spacer

EBI Dbfetch

ID   FR675929; SV 1; linear; genomic DNA; STD; HUM; 3233 BP.
XX
AC   FR675929;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   11-NOV-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*11, clone
DE   CD10001002, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3233
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Wei Wei, Xu Xin, Zhang Xiaozhuang, Ye Ning, Huang Shuiqing, Luo Xianqiong;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 615353e3ceac5a04cb381339a800ad9a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3233
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="CD10001002"
FT                   /db_xref="taxon:9606"
FT   CDS             join(122..194,325..594,836..1111,1691..1966,2069..2185,
FT                   2628..2660,2803..2850,3020..3024)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB05"
FT                   /db_xref="IMGT/HLA:A*11:77"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB05"
FT                   /protein_id="CBW44117.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGKPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            122..194
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   intron          195..324
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   exon            325..594
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   intron          595..835
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   exon            836..1111
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   intron          1112..1690
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   exon            1691..1966
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   intron          1967..2068
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   exon            2069..2185
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   intron          2186..2627
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   exon            2628..2660
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   intron          2661..2802
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   exon            2803..2850
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   intron          2851..3019
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   exon            3020..3024
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=8
XX
SQ   Sequence 3233 BP; 621 A; 934 C; 992 G; 686 T; 0 other;
     gacccagttc tcactcccat tgggtgtcgg gtttccagag aagccaatca gtgtcttcgc        60
     ggtcgctctt ctaaagtccg cacgcaccca ccgggactca gattctcccc agaccccgag       120
     gatggccgtc atggcgcccc gaaccctcct cctgctactc tcgggggccc tggccctgac       180
     ccagacctgg gcgggtgagt gcggggtcgg gagggaaacc gcctctgcgg ggagaagcaa       240
     ggggccctcc tggcgggggc gcaggaccgg gggagccgcg ccgggaggag ggtcgggcag       300
     gtctcagcca ctgctcgccc ccaggctccc actccatgag gtatttctac acctccgtgt       360
     cccggcccgg ccgcgggaag ccccgcttca tcgccgtggg ctacgtggac gacacgcagt       420
     tcgtgcggtt cgacagcgac gccgcgagcc agaggatgga gccgcgggcg ccgtggatag       480
     agcaggaggg gccggagtat tgggaccagg agacacggaa tgtgaaggcc cagtcacaga       540
     ctgaccgagt ggacctgggg accctgcgcg gctactacaa ccagagcgag gacggtgagt       600
     gaccccggcc cggggcgcag gtcacgaccc ctcatccccc acggacgggc caggtggccc       660
     acagtctccg ggtccgagat ccaccccgaa gccgcgggac cccgagaccc ttgccccggg       720
     agaggcccag gcgcctttac ccggtttcat tttcagttta ggccaaaaat ccccccgggt       780
     tggtcggggc cgggcagggc ttgggggact gggctgaccg cggggtcggg gccaggttct       840
     cacaccatcc agataatgta tggctgcgac gtggggccgg acgggcgctt cctccgcggg       900
     taccggcagg acgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctct       960
     tggaccgcgg cggacatggc agctcagatc accaagcgca agtgggaggc ggcccatgcg      1020
     gcggagcagc agagagccta cctggagggc cggtgcgtgg agtggctccg cagatacctg      1080
     gagaacggga aggagacgct gcagcgcacg ggtaccaggg gccacggggc gcctccctga      1140
     tcgcctatag atctcccggg ctggcctccc acaaggaggg gagacaattg ggaccaacac      1200
     tagaatatca ccctccctct ggtcctgagg gagaggaatc ctcctgggtt tccagatcct      1260
     gtaccagaga gtgactctga ggttccgccc tgctctctga cacaattaag ggataaaatc      1320
     tctgaaggag tgacgggaag acgatccctc gaatactgat gagtggttcc ctttgacacc      1380
     ggcagcagcc ttgggcccgt gacttttcct ctcaggcctt gttctctgct tcacactcaa      1440
     tgtgtgtggg ggtctgagtc cagcacttct gagtctctca gcctccactc aggtcaggac      1500
     cagaagtcgc tgttcccttc tcagggaata gaagattatc ccaggtgcct gtgtccaggc      1560
     tggtgtctgg gttctgtgct ctcttcccca tcccgggtgt cctgtccatt ctcaagatgg      1620
     ccacatgcgt gctggtggag tgtcccatga cagatgcaaa atgcctgaat tttctgactc      1680
     ttcccgtcag acccccccaa gacacatatg acccaccacc ccatctctga ccatgaggcc      1740
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg      1800
     gatggggagg accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga      1860
     accttccaga agtgggcggc tgtggtggtg ccttctggag aggagcagag atacacctgc      1920
     catgtgcagc atgagggtct gcccgagccc ctcaccctga gatggggtaa ggagggagat      1980
     gggggtgtca tgtctcttag ggaaagcagg agcctctctg gagaccttta gcagggtcag      2040
     ggcccctcac cttcccctct tttcccagag ctgtcttccc agcccaccat ccccatcgtg      2100
     ggcatcattg ctggcctggt tctccttgga gctgtgatca ctggagctgt ggtcgctgcc      2160
     gtgatgtgga ggaggaagag ctcaggtgga gaaggggtga aaggtggggt ctgagatttc      2220
     ttgtctcact gagggttcca agccccagct agaaatgtgc cctgtctcat tactgggaag      2280
     caccttccac aatcatgggc cgacccagcc tgggccctgt gtgccagcac ttactctttt      2340
     gtaaagcacc tgttaaaatg aaggacagat ttatcacctt gattacggcg gtgatgggac      2400
     ctgataccag cagtcacaag tcacagggga aggtccctga ggacagacct caggagggct      2460
     attggtccag gacccacacc tgctttcttc atgtttcctg atcccgccct gggtctgcag      2520
     tcacacattt ctggaaactt ctctggggtc caagactagg aggttcctct aggaccttaa      2580
     ggccctggct cctttctggt atctcacagg acattttctt cccacagata gaaaaggagg      2640
     gagttacact caggctgcaa gtaagtatga aggaggctga tgcctgaggt ccttgggata      2700
     ttgtgtttgg gagcccatgg gggagctcac ccaccccaca attcctcctc tagccacatc      2760
     ttctgtggga tctgaccagg ttctgttttt gttctacccc aggcagtgac agtgcccagg      2820
     gctctgatgt gtctctcaca gcttgtaaag gtgagagctt ggagggcctg atgtgtgttg      2880
     ggtgttgggc ggaacagtgg acacagctgt gctatggggt ttctttgcat tggatgtatt      2940
     gagcatgcga tgggctgttt aaggtgtgac ccctcactgt gatggatatg aatttgttca      3000
     tgaatatttt tttctatagt gtgagacagc tgccttgtgt gggactgaga ggcaagagtt      3060
     gttcctgccc ttccctttgt gacttgaaga accctgactt tgtttctgca aaggcacctg      3120
     catgtgtctg tgttcgtgta ggcataatgt gaggaggtgg ggagaccacc ccaccccgat      3180
     gtccaccatg accctcttcc cacgctgacc tgtgctccct ctccaatcat ctt             3233
//


spacer
spacer