Dbfetch

ID   FR675935; SV 1; linear; genomic DNA; STD; HUM; 3184 BP.
XX
AC   FR675935;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*11, clone
DE   D10006939, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3184
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 9975bcb416ee87f54025f71692bbc1ce.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3184
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006939"
FT                   /db_xref="taxon:9606"
FT   CDS             join(72..144,275..544,786..1061,1641..1916,2024..2140,
FT                   2578..2610,2753..2800,2970..2974)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB11"
FT                   /db_xref="IMGT/HLA:A*11:75"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB11"
FT                   /protein_id="CBW44123.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFNSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWVFPAHHPHRGHHCWPGSPWSCDHWSCGRCRDVEEEELRWNRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            72..144
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   intron          145..274
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   exon            275..544
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   intron          545..785
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   exon            786..1061
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   intron          1062..1640
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   exon            1641..1916
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   intron          1917..2023
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   exon            2024..2140
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   intron          2141..2577
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   exon            2578..2610
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   intron          2611..2752
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   exon            2753..2800
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   intron          2801..2969
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   exon            2970..2974
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=8
XX
SQ   Sequence 3184 BP; 611 A; 919 C; 979 G; 675 T; 0 other;
     gtgtcttcgc ggtcgctctt ctaaagtccg cacgcaccca ccgggactca gattctcccc        60
     agaccccgag gatggccgtc atggcgcccc gaaccctcct cctgctactc tcgggggccc       120
     tggccctgac ccagacctgg gcgggtgagt gcggggtcgg gagggaaacc gcctctgcgg       180
     ggagaagcaa ggggccctcc tggcgggggc gcaggaccgg gggagccgcg ccgggaggag       240
     ggtcgggcag gtctcagcca ctgctcgccc ccaggctccc actccatgag gtatttctac       300
     acctccgtgt cccggcccgg ccgcggggag ccccgcttca tcgccgtggg ctacgtggac       360
     gacacgcagt tcgtgcggtt caacagcgac gccgcgagcc agaggatgga gccgcgggcg       420
     ccgtggatag agcaggaggg gccggagtat tgggaccagg agacacggaa tgtgaaggcc       480
     cagtcacaga ctgaccgagt ggacctgggg accctgcgcg gctactacaa ccagagcgag       540
     gacggtgagt gaccccggcc cggggcgcag gtcacgaccc ctcatccccc acggacgggc       600
     caggtggccc acagtctccg ggtccgagat ccaccccgaa gccgcgggac cccgagaccc       660
     ttgccccggg agaggcccag gcgcctttac ccggtttcat tttcagttta ggccaaaaat       720
     ccccccgggt tggtcggggc cgggcagggc ttgggggact gggctgaccg cggggtcggg       780
     gccaggttct cacaccatcc agataatgta tggctgcgac gtggggccgg acgggcgctt       840
     cctccgcggg taccggcagg acgcctacga cggcaaggat tacatcgccc tgaacgagga       900
     cctgcgctct tggaccgcgg cggacatggc agctcagatc accaagcgca agtgggaggc       960
     ggcccatgcg gcggagcagc agagagccta cctggagggc cggtgcgtgg agtggctccg      1020
     cagatacctg gagaacggga aggagacgct gcagcgcacg ggtaccaggg gccacggggc      1080
     gcctccctga tcgcctatag atctcccggg ctggcctccc acaaggaggg gagacaattg      1140
     ggaccaacac tagaatatca ccctccctct ggtcctgagg gagaggaatc ctcctgggtt      1200
     tccagatcct gtaccagaga gtgactctga ggttccgccc tgctctctga cacaattaag      1260
     ggataaaatc tctgaaggag tgacgggaag acgatccctc gaatactgat gagtggttcc      1320
     ctttgacacc ggcagcagcc ttgggcccgt gacttttcct ctcaggcctt gttctctgct      1380
     tcacactcaa tgtgtgtggg ggtctgagtc cagcacttct gagtctctca gcctccactc      1440
     aggtcaggac cagaagtcgc tgttcccttc tcagggaata gaagattatc ccaggtgcct      1500
     gtgtccaggc tggtgtctgg gttctgtgct ctcttcccca tcccgggtgt cctgtccatt      1560
     ctcaagatgg ccacatgcgt gctggtggag tgtcccatga cagatgcaaa atgcctgaat      1620
     tttctgactc ttcccgtcag acccccccaa gacacatatg acccaccacc ccatctctga      1680
     ccatgaggcc accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac      1740
     ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga ccaggcctgc      1800
     aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggag aggagcagag      1860
     atacacctgc catgtgcagc atgagggtct gcccaagccc ctcaccctga gatggggtaa      1920
     ggagggagat gggggtgtca tgtctcttag ggaaagcagg agcctctctg gagaccttta      1980
     gcagggtcag ggcccctcac cttcccctct tttcccagag ctgtcttccc agcccaccat      2040
     ccccatcgtg ggcatcattg ctggcctggt tctccttgga gctgtgatca ctggagctgt      2100
     ggtcgctgcc gtgatgtgga ggaggaagag ctcaggtgga gaaggggtga aaggtggggt      2160
     ctgagatttc ttgtctcact gagggttcca agccccagct agaaatgtgc cctgtctcat      2220
     tactgggaag caccttccac aatcatgggc cgacccagcc tgggccctgt gtgccagcac      2280
     ttactctttt gtaaagcacc tgttaaaatg aaggacagat ttatcacctt gattacggcg      2340
     gtgatgggac ctgataccag cagtcacaag tcacagggga aggtccctga ggacagacct      2400
     caggagggct attggtccag gacccacacc tgctttcttc atgtttcctg atcccgccct      2460
     gggtctgcag tcacacattt ctggaaactt ctctggggtc caagactagg aggttcctct      2520
     aggaccttaa ggccctggct cctttctggt atctcacagg acattttctt cccacagata      2580
     gaaaaggagg gagttacact caggctgcaa gtaagtatga aggaggctga tgcctgaggt      2640
     ccttgggata ttgtgtttgg gagcccatgg gggagctcac ccaccccaca attcctcctc      2700
     tagccacatc ttctgtggga tctgaccagg ttctgttttt gttctacccc aggcagtgac      2760
     agtgcccagg gctctgatgt gtctctcaca gcttgtaaag gtgagagctt ggagggcctg      2820
     atgtgtgttg ggtgttgggc ggaacagtgg acacagctgt gctatggggt ttctttgcat      2880
     tggatgtatt gagcatgcga tgggctgttt aaggtgtgac ccctcactgt gatggatatg      2940
     aatttgttca tgaatatttt tttctatagt gtgagacagc tgccttgtgt gggactgaga      3000
     ggcaagagtt gttcctgccc ttccctttgt gacttgaaga accctgactt tgtttctgca      3060
     aaggcacctg catgtgtctg tgttcgtgta ggcataatgt gaggaggtgg ggagaccacc      3120
     ccaccccgat gtccaccatg accctcttcc cacgctgacc tgtgctccct ctccaatcat      3180
     cttt                                                                   3184
//