tag="RBRH_02983" FT /product="Lipase (EC 3.1.1.3)" FT /function="Lipase (EC 3.1.1.3)" FT /EC_number="3.1.1.3" FT /note="Lipase (EC 3.1.1.3)" FT /note="COG: Esterase/lipase" FT /note="Pfam: alpha/beta hydrolase fold::PF07859" FT /db_xref="EnsemblGenomes-Gn:RBRH_02983" FT /db_xref="EnsemblGenomes-Tr:CBW77149" FT /db_xref="GOA:E5AVM5" FT /db_xref="InterPro:IPR013094" FT /db_xref="UniProtKB/TrEMBL:E5AVM5" FT /protein_id="CBW77149.1" FT /translation="MRQCDWGDTPYEIKITGHAREIALRIYRPVQASIDAGNQADSVEP FT SRRAARARAAARQSPRLVPVVLYFHGGLFTRGSLDDADATAVVLARVPALVVSVDYSLA FT PAYPFPAALEDSYHAACWIAERAHEFGADRHRLGVAGHDAGGNLATCLCAMARDRGGVS FT IAAQVLLAPLLDPSMTRVADARRVISDVDVSECAQCYRAYLPHALQRLHPYAAPLESRR FT LHRLPPVLIASAEHDVLHVEAEKYAGELINVGVPTQVTRFASVSHTALATHPPALTEAV FT AFFRHRLACVPDDALKQLDPLHKVNRGSSK" FT CDS 779990..780292 FT /transl_table=11 FT /locus_tag="RBRH_02982" FT /product="Acriflavin resistance periplasmic protein" FT /function="Acriflavin resistance periplasmic protein" FT /note="Acriflavin resistance periplasmic protein" FT /note="COG: Membrane-fusion protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02982" FT /db_xref="EnsemblGenomes-Tr:CBW77150" FT /db_xref="UniProtKB/TrEMBL:E5AVM6" FT /protein_id="CBW77150.1" FT /translation="MIMIRNPRHRHLLLAFAALAVIGGLGVVMALRDNPALQARAANAP FT SAPEVDVAPVVARTITDWQSYSGRLEAIEKVDIRPLVSGTIVAVHFRDGRKTACA" FT CDS 780283..780396 FT /transl_table=11 FT /locus_tag="RBRH_02981" FT /product="Acriflavin resistance periplasmic protein" FT /function="Acriflavin resistance periplasmic protein" FT /note="Acriflavin resistance periplasmic protein" FT /db_xref="EnsemblGenomes-Gn:RBRH_02981" FT /db_xref="EnsemblGenomes-Tr:CBW77151" FT /db_xref="UniProtKB/TrEMBL:E5AVM7" FT /protein_id="CBW77151.1" FT /translation="MRVITKGLKPGERIVVNGLQRVRPGEPVKVNAVQMMG" FT CDS 780414..781982 FT /transl_table=11 FT /locus_tag="RBRH_02980" FT /product="Acriflavin resistance plasma membrane protein" FT /function="Acriflavin resistance plasma membrane protein" FT /note="Acriflavin resistance plasma membrane protein" FT /note="COG: Cation/multidrug efflux pump" FT /note="Pfam: Protein of unknown function FT (DUF1214)::PF06742" FT /db_xref="EnsemblGenomes-Gn:RBRH_02980" FT /db_xref="EnsemblGenomes-Tr:CBW77152" FT /db_xref="GOA:E5AVM8" FT /db_xref="InterPro:IPR001036" FT /db_xref="InterPro:IPR010621" FT /db_xref="InterPro:IPR027463" FT /db_xref="UniProtKB/TrEMBL:E5AVM8" FT /protein_id="CBW77152.1" FT /translation="MNISKFFIDRPIFAGVLSVLVLLAGVIALFQLPIFEYPEAVPPSV FT IVYAQYPGANPKVIAETVASPLEEQINGVENMLYMQSQANSDGNMATTVTFKLGTDPDK FT AQQLVQNRVSQALPRLPEDVQRLGVTTVKSSPTLTMVVHLISPNDRYDMTYLRNYALIN FT VKDRLERIQGVGQVQLWGSGDYSMRVWLNPQKVAQRGMAASDVINAIREQNVQVAAGVV FT GASPSLPGAPLQLSVNAQGRLQTEEQFGDIVLKTSPDGGVTHLRDVARVELGASEYGLR FT ALLDNKPAVAIAINQSPGANSLAISEQVRRTMAELKADMPPGVEYRIVYDPTQFVRASI FT NAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTVVPDAGLMEDVLMPVAD FT VDRDNRPLSGRNGYVMHFTRNPLPVSAGGWTLVAEPLDDDGTGGDARRPGWRNRHVVLT FT NRDHLVRNRDGSIDITVQPTAPARPATANWLVSPTGRFRMVMRIYGPNTMMHRLNWRPP FT VLDRQ" FT CDS complement(782527..782760) FT /transl_table=11 FT /locus_tag="RBRH_02978" FT /db_xref="EnsemblGenomes-Gn:RBRH_02978" FT /db_xref="EnsemblGenomes-Tr:CBW77153" FT /db_xref="UniProtKB/TrEMBL:E5AVM9" FT /protein_id="CBW77153.1" FT /translation="MGICRSYKGYTILPSAEPLGNGLYAANLDLEGQQHGAQAHVEHFE FT ALDYFFEAEQATAYALRWGKLWIDTQHRLKAA" FT CDS complement(782865..784127) FT /transl_table=11 FT /locus_tag="RBRH_02977" FT /product="Glycosyltransferase (EC 2.4.1.-)" FT /function="Glycosyltransferase (EC 2.4.1.-)" FT /EC_number="2.4.1.-" FT /note="Glycosyltransferase (EC 2.4.1.-)" FT /note="COG: Glycosyltransferase" FT /note="Pfam: Glycosyl transferases group 1::PF00534" FT /db_xref="EnsemblGenomes-Gn:RBRH_02977" FT /db_xref="EnsemblGenomes-Tr:CBW77154" FT /db_xref="GOA:E5AVN0" FT /db_xref="InterPro:IPR001296" FT /db_xref="UniProtKB/TrEMBL:E5AVN0" FT /protein_id="CBW77154.1" FT /translation="MLLMNQLSSREADTAQRTRIIFHITEFNDGGIESAIIQWLRVFDR FT KHFDVTLSVMFTSAALEHRFRASIPADVRIETLVDRGWLDFFQTRRHLHKRSKLERVAR FT DIFNTVVVRRYVSQRIAHLAREHHLIVDFDMSLRRIAGRYGVGWLGVNHFSFNARLGGR FT LRKIRRLLKQYQAYDRIAALNEQMADEARAMFGSRLPPLLLLPNAIDIAAIRERASHQA FT GSASIPDEPYIVSVARLDEIYKDHRTLLRAYQRLVTAHAVREHLVIVGDGAFRAELEQL FT ARELSISERVHFTGQLNNPHPVIAGATLQILSSRSEGMPMVLLEGLALGRPIIATDCPT FT GPSEILDGGRAGILVPVGDVDAMVDAMRTVLTDPALRAGLTERARQRAQHYGIDASNAR FT LKAYVDTILASRRAVPTAGAA" FT CDS complement(784404..784685) FT /transl_table=11 FT /locus_tag="RBRH_02976" FT /db_xref="EnsemblGenomes-Gn:RBRH_02976" FT /db_xref="EnsemblGenomes-Tr:CBW77155" FT /db_xref="UniProtKB/TrEMBL:E5AVN1" FT /protein_id="CBW77155.1" FT /translation="MPHRPCGILSFSWASASRASPGDWHACAESPPRADRLCQVRRQPS FT AMRRRIAQPGYDLRRRLFLGGTAVWLHRYSAPYCRSRFGPQCPLFAWT" FT CDS complement(784685..786778) FT /transl_table=11 FT /locus_tag="RBRH_02975" FT /product="Acetoin catabolism regulatory protein" FT /function="Acetoin catabolism regulatory protein" FT /note="Acetoin catabolism regulatory protein" FT /note="COG: Transcriptional activator of acetoin/glycerol FT metabolism" FT /note="Pfam: Bacterial regulatory protein, Fis FT family::PF02954
Sigma-54 interaction domain::PF00158" FT /db_xref="EnsemblGenomes-Gn:RBRH_02975" FT /db_xref="EnsemblGenomes-Tr:CBW77156" FT /db_xref="GOA:E5AVN2" FT /db_xref="InterPro:IPR002078" FT /db_xref="InterPro:IPR002197" FT /db_xref="InterPro:IPR003593" FT /db_xref="InterPro:IPR009057" FT /db_xref="InterPro:IPR025943" FT /db_xref="InterPro:IPR025944" FT /db_xref="InterPro:IPR027417" FT /db_xref="UniProtKB/TrEMBL:E5AVN2" FT /protein_id="CBW77156.1" FT /translation="MCYKRLKLQVLCRGFAMPYVSFSQHIERVRSAIEGRNAPLNNESA FT RLVSSWQRSLERYRLDPSSRVGPRVVTASELRELREREEAFLRASGQCLSKLHEAVRIA FT DYCVLLTNAHGVTIDYRIDRDRRADFKHAGLHIGSCWSEQEEGTCGIANVLADLAPITV FT HKTDHFRAAFTTLTCSASPIFAPDGALIGVLDASAIRSPDNRDSQGLVYQLVQQSARLI FT EDAYFLNQTPHHWILFGHSSRHFVEARPEVLIAFDENGNLVAANAHARETIPGLTGSAP FT SHLADLFDVPLARMLDASNLHDVLPLRLCASGTILYARIRRPQRRGHAAGASTPARVAE FT PAAPAQLAPPLRGTPLHDGRAPGLFSMPSGRLSNTPAGAGPLEAFAQSQDRRVAQAASI FT ALRVAERRLPILILGESGCGKEVFARAIHESGIRCQQPFVAVNCGALPESLIESELFGY FT AAGAFTGARSKGTRGKIALAHGGTLFLDEIGDMPLLLQTRLLRVLADGEVLPLGAETAT FT RVDVNVICATHRDLGAMVAQGTFREDLYYRLSGAVLRLPPLRERIDIRALIQAVFDDEA FT RAVPHRLVLDAAVLERLCHHPWPGNVRQLRHALRYACAVADTNRVEWHHLPAEIAAELG FT SPATPPVALESLTDERERIVAALTRNQWRPIPAAQALGISRATLYRRIAKLGIVPPHRL FT PAA" FT CDS complement(786779..787069) FT /transl_table=11 FT /locus_tag="RBRH_02974" FT /db_xref="EnsemblGenomes-Gn:RBRH_02974" FT /db_xref="EnsemblGenomes-Tr:CBW77157" FT /db_xref="UniProtKB/TrEMBL:E5AVN3" FT /protein_id="CBW77157.1" FT /translation="MQWGCAANTKKLHARWRYAVRLYLAVSKRRRPYAHARIDVRHSVT FT ASSRDKSAATGAVRADARARHAWINVRRRTPHRETIVSRCGVLQCNVCQGR" FT CDS 787113..787277 FT /transl_table=11 FT /locus_tag="RBRH_02973" FT /db_xref="EnsemblGenomes-Gn:RBRH_02973" FT /db_xref="EnsemblGenomes-Tr:CBW77158" FT /db_xref="UniProtKB/TrEMBL:E5AVN4" FT /protein_id="CBW77158.1" FT /translation="MHIAVTTHVSNMSAQAHEQRRRAATPGKETTPCQAPFRQSVSSPI FT LHPAAIFVA" FT CDS 787208..788269 FT /transl_table=11 FT /locus_tag="RBRH_02972" FT /product="Acetoin catabolism protein X" FT /function="Acetoin catabolism protein X" FT /note="Acetoin catabolism protein X" FT /note="COG: Uncharacterized conserved protein" FT /note="Pfam: ATP-NAD kinase::PF01513" FT /db_xref="EnsemblGenomes-Gn:RBRH_02972" FT /db_xref="EnsemblGenomes-Tr:CBW77159" FT /db_xref="GOA:E5AVN5" FT /db_xref="InterPro:IPR002504" FT /db_xref="InterPro:IPR011391" FT /db_xref="InterPro:IPR016064" FT /db_xref="UniProtKB/TrEMBL:E5AVN5" FT /protein_id="CBW77159.1" FT /translation="MSSTVPAVGIIANPASGRDIRRLTSHASVFPTAEKANMVVRLFAG FT LGALGVRRVLTLRDKTGVAALVLRAVQAHAALSGRERWPQVEFADLPMTQSVADTHAGV FT AYMVERGVSLIAVLGGDGTHRAVAMHCRDVPLLTLSTGTNNSFPDLREATVAGLAGALV FT ATGSVPPDAALSRNKRLVVRCVSGRKCGHEEIALVDLCVSRQRFIGARALSDPSDIHAL FT FLTFAAADAIGLSSIGAAWAPVARTAPHGLQMTFADAPLTGVPLVAPIAPGQIGTVWMT FT DCERLEVGQQVMLDVGYGTLALDGEREIEIEKGETYVVSLDWAGPLTVDVERTLRFSAA FT RQFLRERAAALFN" FT CDS 788297..789280 FT /transl_table=11 FT /locus_tag="RBRH_02971" FT /product="Acetoin dehydrogenase E1 component alpha-subunit FT (EC 1.2.4.-)" FT /function="Acetoin dehydrogenase E1 component alpha-subunit FT (EC 1.2.4.-)" FT /EC_number="1.2.4.-" FT /note="Acetoin dehydrogenase E1 component alpha-subunit (EC FT 1.2.4.-)" FT /note="COG: Pyruvate/2-oxoglutarate dehydrogenase complex, FT dehydrogenase (E1) component, eukaryotic type, alpha FT subunit" FT /note="Pfam: Dehydrogenase E1 component::PF00676" FT /db_xref="EnsemblGenomes-Gn:RBRH_02971" FT /db_xref="EnsemblGenomes-Tr:CBW77160" FT /db_xref="GOA:E5AVN6" FT /db_xref="InterPro:IPR001017" FT /db_xref="UniProtKB/TrEMBL:E5AVN6" FT /protein_id="CBW77160.1" FT /translation="MSISGQLTRETLLDAYRSMRTIREFEERLHVEFATGEIPGFVHLY FT AGEEASAVGTMMHLNDIDYVATTHRGHGHCIAKGVDVHGMMAEIYGRRTGVCRGKGGSM FT HIADLSRGMLGANGIVGAGAPLVCGAALAAKFKKTGGVGVCFFGDGASNQGVIFESMNL FT ASVWRLPAIFVAENNGYAEATSASWSVAADNIADRANGFGMPGVIVDGFDFFAVYEALG FT EAISRARNGGGPTLVEVKLTRYYGHFEGDAQTYREAGEVQKAREEKDCLKHFEQRVVRS FT ELVRVDELRAIDERVKALIDDAVRSAKAAPLPTEADLLSDVYVAYP" FT CDS 789413..790108 FT /transl_table=11 FT /locus_tag="RBRH_02970" FT /product="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /function="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /EC_number="1.2.4.-" FT /note="Acetoin dehydrogenase E1 component beta-subunit (EC FT 1.2.4.-)" FT /note="COG: Pyruvate/2-oxoglutarate dehydrogenase complex, FT dehydrogenase (E1) component, eukaryotic type, beta FT subunit" FT /note="Pfam: Transketolase, pyrimidine binding FT domain::PF02779" FT /db_xref="EnsemblGenomes-Gn:RBRH_02970" FT /db_xref="EnsemblGenomes-Tr:CBW77161" FT /db_xref="GOA:E5AVN7" FT /db_xref="InterPro:IPR005475" FT /db_xref="InterPro:IPR027110" FT /db_xref="UniProtKB/TrEMBL:E5AVN7" FT /protein_id="CBW77161.1" FT /translation="MARKITYQQAINEALSQEMARDENVIVMGEDNAGGAGSSGEQDAW FT GGVLGVTKGLFHRYPGRVLDTPLSEGGFIGAAVGAAACGMRPVVELMFIDFMGVCFDQI FT FNQAAKFRYMFGGKALTPVVIRTMQGAGLRAAAQHSQMLTSLFTHVPGLKVVCPSTPYD FT AKGLLIQSIRDDDPVIFCEHKLLYSQEGDVPEESYAIPFGEANVVRDGDDHHLWTDGAP FT VGGGGQHAS" FT CDS 790017..790409 FT /transl_table=11 FT /locus_tag="RBRH_03514" FT /product="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /function="Acetoin dehydrogenase E1 component beta-subunit FT (EC 1.2.4.-)" FT /EC_number="1.2.4.-" FT /note="Acetoin dehydrogenase E1 component beta-subunit (EC FT 1.2.4.-)" FT /note="COG: Pyruvate/2-oxoglutarate dehydrogenase complex, FT dehydrogenase (E1) component, eukaryotic type, beta FT subunit" FT /note="Pfam: Transketolase, C-terminal domain::PF02780" FT /db_xref="EnsemblGenomes-Gn:RBRH_03514" FT /db_xref="EnsemblGenomes-Tr:CBW77162" FT /db_xref="GOA:E5AVN8" FT /db_xref="InterPro:IPR005476" FT /db_xref="InterPro:IPR009014" FT /db_xref="InterPro:IPR027110" FT /db_xref="UniProtKB/TrEMBL:E5AVN8" FT /protein_id="CBW77162.1" FT /translation="MARPTWCATATIITYGRMVHQSVEAASTLARQGIDVEVIDLRTTS FT PLDEETILESASRTGRVVVVDEANPRCSVATDIAALIAQRAFKSLKAQIELVTAPHTPA FT PFAGVLEDMYIPSPEKIAAAVTKVRS" FT CDS 790413..791525 FT /transl_table=11 FT /locus_tag="RBRH_03513" FT /product="Dihydrolipoamide acetyltransferase component of FT acetoin dehydrogenase complex (EC 2.3.1.-)" FT /function="Dihydrolipoamide acetyltransferase component of FT acetoin dehydrogenase complex (EC 2.3.1.-)" FT /EC_number="2.3.1.-" FT /note="Dihydrolipoamide acetyltransferase component of FT acetoin dehydrogenase complex (EC 2.3.1.-)" FT /note="COG: Predicted hydrolases or acyltransferases FT (alpha/beta hydrolase superfamily)" FT /note="Pfam: alpha/beta hydrolase FT fold::PF00561
Biotin-requiring enzyme::PF00364" FT /db_xref="EnsemblGenomes-Gn:RBRH_03513" FT /db_xref="EnsemblGenomes-Tr:CBW77163" FT /db_xref="GOA:E5AVN9" FT /db_xref="InterPro:IPR000073" FT /db_xref="InterPro:IPR000089" FT /db_xref="InterPro:IPR003016" FT /db_xref="InterPro:IPR011053" FT /db_xref="UniProtKB/TrEMBL:E5AVN9" FT /protein_id="CBW77163.1" FT /translation="MPIHMIKMPKWGLSMEQGQVNGWLKQIGDKVSKGDELLDVETEKI FT SSDVECAFDGVLRRQIAVEGETLPIGALLAVVADADVSDAQIDEAVAAFQRDFVPAAAD FT AADTGPQPHKRIVGSHTIRYLKQGDGGVPVLLIHGFGGDLNNWLFNHAELAARRAVWAL FT DLPGHGESSKPLQAGTLDELAQYVTAFMREEGIERAHLVGHSMGGAVALQIASLEPQRV FT ASLALIASAGLGREIDADYIDGFVAGTSRNTLKPHLLKLFADPALVTRQLVEDMVKYKR FT LDGVNETLAKIAAATFGDGVQRHVYRDRLAELAPRTLVLWGSEDRIIPALHAQGLPAGV FT QSHVIEGKGHMVQMEAAAEVNQVLNAFFGD" FT CDS 791528..792511 FT /transl_table=11 FT /locus_tag="RBRH_03512" FT /product="Lipoic acid synthetase (EC 2.8.1.8)" FT /function="Lipoic acid synthetase (EC 2.8.1.8)" FT /EC_number="2.8.1.8" FT /note="Lipoic acid synthetase (EC 2.8.1.8)" FT /note="COG: Lipoate synthase" FT /note="Pfam: Radical SAM superfamily::PF04055" FT /db_xref="EnsemblGenomes-Gn:RBRH_03512" FT /db_xref="EnsemblGenomes-Tr:CBW77164" FT /db_xref="GOA:E5AVP0" FT /db_xref="InterPro:IPR003698" FT /db_xref="InterPro:IPR006638" FT /db_xref="InterPro:IPR007197" FT /db_xref="InterPro:IPR013785" FT /db_xref="UniProtKB/TrEMBL:E5AVP0" FT /protein_id="CBW77164.1" FT