spacer

EBI Dbfetch

ID   FR686470; SV 1; linear; genomic DNA; STD; HUM; 1261 BP.
XX
AC   FR686470;
XX
DT   26-AUG-2010 (Rel. 105, Created)
DT   26-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*15New, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1261
RA   Tourne S.;
RT   ;
RL   Submitted (20-AUG-2010) to the INSDC.
RL   Tourne S., Laboratoire d Histocompatibilite, EFS Alsace, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Froelich N., Weschler B., Schell A., Leisenbach R., Tourne S., Hanau D.;
RT   "The new HLA-C*15 allele has a nucleotide change from HLA-C*15:02:01 (a C
RT   to G) at position 186 (exon 2), which induces the substitution of the
RT   amino-acid at position 38 (a serine to an Arginine)";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1261
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: AlaC-9 (exon 1), fwd_seq:
FT                   mtcctgctgctctcgggagc, rev_name: Intron4C (Intron 4),
FT                   rev_seq: cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,517..792,986..>1261)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E0WMP8"
FT                   /db_xref="IMGT/HLA:C*15:44"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E0WMP8"
FT                   /protein_id="CBW47557.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDRDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRKLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQLAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   mRNA            join(1..270,517..792,986..1261)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /number=2
FT   intron          271..516
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /number=3
FT   intron          793..985
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            986..1261
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*15New"
FT                   /number=4
XX
SQ   Sequence 1261 BP; 229 A; 362 C; 401 G; 169 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agggacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgggggac ggggctgacc acgggggcgg ggccagggtc tcacatcatc cagaggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gcatgaccag ttagcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gggtaccagg ggcagtgggg agccttcccn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna tgggcgctgt tggagtgtcg caagagagat acaaagtgtc       960
     tgaattttct gactcttccc gtcagaacac ccaaagacac acgtgaccca ccatcccgtc      1020
     tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca      1080
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ccgagcttgt ggagaccagg      1140
     ccagcaggag atggaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaagag      1200
     cagagataca cgtgccatgt gcagcacgag gggctgccgg agcccctcac cctgagatgg      1260
     g                                                                      1261
//


spacer
spacer