spacer

EBI Dbfetch

ID   FR682498; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR682498;
XX
DT   14-AUG-2010 (Rel. 105, Created)
DT   14-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*13, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Masson D.M.;
RT   ;
RL   Submitted (12-AUG-2010) to the INSDC.
RL   Masson D.M., EFS Rhone Alpes, HLA Laboratory, BP35, 38701, FRANCE.
XX
RN   [2]
RA   Masson D.;
RT   "x";
RL   Unpublished.
XX
DR   MD5; 8aac38980203a70c8ceb40a727c403e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: RB10, fwd_seq: gtgggcgttgcggcggc,
FT                   rev_name: RB28, rev_seq: acacacacactcagattccca"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*13"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D9UC11"
FT                   /db_xref="IMGT/HLA:DRB1*13:01:08"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D9UC11"
FT                   /protein_id="CBW46831.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer