spacer

EBI Dbfetch

ID   FR675933; SV 1; linear; genomic DNA; STD; HUM; 3103 BP.
XX
AC   FR675933;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*02, clone
DE   D10003602, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3103
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 0aef01822ccf2bada1e9a2ce8c771711.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3103
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10003602"
FT                   /db_xref="taxon:9606"
FT   CDS             join(63..135,266..535,777..1052,1653..1928,2028..2144,
FT                   2583..2615,2758..2805,2975..2979)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB09"
FT                   /db_xref="IMGT/HLA:A*02:279"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB09"
FT                   /protein_id="CBW44121.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGPDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            63..135
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=1
FT   intron          136..265
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=1
FT   exon            266..535
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=2
FT   intron          536..776
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=2
FT   exon            777..1052
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=3
FT   intron          1053..1652
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=3
FT   exon            1653..1928
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=4
FT   intron          1929..2027
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=4
FT   exon            2028..2144
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=5
FT   intron          2145..2582
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=5
FT   exon            2583..2615
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=6
FT   intron          2616..2757
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=6
FT   exon            2758..2805
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=7
FT   intron          2806..2974
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=7
FT   exon            2975..2979
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02"
FT                   /number=8
XX
SQ   Sequence 3103 BP; 602 A; 881 C; 962 G; 658 T; 0 other;
     cggtcgcggt tctaaagtcc gcacgcaccc accgggactc agattctccc cagacgccga        60
     ggatggccgt catggcgccc cgaaccctcg tcctgctact ctcgggggct ctggccctga       120
     cccagacctg ggcgggtgag tgcggggtcg ggagggaaac ggcctctgtg gggagaagca       180
     acgggcccgc ctggcggggg cgcaggaccc gggaagccgc gccgggagga gggtcgggcg       240
     ggtctcagcc actcctcgtc cccaggctct cactccatga ggtatttctt cacatccgtg       300
     tcccggcccg gccgcgggga gccccgcttc atcgcagtgg gctacgtgga cgacacgcag       360
     ttcgtgcggt tcgacagcga cgccgcgagc cagaggatgg agccgcgggc gccgtggata       420
     gagcaggagg gtccggagta ttgggacggg gagacacgga aagtgaaggc ccactcacag       480
     actcaccgag tggacctggg gaccctgcgc ggctactaca accagagcga ggccggtgag       540
     tgaccccggc ccggggcgca ggtcacgacc tctcatcccc cacggacggg ccaggtcgcc       600
     cacagtctcc gggtccgaga tccgccccga agccgcggga ccccgagacc cttgccccgg       660
     gagaggccca ggcgccttta cccggtttca ttttcagttt aggccaaaaa tccccccagg       720
     ttggtcgggg cggggcgggg ctcgggggac cgggctgacc gcggggtccg ggccaggttc       780
     tcacaccgtc cagaggatgt atggctgcga cgtggggccg gacgggcgct tcctccgcgg       840
     gtaccggcag gacgcctacg acggcaagga ttacatcgcc ctgaaagagg acctgcgctc       900
     ttggaccgcg gcggacatgg cagctcagac caccaagcac aagtgggagg cggcccatgt       960
     ggcggagcag ttgagagcct acctggaggg cacgtgcgtg gagtggctcc gcagatacct      1020
     ggagaacggg aaggagacgc tgcagcgcac gggtaccagg ggccacgggg cgcctccctg      1080
     atcgcctgta gatctcccgg gctggcctcc cacaaggagg ggagacaatt gggaccaaca      1140
     ctagaatatc gccctccctc tggtcctgag ggagaggaat cctcctgggt ttccagatcc      1200
     tgtaccagag agtgactctg aggttccgcc ctgctctctg acacaattaa gggataaaat      1260
     ctctgaagga atgacgggaa gacgatccct cgaatactga tgagtggttc cctttgacac      1320
     acacaggcag cagccttggg cccgtgactt ttcctctcag gccttgttct ctgcttcaca      1380
     ctcaatgtgt gtgggggtct gagtccagca cttctgagtc cttcagcctc cactcaggtc      1440
     aggaccagaa gtcgctgttc cctcttcagg gactagaatt ttccacggaa taggagatta      1500
     tcccaggtgc ctgtgtccag gctggtgtct gggttctgtg ctcccttccc catcccaggt      1560
     gtcctgtcca ttctcaagat agccacatgt gtgctggagg agtgtcccat gacagatgca      1620
     aaatgcctga atgatctgac tcttcctgac agacgccccc aaaacgcata tgactcacca      1680
     cgctgtctct gaccatgaag ccaccctgag gtgctgggcc ctgagcttct accctgcgga      1740
     gatcacactg acctggcagc gggatgggga ggaccagacc caggacacgg agctcgtgga      1800
     gaccaggcct gcaggggatg gaaccttcca gaagtgggcg gctgtggtgg tgccttctgg      1860
     acaggagcag agatacacct gccatgtgca gcatgagggt ttgcccaagc ccctcaccct      1920
     gagatggggt aaggagggag acgggggtgt catgtctttt agggaaagca ggagcctctc      1980
     tgacctttag cagggtcagg gcccctcacc ttcccctctt ttcccagagc cgtcttccca      2040
     gcccaccatc cccatcgtgg gcatcattgc tggcctggtt ctctttggag ctgtgatcac      2100
     tggagctgtg gtcgctgctg tgatgtggag gaggaagagc tcaggtgggg aaggggtgaa      2160
     gggtgggtct gagatttctt gtctcactga gggttccaag acccaggtag aagtgtgccc      2220
     tgcctcgtta ctgggaagca ccacccacaa ttatgggcct acccagcctg ggccctgtgt      2280
     gccagcactt actcttttgt aaagcacctg ttaaaatgaa ggacagattt atcaccttga      2340
     ttacagcggt gatgggacct gatcccagca gtcacaagtc acaggggaag gtccctgagg      2400
     accttcagga gggcggttgg tccaggaccc acacctgctt tcttcatgtt tcctgatccc      2460
     gccctgggtc tgcagtcaca catttctgga aacttctctg aggtccaaga cttggaggtt      2520
     cctctaggac cttaaggccc tgactccttt ctggtatctc acaggacatt ttcttcccac      2580
     agatagaaaa ggagggagct actctcaggc tgcaagtaag tatgaaggag gctgatgcct      2640
     gaggtccttg ggatattgtg tttgggagcc catgggggag ctcacccacc ccacaattcc      2700
     tcctctagcc acatcttctg tgggatctga ccaggttctg tttttgttct accccaggca      2760
     gtgacagtgc ccagggctct gatgtgtctc tcacagcttg taaaggtgag agcctggagg      2820
     gcctgatgtg tgttgggtgt tgggcggaac agtggacaca gctgtgctat ggggtttctt      2880
     tccattggat gtattgagca tgcgatgggc tgtttaaagt gtgacccctc actgtgacag      2940
     atacgaattt gttcatgaat atttttttct atagtgtgag acagctgcct tgtgtgggac      3000
     tgagaggcaa gagttgttcc tgcccttccc tttgtgactt gaagaaccct gactttgttt      3060
     ctgcaaaggc acctgcatgt gtctgtgttc gtgtaggcat aat                        3103
//


spacer
spacer