spacer

EBI Dbfetch

ID   FR675938; SV 1; linear; genomic DNA; STD; HUM; 2806 BP.
XX
AC   FR675938;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*35, clone
DE   D10006022, exons 1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2806
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 198a61b3d4b83cfed1fa018f0b5313e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2806
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006022"
FT                   /db_xref="taxon:9606"
FT   CDS             join(95..167,297..566,812..1087,1663..1938,2043..2159,
FT                   2601..2633,2740..2783)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q546I9"
FT                   /db_xref="IMGT/HLA:B*35:01:22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546I9"
FT                   /protein_id="CBW44126.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            95..167
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   intron          168..296
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   exon            297..566
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   intron          567..811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   exon            812..1087
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   intron          1088..1662
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   exon            1663..1938
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
FT   intron          1939..2042
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
FT   exon            2043..2159
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=5
FT   intron          2160..2600
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=5
FT   exon            2601..2633
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=6
FT   intron          2634..2739
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=6
FT   exon            2740..2783
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=7
XX
SQ   Sequence 2806 BP; 529 A; 834 C; 886 G; 557 T; 0 other;
     tcggatatct agagaagcca atcagtgtcg ccggggtccc agttctaaag tccccacgca        60
     cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcgc cccgaaccgt       120
     cctcctgctg ctctgggggg cagtggccct gaccgagacc tgggccggtg agtgcggggt       180
     cgggagggaa atggcctctg tggggaggag cgaggggacc gcaggcgggg gcgcaggacc       240
     tgaggagccg cgccgggagg agggtcgggc gggtctcagc ccctcctcgc ccccaggctc       300
     ccactccatg aggtatttct acaccgccat gtcccggccc ggccgcgggg agccccgctt       360
     catcgcagtg ggctacgtgg acgacaccca gttcgtgagg ttcgacagcg acgccgcgag       420
     tccgaggacg gagccccggg cgccatggat agagcaggag gggccggagt attgggaccg       480
     gaacacacag atcttcaaga ccaacacaca gacttaccga gagagcctgc ggaacctgcg       540
     cggctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcacgac       600
     tccccatccc ccacgtacgg cccgggtcgc cccgagtctc cgggtccgag atccgcctcc       660
     ctgaggccgc gggacccgcc cagaccctcg accggcgaga gccccaggcg cgtttacccg       720
     gtttcatttt cagttgaggc caaaatcccc gcgggttggt cggggcgggg cggggctcgg       780
     gggacggggc tgaccgcggg gccggggcca gggtctcaca tcatccagag gatgtatggc       840
     tgcgacctgg ggcccgacgg gcgcctcctc cgcgggcatg accagtccgc ctacgacggc       900
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga caccgcggct       960
     cagatcaccc agcgcaagtg ggaggcggcc cgggtggcgg agcagctgag agcctacctg      1020
     gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag      1080
     cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg ccggggatgg      1140
     cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct cccttgaatg      1200
     gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct ctaggacaat      1260
     taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata ctgatcaggg      1320
     gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca ggccttgttc      1380
     tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt cactttacct      1440
     ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac tttccaatga      1500
     ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt gccccttccc      1560
     cacaccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat      1620
     gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca aagacacacg      1680
     tgacccacca ccccgtctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct      1740
     accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact caggacactg      1800
     agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca gctgtggtgg      1860
     tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg ctgccgaagc      1920
     ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc tcagggaaag      1980
     caggagccct tctggagccc ttcagcaggg tcagggcccc tcgtcttccc ctcctttccc      2040
     agagccatct tcccagtcca ccatccccat cgtgggcatt gttgctggcc tggctgtcct      2100
     agcagttgtg gtcatcggag ctgtggtcgc tactgtgatg tgtaggagga agagctcagg      2160
     tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt ttcaagcccc      2220
     aggtagaagt gttccctgcc tcattactgg gaagcagcat ccacacaggg gctaacgcag      2280
     cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca atgaaggacg      2340
     gatgtatcac cttgatggtt gtggtgttgg ggtcctgatt tcagcattca tgagtcaggg      2400
     gaaggtccct gctaaggaca gaccttagga gggcagttgg tccaggaccc acacttgctt      2460
     tcctcgtgtt tcctgatcct gccttgggtc tgtagtcata cttctggaaa ttccttttgg      2520
     gtccaagacg aggaggttcc tctaagatct catggccctg cttcctccca gtcccctcac      2580
     aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg cgtgtaagtg      2640
     gtgggggtgg gagtgtggag gagctcaccc accccataat tcctcctgtc ccacgtctcc      2700
     tgcgggctct gaccaggtcc tgtttttgtt ctactccagc cagcgacagt gcccagggct      2760
     ctgatgtgtc tctcacagct tgaaaaggtg agattcttgg ggtcta                     2806
//


spacer
spacer