Dbfetch

ID   FR675928; SV 1; linear; genomic DNA; STD; HUM; 3019 BP.
XX
AC   FR675928;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*08, clone
DE   D10006380, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3019
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; bf7ecc6786f26c3740e9291e7fdd990e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3019
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006380"
FT                   /db_xref="taxon:9606"
FT   CDS             join(87..159,290..559,806..1081,1669..1944,2066..2185,
FT                   2625..2657,2765..2812,2977..2981)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB04"
FT                   /db_xref="IMGT/HLA:C*08:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB04"
FT                   /protein_id="CBW44116.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARTAEQLRAYLEGLCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            87..159
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   intron          160..289
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   exon            290..559
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   intron          560..805
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   exon            806..1081
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   intron          1082..1668
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   exon            1669..1944
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   intron          1945..2065
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   exon            2066..2185
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   intron          2186..2624
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   exon            2625..2657
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   intron          2658..2764
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   exon            2765..2812
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   intron          2813..2976
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   exon            2977..2981
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=8
XX
SQ   Sequence 3019 BP; 570 A; 879 C; 954 G; 616 T; 0 other;
     ctagagaagc caatcagcgt ctccgcagtc ccggttctaa agtccccagt cacccacccg        60
     gactcggatt ctccccagac gccgagatgc gggtcatggc gccccgaacc ctcatcctgc       120
     tgctctcggg agccctggcc ctgaccgaga cctgggcctg tgagtgcgag gttgggaggg       180
     aaacggcctc tgcggagagg agcgaggggc ccgcccggcg agggcgcagg acccggggag       240
     ccgcgcaggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc       300
     atgaggtatt tctacaccgc cgtgtcccgg cccggccgcg gagagccccg cttcatcgca       360
     gtgggctacg tggacgacac gcagttcgtg cagttcgaca gcgacgccgc gagtccaaga       420
     ggggagccgc gggcgccgtg ggtggagcag gaggggccgg agtattggga ccgggagaca       480
     cagaagtaca agcgccaggc acagactgac cgagtgagcc tgcggaacct gcgcggctac       540
     tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg cgcaggtccc gacccctccc       600
     catcccccac ggacggcccg ggtcgccccg agtctcccgg tctgagatcc accccgaggc       660
     tgcggaaccc gcccagaccc tcgaccggag agagccccag tcacctttac ccggtttcat       720
     tttcagttta ggccaaaatc cccgcgggtt ggtcggggct ggggcggggc tcgggggacg       780
     gggctgacca cgggggcggg gccagggtct cacaccctcc agaggatgta tggctgcgac       840
     ctggggcccg acgggcgcct cctccgcggg tataaccagt tcgcctacga cggcaaggat       900
     tacatcgccc tgaatgagga cctgcgctcc tggaccgccg cggacacggc ggctcagatc       960
     acccagcgca agtgggaggc ggcccgtacg gcggagcagc tgagagccta cctggagggc      1020
     ctgtgcgtgg agtggctccg cagatacctg gagaacggga agaagacgct gcagcgcgcg      1080
     ggtaccaggg gcagtgggga gccttcccca tctcctgtag atctcccggg atggcctccc      1140
     acgaggaggg gaggaaaatg ggatcagcgc tggaatatcg ccctcccttg aatggagaat      1200
     gggatgagtt ttcctgagtt tcctctgagg gccccctctg ctctctagga caattaaggg      1260
     atgaagtcct tgaggaaatg gaggggaaga cagtccctgg aatactgatc aggggtcccc      1320
     tttgaccact ttgaccactg cagcagctgt ggtcaggctg ctgacctttc tctcaggcct      1380
     tgttctctgc ctcacgctca atgtgtttaa aggtttgatt ccagcttttc tgagtccttc      1440
     ggcctccact caggtcagga ccagaagtcg ctgttcctcc ctcagagact agaactttcc      1500
     aatgaatagg agattatccc aggtgcctgt gtccaggctg gcgtctgggt tctgtgcccc      1560
     cttccccacc ccaggtgtcc tgtccattct caggatggtc acatgggcac tgttggagtg      1620
     tcgcaagaga gatacaaagt gtctgaattt tctgactctt cccgtcagaa cacccaaaga      1680
     cacacgtgac ccaccatccc gtctctgacc atgaggccac cctgaggtgc tgggccctgg      1740
     gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac caaactcagg      1800
     acaccgagct tgtggagacc aggccagcag gagatggaac cttccagaag tgggcagctg      1860
     tggtggtgcc ttctggagaa gagcagagat acacgtgcca tgtgcagcac gaggggctgc      1920
     cagagcccct caccctgaga tggggtaagg agggggatga ggggtcatgt gtcttctcag      1980
     ggaaagcaga agtcctggag cccttcagcc gggtcagggc tgaggcttgg gggtcagggc      2040
     ccctcacctt cccctccttt cccagggcca tcttcccagc ccaccatccc catcgtgggc      2100
     atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt gatggctgtt      2160
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggagtggggt ctgggttttc      2220
     ttgtcccact gggagtttca agccccaggt agaagtgtgc cccacctcgt tactggaagc      2280
     accatccaca catgggccat cccagcctgg gaccctgtgt gctagcactt actctgttgt      2340
     gaagcacatg acaatgaagg acagatgtat caccttgatg attatggtgt tggggtcctt      2400
     gattccagca ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag      2460
     ttgctccaga acccacagct gctttccccg tgtttcctga tcctgccctg ggtctgcagt      2520
     catagttctg gaaacttctc ttgggtccaa gactaggagg ttcccctaag atcgcatggc      2580
     cctgcctcct ccctgtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag      2640
     ctgctctcag gctgcgtgta agtgatggcg gtgggcgtgt ggaggagctc acccacccca      2700
     taattcctct tgtcccacat ctcctgcggg ctctgaccag gtcttttttt ttgttctacc      2760
     ccagccagca acagtgccca gggctctgat gagtctctca tcgcttgtaa aggtgagatt      2820
     ctggggagct gaagtggtcg ggggtggggc agagggaaaa ggcctaggta atggggatcc      2880
     tttgattggg acgtttcgaa tgtgtggtga gctgttcaga gtgtcatcac ttaccatgac      2940
     tgacctgaat ttgttcatga ctattgtgtt ctgtagcctg agacagctgc ctgtgtggga      3000
     ctgagatgca ggatttctt                                                   3019
//