spacer

EBI Dbfetch

ID   FR675936; SV 1; linear; genomic DNA; STD; HUM; 2980 BP.
XX
AC   FR675936;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*55, clone
DE   D10006015, exons 1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2980
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; b8cd7ebdabaea8025fe0b0308b1c500f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2980
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006015"
FT                   /db_xref="taxon:9606"
FT   CDS             join(234..306,435..704,950..1225,1801..2076,2181..2297,
FT                   2739..2771,2878..2921)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB12"
FT                   /db_xref="IMGT/HLA:B*55:48"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB12"
FT                   /protein_id="CBW44124.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSRTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            234..306
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=1
FT   intron          307..434
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=1
FT   exon            435..704
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=2
FT   intron          705..949
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=2
FT   exon            950..1225
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=3
FT   intron          1226..1800
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=3
FT   exon            1801..2076
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=4
FT   intron          2077..2180
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=4
FT   exon            2181..2297
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=5
FT   intron          2298..2738
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=5
FT   exon            2739..2771
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=6
FT   intron          2772..2877
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=6
FT   exon            2878..2921
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /number=7
XX
SQ   Sequence 2980 BP; 548 A; 881 C; 954 G; 597 T; 0 other;
     cgagggccgc gtctgcattg gggaggcgca gcgttgggga ttccccactc ccacgagttt        60
     cacttcttct cccaacctat gtcgggtcct tcttccagga tactcgtgac gcgtccccat       120
     ttcccactcc cattgggtgt cgggtgtcta gagaagccaa tcagtgtcgc cggggtccca       180
     gttctaaagt ccccacgcac ccacccggac tcagagtctc ctcagacacc gagatgcggg       240
     tcacggcacc ccgaaccctc ctcctgctgc tctggggggc cctggccctg accgagacct       300
     gggccggtga gtgcgggtcg ggagggaaat ggcctctgtg gggaggagcg aggggaccgc       360
     aggcgggggc gcaggacccg gggagccgcg ccgggaggag ggtctggcgg gtctcagccc       420
     ctcctcgccc ccaggctccc actccatgag gtatttctac accgccatgt cccggcccgg       480
     ccgcggggag ccccgcttca tcgcagtggg ctacgtggac gacacgcagt tcgtgaggtt       540
     cgacagcgac gccgcgagtc cgagagagga gccgcgggcg ccgtggatag agcaggaggg       600
     gccggagtat tgggaccgga acacacagat ctacaaggcc caggcacaga ctgaccgaga       660
     gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccggcc       720
     cggggcgcag gtcacgactc cccatccccc acgtacggcc cgggtcgccc cgagtctccg       780
     ggtccgagat ccgcctccct gaggccgcgg gacccgccca gaccctcgac cggcgagagc       840
     cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc gggttggtcg       900
     gggcggggcg gggctcgggg gacggggctg accgcggggc cggggccagg gtctcacact       960
     tggcagacga tgtatggctg cgacctgggg ccggacgggc gcctcctccg cgggcataac      1020
     cagttagcct acgacggcaa ggattacatc gccctgaacg aggacctgag ctcccggacc      1080
     gcggcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag      1140
     cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac      1200
     gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc cccatctcct      1260
     ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca gcgctagaat      1320
     gtcgccctcc cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc      1380
     tcttctctct aggacaatta agggatgacg tctctgagga aatggagggg aagacagtcc      1440
     ctagaatact gatcaggggt cctctttgac ccctgcagca gccttgggaa ccgtgacttt      1500
     tcctctcagg ccttgttctc tgcctcacac tcagtgtgtt tggggctctg attccagcac      1560
     ttctgagtca ctttacctcc actcagatca ggagcagaag tccctgttcc ccgctcagag      1620
     actcgaactt tccaatgaat aggagattat cccaggtgcc tgcgtccagg ctggtgtctg      1680
     ggttctgtgc cccttcccca ccccaggtgt cctgtccatt ctcaggctgg tcacatgggt      1740
     ggtcctaggg tgtcctatga gagatgcaaa gcgcctgaat tttctgactc ttcccatcag      1800
     accccccaaa gacacacgtg acccaccacc ccatctctga ccatgaggcc accctgaggt      1860
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg      1920
     accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga accttccaga      1980
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc      2040
     atgaggggct gccgaagccc ctcaccctga gatggggtaa ggagggggat gaggggtcat      2100
     atctcttctc agggaaagca ggagcccttc tggagccctt cagcagggtc agggcccctc      2160
     gtcttcccct cctttcccag agccatcttc ccagtccacc atccccatcg tgggcattgt      2220
     tgctggcctg gctgtcctag cagttgtggt catcggagct gtggtcgcta ctgtgatgtg      2280
     taggaggaag agctcaggta gggaaggggt gaggggtggg gtctgggttt tcttgtccca      2340
     ctgggggttt caagccccag gtagaagtgt tccctgcctc attactggga agcagcatcc      2400
     acacaggggc taatgcagcc tgggaccctg tgtgccagca cttactcttt tgtgcagcac      2460
     atgtgacaat gaaggacgga tgtatcacct tgatggttgt ggtgttgggg tcctgatttc      2520
     agcattcatg agtcagggga aggtccctgc taaggacaga ccttaggagg gcagttggtc      2580
     caggacccac acttgctttc ctcgtgtttc ctgatcctgc cttgggtctg tagtcatact      2640
     tctggaaatt ccttttgggt ccaagacgag gaggttcctc taagatctca tggccctgct      2700
     tcctcccagt cccctcacag gacattttct tcccacaggt ggaaaaggag ggagctactc      2760
     tcaggctgcg tgtaagtggt gggggtggga gtgtggagga gctcacccac cccataattc      2820
     ctcctgtccc acgtctcctg cgggctctga ccaggtcctg tttttgttct actccagcca      2880
     gcgacagtgc ccagggctct gatgtgtctc tcacagcttg aaaaggtgag attcttgggg      2940
     tctagagtgg gcgggggggg gtggggtggg gagggggcag                            2980
//


spacer
spacer