spacer

EBI Dbfetch

ID   FR675932; SV 1; linear; genomic DNA; STD; HUM; 3176 BP.
XX
AC   FR675932;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*24, clone
DE   D1004116, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3176
RA   Qu J.;
RT   ;
RL   Submitted (03-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3176
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D1004116"
FT                   /db_xref="taxon:9606"
FT   CDS             join(49..121,252..521,763..1038,1618..1893,1996..2112,
FT                   2555..2587,2730..2777,2946..2950)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB08"
FT                   /db_xref="IMGT/HLA:A*24:152"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB08"
FT                   /protein_id="CBW44120.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPC
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            49..121
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=1
FT   intron          122..251
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=1
FT   exon            252..521
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=2
FT   intron          522..762
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=2
FT   exon            763..1038
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=3
FT   intron          1039..1617
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=3
FT   exon            1618..1893
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=4
FT   intron          1894..1995
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=4
FT   exon            1996..2112
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=5
FT   intron          2113..2554
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=5
FT   exon            2555..2587
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=6
FT   intron          2588..2729
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=6
FT   exon            2730..2777
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=7
FT   intron          2778..2945
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=7
FT   exon            2946..2950
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24"
FT                   /number=8
XX
SQ   Sequence 3176 BP; 617 A; 918 C; 972 G; 669 T; 0 other;
     aagtccgcac gcacccaccg ggactcagat tctccccaga cgccgaggat ggccgtcatg        60
     gcgccccgaa ccctcgtcct gctactctcg ggggccctgg ccctgaccca gacctgggca       120
     ggtgagtgcg gggtcgggag ggaaacggcc tctgcgggga gaagcaaggg gcccgcctgg       180
     cgggggcgca agacccggga agccgcgccg ggaggagggt cgggcgggtc tcagccactc       240
     ctcgtcccca ggctcccact ccatgaggta tttctccaca tccgtgtccc ggcccggccg       300
     cggggagccc tgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga       360
     cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc       420
     ggagtattgg gacgaggaga cagggaaagt gaaggcccac tcacagactg accgagagaa       480
     cctgcggatc gcgctccgct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       540
     ggcgcaggtc acgacccctc atcccccacg gacgggccgg gtcgcccaca gtctccgggt       600
     ccgagatcca ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg       660
     ccttaacccg gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggccgg       720
     gcggggctcg ggggactggg ctgaccgcgg ggtcggggcc aggttctcac accctccaga       780
     tgatgtttgg ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac caccagtacg       840
     cctacgacgg caaggattac atcgccctga aagaggacct gcgctcttgg accgcggcgg       900
     acatggcggc tcagatcacc aagcgcaagt gggaggcggc ccatgtggcg gagcagcaga       960
     gagcctacct ggagggcacg tgcgtggacg ggctccgcag atacctggag aacgggaagg      1020
     agacgctgca gcgcacgggt accaggggcc acggggcgcc tacctgatcg cctgtaggtc      1080
     tcccgggctg gcctcccaca aggaggggag acaattggga ccaacactag aatatcgccc      1140
     tccctctggt cctgagggag aggaatcctc ctgggtttcc agatcctgta ccagagagtg      1200
     actctgaggt tccgccctgc tctctgacac aattaaggga taaaatctct gacggaatga      1260
     cggaaagacg atccctcgaa tactgatgac tggttccctt tgacaccggc agcagccttg      1320
     ggaccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt      1380
     ctgagtccag cacttctgag tccctcagcc tccactcagg tcaggaccag aagtcgctgt      1440
     tccctcctca gggaatagaa gattatccca ggtgcctgtg tccaggctgg tgtctgggtt      1500
     ctgtgctctc ttccccatcc cgggtgtcct gtccattctc aagatggcca catgcatgct      1560
     ggtggagtgt cccatgacag atgcaaaatg cctgaatttt ctgactcttc ccgtcagacc      1620
     cccccaagac acatatgacc caccacccca tctctgacca tgaggccact ctgagatgct      1680
     gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc      1740
     agacccagga cacggagctt gtggagacca ggcctgcagg ggatggaacc ttccagaagt      1800
     gggcagctgt ggtggtacct tctggagagg agcagagata cacctgccat gtgcagcatg      1860
     agggtctgcc caagcccctc accctgagat ggggtaagga gggagatggg ggtgtcatgt      1920
     ctcttaggga aagcaggagc ctctctggag acctttagca gggtcagggc ccctcacctt      1980
     cccctctttt cccagagcca tcttcccagc ccaccgtccc catcgtgggc atcattgctg      2040
     gcctggttct ccttggagct gtgatcactg gagctgtggt cgctgctgtg atgtggagga      2100
     ggaacagctc aggtggagaa ggggtgaagg gtggggtctg agatttcttg tctcactgag      2160
     ggttccaagc cccagctaga aatgtgccct gtctcattac tgggaagcac catccacaat      2220
     catgggccga cccagcctgg gccctgtgtg ccagcactta ctcttttgta aagcacctgt      2280
     gacaatgaag gacagattta tcaccttgat tatggcggtg atgggacctg atcccagcag      2340
     tcacaagtca caggggaagg tccctgacga cagatctcag gagggcgatt ggtccagggc      2400
     ccacatctgc tttcttcatg tttcctgatc ctgccctggg tctgcagtca cacatttctg      2460
     gaaacttctc tggggtccaa gactaggagg ttcctctagg accttaaggc cctggctcct      2520
     ttctggtatc tcacaggaca ttttcttccc acagatagaa aaggagggag ctactctcag      2580
     gctgcaagta agtatgaagg aggctgatgc ctgaggtcct tgggatattg tgtttgggag      2640
     cccatggggg agctcaacca ccccacaatt cctcctctag ccacatcttc tgtgggatct      2700
     gaccaggttc tgtttttgtt ctaccccagg cagtgacagt gcccagggct ctgatgtgtc      2760
     tctcacagct tgtaaaggtg agagcttgga gggcctgatg tgtgttgggt gttgggcgga      2820
     acagtggaca cagctgtgct atggggtttc tttgcattgg atgtattgag catgcgatgg      2880
     gctgtttaaa gtgtgacccc tcactgtgac agatatgaag ttgttcatga attttttttc      2940
     tatagtgtga gacagctgcc ttgtgtggga ctgagaggca agagttgttc ctgcccttcc      3000
     ctttgtgact tgaagaaccc tgactttgtt tctgcaaagg cacctgcatg tgtctgtgtt      3060
     catgtaggca taatgtgagg aggtggggag accaccccac ccccatgtcc accatgaccc      3120
     tcttcccacg ctgacctgtg ctccctcccc aatcatcttt cctgttgcag agaggt          3176
//


spacer
spacer