Dbfetch

ID   FR677014; SV 1; linear; genomic DNA; STD; HUM; 2615 BP.
XX
AC   FR677014;
XX
DT   04-AUG-2010 (Rel. 105, Created)
DT   04-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*15,
DE   clone D10002153, exons 1-6
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2615
RA   Qu J.;
RT   ;
RL   Submitted (04-AUG-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Zhen H., Deng X., Shen M., Huang C., Liao K., Li J.,
RA   Zhang H., Zheng Z.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
DR   MD5; 1cbc3cb07c5c39b566be44009611be4b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2615
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10002153"
FT                   /db_xref="taxon:9606"
FT   CDS             join(25..97,227..496,742..1017,1593..1868,1973..2089,
FT                   2531..>2563)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB27"
FT                   /db_xref="IMGT/HLA:B*15:01:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB27"
FT                   /protein_id="CBW44736.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAA"
FT   exon            25..97
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=1
FT   intron          98..226
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=1
FT   exon            227..496
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
FT   intron          497..741
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
FT   exon            742..1017
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=3
FT   intron          1018..1592
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=3
FT   exon            1593..1868
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=4
FT   intron          1869..1972
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=4
FT   exon            1973..2089
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=5
FT   intron          2090..2530
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=5
FT   exon            2531..>2563
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=6
XX
SQ   Sequence 2615 BP; 492 A; 778 C; 836 G; 509 T; 0 other;
     ctcaaaatct cctcagacgc cgagatgcgg gtcacggcgc cccgaaccgt cctcctgctg        60
     ctctcgggag ccctggccct gaccgagacc tgggccggtg agtgcggggt cggcagggaa       120
     atggcctctg tggggaggag cgaggggacc gcaggcgggg gcgcaggacc cggggagccg       180
     cgccgggagg agggtcgggc gggtctcagc ccctcctcgc ccccaggctc ccactccatg       240
     aggtatttct acaccgccat gtcccggccc ggccgcgggg agccccgctt catcgcagtg       300
     ggctacgtgg acgacaccca gttcgtgagg ttcgacagcg acgccgcgag tccgaggatg       360
     gcgccccggg cgccatggat agagcaggag gggccggagt attgggaccg ggagacacag       420
     atctccaaga ccaacacaca gacttaccga gagagcctgc ggaacctgcg cggctactac       480
     aaccagagcg aggccggtga gtgaccccgg cctggggcgc aggtcacgac tccccatccc       540
     ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag atccgccccc ctgaggccgc       600
     gggacccgcc caaaccctcg accggcgaga gccccaggcg cgtttacccg gtttcatttt       660
     cagttgaggc caaaatcccc gcgggttggt cggggcgggg cggggctcgg gggacggggc       720
     tgaccgcggg gcctgggcca gggtctcaca ccctccagag gatgtacggc tgcgacgtgg       780
     ggccggacgg gcgcctcctc cgcgggcatg accagtccgc ctacgacggc aaggattaca       840
     tcgccctgaa cgaggacctg agctcctgga ccgcggcgga cacggcggct cagatcaccc       900
     agcgcaagtg ggaggcggcc cgtgaggcgg agcagtggag agcctacctg gagggcctgt       960
     gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcgggta      1020
     ccaggggcag tggggagcct tccccatctc ctataggtcg ccggggatgg cctcccacga      1080
     gaagaggagg aaaatgggat cagcgctaga atgtcgccct cccttgaatg gagaatggca      1140
     tgagttttcc tgagtttcct ctgagggccc cctcttctct ctaggacaat taagggatga      1200
     cgtctctgag gaaatggagg ggaagacagt ccctaggata gtgatcaggg gtcccctttg      1260
     acccctgcag cagccttggg aaccgtgact tttcctctca ggccttgttc tctgcctcac      1320
     actcagtgtg tttggggctc tgattccagc acttctgagt cactttacct ccactcagat      1380
     caggagcaga agtccctgtt ccccgctcag agactcgaac tttccaatga ataggagatt      1440
     atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt gccccttccc caccccaggt      1500
     gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat gagagatgca      1560
     aagcgcctga attttctgac tcttcccatc agacccccca aagacacatg tgacccacca      1620
     ccccatctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct accctgcgga      1680
     gatcacactg acctggcagc gggatggcga ggaccaaact caggacactg agcttgtgga      1740
     gaccagacca gcaggagata gaaccttcca gaagtgggca gctgtggtgg tgccttctgg      1800
     agaagagcag agatacacat gccatgtaca gcatgagggg ctgccgaagc ccctcaccct      1860
     gagatggggt aaggaggggg atgaggggtc atatctgttc tcagggaaag caggagccct      1920
     tctggagccc ttcagcaggg tcagggcccc tcatcttccc ctcctttccc agagccatct      1980
     tcccagtcca ccatccccat cgtgggcatt gttgctggcc tggctgtcct agcagttgtg      2040
     gtcatcggag ctgtggtcgc tactgtgatg tgtaggagga agagctcagg tagggaaggg      2100
     gtgaggggtg gggtctgggt tttcttgtcc cactgggggt ttcaagcccc aggtagaagt      2160
     gttccctgcc tcattactgg gaagcagcat ccacacaggg gctaacgcag cctgggaccc      2220
     tgtgtgccag cacttactct tttgtgcagc acatgtgaca atgaaggaca gatgtatcgc      2280
     cttgatggtt gtggtgttgg ggtcctgatt ccagcattca tgagtcaggg gaaggtccct      2340
     gctaaggaca gaccttagga gggcagttgg tccaggaccc acacttgctt tcctcgtgtt      2400
     tcctgatcct gccctgggtc tgtagtcata cttctggaaa ttccttttgg ttccaagacg      2460
     aggaggttcc tctaagatct catggtcctg cttcctccca gtcccctcac aggacatttt      2520
     cttcccacag gtggaaaagg agggagctac tctcaggctg cgtgtaagtg gtgggggtgg      2580
     gagtgtggag gagctcaccc accccataat tcctc                                 2615
//