spacer

EBI Dbfetch

ID   FR675937; SV 1; linear; genomic DNA; STD; HUM; 2800 BP.
XX
AC   FR675937;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*40, clone
DE   D10002870, exons 1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2800
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; f889007857633aee1ffcdf1fc924ca96.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2800
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10002870"
FT                   /db_xref="taxon:9606"
FT   CDS             join(20..92,221..490,736..1011,1586..1861,1955..2071,
FT                   2513..2545,2652..2695)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB13"
FT                   /db_xref="IMGT/HLA:B*40:150"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB13"
FT                   /protein_id="CBW44125.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPVEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            20..92
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=1
FT   intron          93..220
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=1
FT   exon            221..490
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
FT   intron          491..735
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=2
FT   exon            736..1011
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=3
FT   intron          1012..1585
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=3
FT   exon            1586..1861
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=4
FT   intron          1862..1954
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=4
FT   exon            1955..2071
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=5
FT   intron          2072..2512
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=5
FT   exon            2513..2545
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=6
FT   intron          2546..2651
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=6
FT   exon            2652..2695
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40"
FT                   /number=7
XX
SQ   Sequence 2800 BP; 522 A; 808 C; 906 G; 564 T; 0 other;
     aatctcctca gacgccgaga tgcgggtcac ggcaccccga accgtcctcc tgctgctctc        60
     ggcggccctg gccctgaccg agacctgggc cggtgagtgc gggtcggcag ggaaatggcc       120
     tctgtgggga ggagcgaggg gaccgcaggc gggggcgcag gacccgggga gccgcgccgg       180
     gaggagggtc gggcgggtct cagctcctcc tcgcccccag gctcccactc catgaggtat       240
     ttccacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcac cgtgggctac       300
     gtggacgaca cgctgttcgt gaggttcgac agcgacgcca cgagtccgag gaaggagccg       360
     cgggcgccat ggatagagca ggaggggccg gagtattggg accgggagac acagatctcc       420
     aagaccaaca cacagactta ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag       480
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       540
     acggcccggg tcgccccgag tctccgggtc cgagatccga ccccctgagg ccgcgggacc       600
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       660
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggact gggctgaccg       720
     cggggccggg gccagggtct cacaccctcc agaggatgta cggctgcgac gtggggccgg       780
     acgggcgcct cctccgcggg cataaccagt acgcctacga cggcaaggat tacatcgccc       840
     tgaacgagga cctgcgctcc tggaccgccg cggacacggc ggctcagatc tcccagcgca       900
     agttggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc gagtgcgtgg       960
     agtggctccg cagatacctg gagaacggga aggacaagct ggagcgcgct ggtaccaggg      1020
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1080
     gaggaaaatg ggatcagcgc tagaatgtcg ccctccgttg aatggagaat ggcatgagtt      1140
     ttcctgagtt tcctctgagg gccccctctt ctctctagac aattaaggaa tgacgtctct      1200
     gaggaaatgg aggggaagac agtccctaga atactgatca ggggtcccct ttgacccctg      1260
     cagcagcctt gggaaccgtg acttttcctc tcaggccttg ttctctgcct cacactcagt      1320
     gtgtttgggg ctctgattcc agcacttctg agtcacttta cctccactca gatcaggagc      1380
     agaagtccct gttccccgct cagagactcg aactttccaa tgaataggag attatcccag      1440
     gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt      1500
     ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgaaagat gcaaagcgcc      1560
     tgaattttct gactcttccc atcagacccc ccaaagacac acgtgaccca ccaccccatc      1620
     tctgaccatg aggccaccct gaggtgctgg gccctgggtt tctaccctgt ggagatcaca      1680
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ctgagcttgt ggagaccaga      1740
     ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaagag      1800
     cagagataca catgccatgt acagcatgag gggctgccga agcccctcac cctgagatgg      1860
     ggtaaggagg gggatgaggg gtcatatctc ttctcaggga aagcaggagc ccttcagcag      1920
     ggtcagggcc cctcatcttc ccctcctttc ccagagccgt cttcccagtc caccgtcccc      1980
     atcgtgggca ttgttgctgg cctggctgtc ctagcagttg tggtcatcgg agctgtggtc      2040
     gctgctgtga tgtgtaggag gaagagttca ggtagggaag gggtgagggg tggggtctgg      2100
     gttttcttgt cccactgggg gtttcaagcc ccaggtagaa gtgttccctg cctcattact      2160
     gggaagcagc atgcacacag gggctaacgc agcctgggac cctgtgtgcc agcacttact      2220
     cttttgtgca gcacatgtga caatgaagga tggatgtatc accttgatgg ttgtggtgtt      2280
     ggggtcctga ttccagcatt catgagtcag gggaaggtcc ctgctaagga cagaccttag      2340
     gagggcagtt ggtccaggac ccacacttgc tttcctcgtg tttcctgatc ctgccctggg      2400
     tctgtagtca tacttctgga aattcctttt gggtccaaga ctaggaggtt cctctaagat      2460
     ctcatggccc tgcttcctcc cagtgccctc acaggacatt ttcttcccac aggtggaaaa      2520
     ggagggagct actctcaggc tgcgtgtaag tggtgggggt gggagtgtgg aggagctcac      2580
     ccaccccata attcctcctg tcccacgtct cctgcgggct ctgaccaggt cctgtttttg      2640
     ttctactcca ggcagcgaca gtgcccaggg ctctgatgtg tctctcacag cttgaaaagg      2700
     tgagattctt ggggtctaga gtgggtgggg tggcgggtct gggggtgggt ggggcagagg      2760
     ggaaaggcct gggtaatggg gattctttga ttgggatgtt                            2800
//


spacer
spacer