spacer

EBI Dbfetch

ID   FR686493; SV 1; linear; genomic DNA; STD; HUM; 1135 BP.
XX
AC   FR686493;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   26-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*07,
DE   exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1135
RA   Tourne S.;
RT   ;
RL   Submitted (22-AUG-2010) to the INSDC.
RL   Tourne S., Laboratoire d Histocompatibilite, EFS Alsace, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Froelich N., Weschler B., Schell A., Leisenbach R., Tourne S., Hanau D.;
RT   "The new HLA-C*O7 allele has a nucleotide change from HLA-C*07:02:01 (a G
RT   to a A) at position 544 (exon 3), which induces the substitution of
RT   amino-acid at position 158 (an alanine to a threonine)";
RL   Unpublished.
XX
DR   MD5; 17d57b36f7f69d0822666d653b56feed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1135
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: GlyG-9 (exon 1), fwd_seq:
FT                   ctgctgctctcgggaggc, rev_name: Intron 4C (Intron 4),
FT                   rev_seq: cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,430..705,854..>1135)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WMP9"
FT                   /db_xref="IMGT/HLA:C*07:137:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E0WMP9"
FT                   /protein_id="CBW47559.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWGK"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=2
FT   intron          271..429
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=2
FT   gap             296..395
FT                   /estimated_length=unknown
FT   exon            430..705
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=3
FT   intron          706..853
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=3
FT   gap             734..833
FT                   /estimated_length=unknown
FT   exon            854..>1135
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=4
XX
SQ   Sequence 1135 BP; 183 A; 295 C; 331 G; 126 T; 200 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcannnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnncgggg gactgggctg accgcggggg       420
     cggggccagg gtctcacacc ctccagagga tgtctggctg cgacctgggg cccgacgggc       480
     gcctcctccg cgggtatgac cagtccgcct acgacggcaa ggattacatc gccctgaacg       540
     aggacctgcg ctcctggacc gccgcggaca ccgcggctca gatcacccag cgcaagttgg       600
     aggcggcccg tgcggcggag cagctgagaa cctacctgga gggcacgtgc gtggagtggc       660
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cgcaggtacc aggggcagtg       720
     gggagccttc cccnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntttctga       840
     ctcttcccgt cagaaccccc aaagacacac gtgacccacc accccctctc tgaccatgag       900
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag       960
     cgggatgggg aggaccagac ccaggacacc gagcttgtgg agaccaggcc agcaggagat      1020
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gacaagagca gagatacacg      1080
     tgccatatgc agcacgaggg gctgcaagag cccctcaccc tgagctgggg taagg           1135
//


spacer
spacer