spacer

EBI Dbfetch

ID   FR675931; SV 1; linear; genomic DNA; STD; HUM; 3101 BP.
XX
AC   FR675931;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*31, clone
DE   D10003997, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3101
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 724d76a112c0b557ae52e35dcc2973dc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3101
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10003997"
FT                   /db_xref="taxon:9606"
FT   CDS             join(61..133,264..533,775..1050,1651..1926,2026..2142,
FT                   2581..2613,2756..2803,2973..2977)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB07"
FT                   /db_xref="IMGT/HLA:A*02:269"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB07"
FT                   /protein_id="CBW44119.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYCNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            61..133
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=1
FT   intron          134..263
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=1
FT   exon            264..533
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=2
FT   intron          534..774
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=2
FT   exon            775..1050
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=3
FT   intron          1051..1650
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=3
FT   exon            1651..1926
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=4
FT   intron          1927..2025
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=4
FT   exon            2026..2142
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=5
FT   intron          2143..2580
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=5
FT   exon            2581..2613
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=6
FT   intron          2614..2755
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=6
FT   exon            2756..2803
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=7
FT   intron          2804..2972
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=7
FT   exon            2973..2977
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=8
XX
SQ   Sequence 3101 BP; 602 A; 880 C; 958 G; 661 T; 0 other;
     gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg        60
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc       120
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaac       180
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg       240
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttcttca catccgtgtc       300
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       360
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       420
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       480
     tcaccgagtg gacctgggga ccctgcgcgg ctactgcaac cagagcgagg ccggtgagtg       540
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       600
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       660
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       720
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc       780
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt       840
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       900
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       960
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg      1020
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1080
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1140
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1200
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1260
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1320
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1380
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1440
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1500
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1560
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1620
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1680
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1740
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1800
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggac      1860
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      1920
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1980
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      2040
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2100
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2160
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2220
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2280
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2340
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2400
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2460
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2520
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2580
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2640
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2700
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      2760
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      2820
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      2880
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      2940
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      3000
     agaggcaaga gttgttcctg cccttccctt tgtgacttga agaaccctga ctttgtttct      3060
     gcaaaggcac ctgcatgtgt ctgtgttcgt gtaggcataa t                          3101
//


spacer
spacer