spacer

EBI Dbfetch

ID   FR675934; SV 1; linear; genomic DNA; STD; HUM; 3227 BP.
XX
AC   FR675934;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*11, clone
DE   D10004069, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3227
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 057f5c85ad1f09e82b0f04bbc54f9283.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3227
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10004069"
FT                   /db_xref="taxon:9606"
FT   CDS             join(118..190,321..590,832..1107,1687..1962,2065..2181,
FT                   2624..2656,2799..2846,3016..3020)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB10"
FT                   /db_xref="IMGT/HLA:A*11:74"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB10"
FT                   /protein_id="CBW44122.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYISVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            118..190
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   intron          191..320
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   exon            321..590
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   intron          591..831
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   exon            832..1107
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   intron          1108..1686
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   exon            1687..1962
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   intron          1963..2064
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   exon            2065..2181
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   intron          2182..2623
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   exon            2624..2656
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   intron          2657..2798
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   exon            2799..2846
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   intron          2847..3015
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   exon            3016..3020
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=8
XX
SQ   Sequence 3227 BP; 620 A; 931 C; 991 G; 685 T; 0 other;
     cagttctcac tcccattggg tgtcgggttt ccagagaagc caatcagtgt cttcgcggtc        60
     gctcttctaa agtccgcacg cacccaccgg gactcagatt ctccccagac cccgaggatg       120
     gccgtcatgg cgccccgaac cctcctcctg ctactctcgg gggccctggc cctgacccag       180
     acctgggcgg gtgagtgcgg ggtcgggagg gaaaccgcct ctgcggggag aagcaagggg       240
     ccctcctggc gggggcgcag gaccggggga gccgcgccgg gaggagggtc gggcaggtct       300
     cagccactgc tcgcccccag gctcccactc catgaggtat ttctacatct ccgtgtcccg       360
     gcccggccgc ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt       420
     gcggttcgac agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca       480
     ggaggggccg gagtattggg accaggagac acggaatgtg aaggcccagt cacagactga       540
     ccgagtggac ctggggaccc tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc       600
     ccggcccggg gcgcaggtca cgacccctca tcccccacgg acgggccagg tggcccacag       660
     tctccgggtc cgagatccac cccgaagccg cgggaccccg agacccttgc cccgggagag       720
     gcccaggcgc ctttacccgg tttcattttc agtttaggcc aaaaatcccc ccgggttggt       780
     cggggccggg cagggcttgg gggactgggc tgaccgcggg gtcggggcca ggttctcaca       840
     ccatccagat aatgtatggc tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc       900
     ggcaggacgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcttgga       960
     ccgcggcgga catggcagct cagatcacca agcgcaagtg ggaggcggcc catgcggcgg      1020
     agcagcagag agcctacctg gagggccggt gcgtggagtg gctccgcaga tacctggaga      1080
     acgggaagga gacgctgcag cgcacgggta ccaggggcca cggggcgcct ccctgatcgc      1140
     ctatagatct cccgggctgg cctcccacaa ggaggggaga caattgggac caacactaga      1200
     atatcaccct ccctctggtc ctgagggaga ggaatcctcc tgggtttcca gatcctgtac      1260
     cagagagtga ctctgaggtt ccgccctgct ctctgacaca attaagggat aaaatctctg      1320
     aaggagtgac gggaagacga tccctcgaat actgatgagt ggttcccttt gacaccggca      1380
     gcagccttgg gcccgtgact tttcctctca ggccttgttc tctgcttcac actcaatgtg      1440
     tgtgggggtc tgagtccagc acttctgagt ctctcagcct ccactcaggt caggaccaga      1500
     agtcgctgtt cccttctcag ggaatagaag attatcccag gtgcctgtgt ccaggctggt      1560
     gtctgggttc tgtgctctct tccccatccc gggtgtcctg tccattctca agatggccac      1620
     atgcgtgctg gtggagtgtc ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc      1680
     cgtcagaccc ccccaagaca catatgaccc accaccccat ctctgaccat gaggccaccc      1740
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1800
     gggaggacca gacccaggac acggagctcg tggagaccag gcctgcaggg gatggaacct      1860
     tccagaagtg ggcggctgtg gtggtgcctt ctggagagga gcagagatac acctgccatg      1920
     tgcagcatga gggtctgccc aagcccctca ccctgagatg gggtaaggag ggagatgggg      1980
     gtgtcatgtc tcttagggaa agcaggagcc tctctggaga cctttagcag ggtcagggcc      2040
     cctcaccttc ccctcttttc ccagagctgt cttcccagcc caccatcccc atcgtgggca      2100
     tcattgctgg cctggttctc cttggagctg tgatcactgg agctgtggtc gctgccgtga      2160
     tgtggaggag gaagagctca ggtggagaag gggtgaaagg tggggtctga gatttcttgt      2220
     ctcactgagg gttccaagcc ccagctagaa atgtgccctg tctcattact gggaagcacc      2280
     ttccacaatc atgggccgac ccagcctggg ccctgtgtgc cagcacttac tcttttgtaa      2340
     agcacctgtt aaaatgaagg acagatttat caccttgatt acggcggtga tgggacctga      2400
     taccagcagt cacaagtcac aggggaaggt ccctgaggac agacctcagg agggctattg      2460
     gtccaggacc cacacctgct ttcttcatgt ttcctgatcc cgccctgggt ctgcagtcac      2520
     acatttctgg aaacttctct ggggtccaag actaggaggt tcctctagga ccttaaggcc      2580
     ctggctcctt tctggtatct cacaggacat tttcttccca cagatagaaa aggagggagt      2640
     tacactcagg ctgcaagtaa gtatgaagga ggctgatgcc tgaggtcctt gggatattgt      2700
     gtttgggagc ccatggggga gctcacccac cccacaattc ctcctctagc cacatcttct      2760
     gtgggatctg accaggttct gtttttgttc taccccaggc agtgacagtg cccagggctc      2820
     tgatgtgtct ctcacagctt gtaaaggtga gagcttggag ggcctgatgt gtgttgggtg      2880
     ttgggcggaa cagtggacac agctgtgcta tggggtttct ttgcattgga tgtattgagc      2940
     atgcgatggg ctgtttaagg tgtgacccct cactgtgatg gatatgaatt tgttcatgaa      3000
     tatttttttc tatagtgtga gacagctgcc ttgtgtggga ctgagaggca agagttgttc      3060
     ctgcccttcc ctttgtgact tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg      3120
     tgtctgtgtt cgtgtaggca taatgtgagg aggtggggag accaccccac cccgatgtcc      3180
     accatgaccc tcttcccacg ctgacctgtg ctccctctcc aatcatc                    3227
//


spacer
spacer