spacer

EBI Dbfetch

ID   FR675939; SV 1; linear; genomic DNA; STD; HUM; 2891 BP.
XX
AC   FR675939;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   11-NOV-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*35, clone
DE   CD10001097, exons 1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2891
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Wei Wei, Xu Xin, Zhang Xiaozhuang, Ye Ning, Huang Shuiqing, Luo Xianqiong;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 314e19fc403d8ea017669e53723aead0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2891
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="CD10001097"
FT                   /db_xref="taxon:9606"
FT   CDS             join(18..90,220..489,735..1010,1586..1861,1966..2082,
FT                   2524..2556,2663..2706)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D2IYK1"
FT                   /db_xref="IMGT/HLA:B*46:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D2IYK1"
FT                   /protein_id="CBW44127.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            18..90
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   intron          91..219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   exon            220..489
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   intron          490..734
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   exon            735..1010
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   intron          1011..1585
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   exon            1586..1861
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
FT   intron          1862..1965
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
FT   exon            1966..2082
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=5
FT   intron          2083..2523
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=5
FT   exon            2524..2556
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=6
FT   intron          2557..2662
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=6
FT   exon            2663..2706
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=7
XX
SQ   Sequence 2891 BP; 532 A; 832 C; 935 G; 592 T; 0 other;
     tctcctcaga cgccgagatg cgggtcacgg cgccccgaac cgtcctcctg ctgctctcgg        60
     gagccctggc cctgaccgag acctgggccg gtgagtgcgg ggtcggcagg gaaatggcct       120
     ctgtggggag gagcgagggg accgcaggcg ggggcgcagg acccggggag ccgcgccggg       180
     aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt       240
     tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcgca gtgggctacg       300
     tggacgacac ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg atggcgcccc       360
     gggcgccatg gatagagcag gaggggccgg agtattggga ccgggagaca caaaagtaca       420
     agcgccaggc acagactgac cgagtgagcc tgcggaacct gcgcggctac tacaaccaga       480
     gcgaggccgg tgagtgaccc cggcctgggg cgcaggtcac gactccccat cccccacgta       540
     cggcccgggt cgccccgagt ctccgggtcc gagatccgcc cccctgaggc cgcgggaccc       600
     gcccaaaccc tcgaccggcg agagccccag gcgcgtttac ccggtttcat tttcagttga       660
     ggccaaaatc cccgcgggtt ggtcggggcg gggcggggct cgggggacgg ggctgaccgc       720
     ggggcctggg ccagggtctc acaccctcca gaggatgtac ggctgcgacg tggggccgga       780
     cgggcgcctc ctccgcgggc atgaccagtc cgcctacgac ggcaaggatt acatcgccct       840
     gaacgaggac ctgagctcct ggaccgcggc ggacacggcg gctcagatca cccagcgcaa       900
     gtgggaggcg gcccgtgagg cggagcagtg gagagcctac ctggagggcc tgtgcgtgga       960
     gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg      1020
     cagtggggag ccttccccat ctcctatagg tcgccgggga tggcctccca cgagaagagg      1080
     aggaaaatgg gatcagcgct agaatgtcgc cctcccttga atggagaatg gcatgagttt      1140
     tcctgagttt cctctgaggg ccccctcttc tctctaggac aattaaggga tgacgtctct      1200
     gaggaaatgg aggggaagac agtccctagg atagtgatca ggggtcccct ttgacccctg      1260
     cagcagcctt gggaaccgtg acttttcctc tcaggccttg ttctctgcct cacactcagt      1320
     gtgtttgggg ctctgattcc agcacttctg agtcacttta cctccactca gatcaggagc      1380
     agaagtccct gttccccgct cagagactcg aactttccaa tgaataggag attatcccag      1440
     gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt      1500
     ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc      1560
     tgaattttct gactcttccc atcagacccc ccaaagacac atgtgaccca ccaccccatc      1620
     tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca      1680
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ccgagcttgt ggagaccaga      1740
     ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaagag      1800
     cagagataca catgccatgt acagcatgag gggctgccga agcccctcac cctgagatgg      1860
     ggtaaggagg gggatgaggg gtcatatctg ttctcaggga aagcaggagc ccttctggag      1920
     cccttcagca gggtcagggc ccctcatctt cccctccttt cccagagcca tcttcccagt      1980
     ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg      2040
     gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtagggaa ggggtgaggg      2100
     gtggggtctg ggttttcttg tcccactggg ggtttcaagc cccaggtaga agtgttccct      2160
     gcctcattac tgggaagcag catccacaca ggggctaacg cagcctggga ccctgtgtgc      2220
     cagcacttac tcttttgtgc agcacatgtg acaatgaagg acagatgtat cgccttgatg      2280
     gttgtggtgt tggggtcctg attccagcat tcatgagtca ggggaaggtc cctgctaagg      2340
     acagacctta ggagggcagt tggtccagga cccacacttg ctttcctcgt gtttcctgat      2400
     cctgccctgg gtctgtagtc atacttctgg aaattccttt tggttccaag acgaggaggt      2460
     tcctctaaga tctcatggtc ctgcttcctc ccagtcccct cacaggacat tttcttccca      2520
     caggtggaaa aggagggagc tactctcagg ctgcgtgtaa gtggtggggg tgggagtgtg      2580
     gaggagctca cccaccccat aattcctcct gtcccacgtc tcctgcgggc tctgaccagg      2640
     tcctgttttt gttctactcc agccagcgac agtgcccagg gctctgatgt gtctctcaca      2700
     gcttgaaaag gtgagattct tggggtctag agtgggtggg gtggcgggtc tgggggtggg      2760
     tggggcagtg gggaaaggcc tgggtaatgg agattctttg attgggatgt ttcgcgtgtg      2820
     tcgtgggctg ttcagagtgt catcacttac catgactaac cagaatttgt tcatgactgt      2880
     tgttttctgt a                                                           2891
//


spacer
spacer