spacer

EBI Dbfetch

ID   FR675930; SV 1; linear; genomic DNA; STD; HUM; 3075 BP.
XX
AC   FR675930;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*31, clone
DE   D10006388, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3075
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; ae87be36c211dbf040022ade7713d2c9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3075
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006388"
FT                   /db_xref="taxon:9606"
FT   CDS             join(79..151,281..550,792..1067,1668..1943,2043..2159,
FT                   2600..2632,2775..2822,2992..2996)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB06"
FT                   /db_xref="IMGT/HLA:A*31:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB06"
FT                   /protein_id="CBW44118.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVEARPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            79..151
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=1
FT   intron          152..280
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=1
FT   exon            281..550
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=2
FT   intron          551..791
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=2
FT   exon            792..1067
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=3
FT   intron          1068..1667
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=3
FT   exon            1668..1943
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=4
FT   intron          1944..2042
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=4
FT   exon            2043..2159
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=5
FT   intron          2160..2599
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=5
FT   exon            2600..2632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=6
FT   intron          2633..2774
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=6
FT   exon            2775..2822
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=7
FT   intron          2823..2991
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=7
FT   exon            2992..2996
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31"
FT                   /number=8
XX
SQ   Sequence 3075 BP; 593 A; 879 C; 947 G; 656 T; 0 other;
     ccaatcagtg tcgtcgcggt cgcggttcta aagtccgcac gcacccaccg ggactcagat        60
     tctccccaga cgccgaggat ggccgtcatg gcgccccgaa ccctcctcct gctactcttg       120
     ggggccctgg ccctgaccca gacctgggcg ggtgagtgcg gggtcgtggg gaaaccgcct       180
     ctgcggggag aagcaagggg cccgcccggc gggggcgcag gacccgggta gccgcgccgg       240
     gaggagggtc gggcggatct cagccactcc tcgcccccag gctcccactc catgaggtat       300
     ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc cgtgggctac       360
     gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagccagag gatggagccg       420
     cgggcgccgt ggatagagca ggagaggcct gagtattggg accaggagac acggaatgtg       480
     aaggcccact cacagattga ccgagtggac ctggggaccc tgcgcggcta ctacaaccag       540
     agcgaggccg gtgagtgacc ccagcccggg gcgcaggtca cgacctctca tcccccacgg       600
     acgggccagg tcacccacag tctccgggtc cgagatccac cccgaagccg cgggaccccg       660
     agacccttgc cccgggagag gcccaggcgc ctttacccgg tttcattttc agtttaggcc       720
     aaaaatcccc ccgggttggt cggggccgga cggggctcgg gggactgggc tgaccgtggg       780
     gtcggggcca ggttctcaca ccatccagat gatgtatggc tgcgacgtgg ggtcggacgg       840
     gcgcttcctc cgcgggtacc agcaggacgc ctacgacggc aaggattaca tcgccttgaa       900
     cgaggacctg cgctcttgga ccgcggcgga catggcggct cagatcaccc agcgcaagtg       960
     ggaggcggcc cgtgtggcgg agcagttgag agcctacctg gagggcacgt gcgtggagtg      1020
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacgggta ccaggggcca      1080
     cggggcgcct ccctgatcgc ctgtagatct cccgggctgg cctcccacaa ggaggggaga      1140
     caattgggac caacactaga atatcaccct ccctctggtc ctgagggaga ggaatcctcc      1200
     tgggtttcca gatcctgtac cagagagtga ctctgaggtt ccgccctgct ctgtgacaca      1260
     attaagggat aaaatctctg aaggaatgac gggaagacga tccctcgaat actgatgagt      1320
     ggttcccttt gacacacacc ggcagcagcc ttgggcccgt gacttttcct ctcaggcctt      1380
     gttctctgct tcacactcaa tgtgtgtggg ggtctgagtc cagcacttct gagtccctca      1440
     gcctccactc aggtcaggac cagaagtcgc tgttccctct tcagggacta gaattttcca      1500
     cggaatagga gattatccca ggtgcctgtg tccaggctgg tgtctgggtt ctgtgctccc      1560
     ttccccatcc caggtgtcct gtccattctc aagatagcca catgtgtgct ggaggagtgt      1620
     cccattacag atgcaaaatg cctgaatgtt ctgactcttc ctgacagacc cccccaagac      1680
     gcatatgact caccacgctg tctctgacca tgaggccacc ctgaggtgct gggccctgag      1740
     cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc agacccagga      1800
     cacggagctc gtggaggcca ggcctgcagg ggatggaacc ttccagaagt gggcgtctgt      1860
     ggtggtgcct tctggacagg agcagagata cacctgccat gtgcagcatg agggtctccc      1920
     caagcccctc accctgagat ggggtaagga gggagatggg ggtgtcatgt cttttaggga      1980
     aagcaggagc ctctctgacc tttagcaggg tcagggcccc tcaccttccc ctcttttccc      2040
     agagccgtct tcccagccca ccatccccat cgtgggcatc attgctggcc tagttctctt      2100
     tggagctgtg ttcgctggag ctgtggtcgc tgctgtgagg tggaggagga agagctcagg      2160
     tggggtgaag gggtgaaggg tgggtctgag atttcttgtc tcactgaggg ttccaagacc      2220
     caggtagaag tgtgccctgc ctcgttactg ggaagcacca tccacaatta tgggcctacc      2280
     cagcctgggc cctgtgtgcc agcacttact cttttgtaaa gcacctgtta aaatgaagga      2340
     cagatttatc accttgatta tggcggtgat gggacctgat cccagcagtc acaagtcaca      2400
     ggggaaggtc cctgaggacc ttcaggaggg cggttggtcc aggacccaca cctgctttct      2460
     tcatgtttcc tgatcccgcc ctgggtctgc agtcacacat ttctggaaac ttctctgagg      2520
     tccaagactt ggaggttcct ctaggacctt aaggccctgg ctcctttctg gtatctcaca      2580
     ggacattttc ttcccacaga tagaaaagga gggagctact ctcaggctgc aagtaagtat      2640
     gaaggaggat gatccaagaa atcactggga tattgtgttt gggagcccgt gggggagctc      2700
     acccacccca caattcctcc tctagccaca tcttctgtgg gatctgacca ggttctgttt      2760
     ttgtcctacc ccaggcagtg acagtgccca gggctctgat atgtctctca cagcttgtaa      2820
     aggtgagagc ctggagggcc tgatgtgtgt tgggtgttgg gcggaacagt ggacgcagct      2880
     gtgctatggg gtttctttgc attggatgta ttgagcatgc gatgggctgt ttaaagtgtg      2940
     actcctcact gtgacagata cgaatttgtt catgaatatt tttttctata gtgtgagaca      3000
     gctgccttgt gtgggactga gaggcaagat ttgttcctgc ccttcccttt gtgacttgaa      3060
     gtaccctgac tttgt                                                       3075
//


spacer
spacer