Dbfetch

ID   FR675927; SV 1; linear; genomic DNA; STD; HUM; 2976 BP.
XX
AC   FR675927;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*14, clone
DE   D1006051, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2976
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; e5e65cbe62521c667b3ed587aaa762e0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2976
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D1006051"
FT                   /db_xref="taxon:9606"
FT   CDS             join(39..111,242..511,758..1033,1621..1896,2018..2137,
FT                   2577..2609,2717..2764,2929..2933)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB03"
FT                   /db_xref="IMGT/HLA:C*14:23"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB03"
FT                   /protein_id="CBW44115.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMFGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLLEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            39..111
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=1
FT   intron          112..241
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=1
FT   exon            242..511
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=2
FT   intron          512..757
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=2
FT   exon            758..1033
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=3
FT   intron          1034..1620
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=3
FT   exon            1621..1896
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=4
FT   intron          1897..2017
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=4
FT   exon            2018..2137
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=5
FT   intron          2138..2576
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=5
FT   exon            2577..2609
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=6
FT   intron          2610..2716
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=6
FT   exon            2717..2764
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=7
FT   intron          2765..2928
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=7
FT   exon            2929..2933
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*14"
FT                   /number=8
XX
SQ   Sequence 2976 BP; 554 A; 859 C; 953 G; 610 T; 0 other;
     gtcacccacc cggactcaga ttctccccag acgccgagat gcgggtcatg gcgccccgaa        60
     ccctcatcct gctgctctcg ggagccctgg ccctgaccga gacctgggcc tgtgagtgcg       120
     gggttaggag ggaaacggcc tctgcggaga ggagcgaggg gcccgcccgg cgagggcgca       180
     ggacccgggg agccgcgcag ggaggagggt cgggcgggtc tcagccactc ctcgtcccca       240
     ggctcccact ccatgaggta tttctccaca tccgtgtccc ggcccggccg cggggagccc       300
     cgcttcatcg cagtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       360
     gcgagtccga gaggggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg       420
     gaccgggaga cacagaagta caagcgccag gcacagactg accgagtgag cctgcggaac       480
     ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc       540
     acgacccctc cccatccccc acggacggcc cgggtcgccc cgagtctccc cgtctgagat       600
     ccaccccgag gctgcggaac ccgcccagac cctcgaccgg agagagcccc agtcaccttt       660
     acccggtttc attttcagtt taggccaaaa tccccgcggg ttggtcggga ctggggcggg       720
     gctcggggga cggggctgac cacgggggcg gggccagggt ctcacaccct ccagtggatg       780
     tttggctgcg acctggggcc cgacgggcgc ctcctccgcg ggtatgacca gtccgcctac       840
     gacggcaagg attacatcgc cctgaacgag gatctgcgct cctggaccgc cgcggacacg       900
     gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca gcggagagcc       960
     tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg      1020
     ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcccgt agatctcccg      1080
     ggatggcctc ccacgaggag gggaggaaaa tgggatcagc gctagaatat cgccctccct      1140
     tgaatggaga atgggatgag ttttcctgag tttcctctga gggccccctc tgctctctag      1200
     gacaattaag ggatgaagtc cttgaggaaa tggaggggaa gacagtccct ggaatactga      1260
     tcaggggtcc cctttgacca ctttgaccac tgcagcagct gtggtcaggc tgctgacctt      1320
     tctctcaggc cttgttctct gcctcacgct caatgtgttt gaaggtttga ttccagcttt      1380
     tctgagtcct tcggcctcca ctcaggtcag gaccagaagt cgctgttcct ccctcagaga      1440
     ctagaacttt ccaatgaata ggagattatc ccaggtgcct gtgtccaggc tggcgtctgg      1500
     gttctgtgcc cccttcccca ccccaggtgt cctgtccatt ctcaggatgg tcacatgggc      1560
     gctgttggag tgtcgcaaga gagatacaaa gtgtctgaat tttctgactc ttcccgtcag      1620
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt      1680
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagtgg gatggggagg      1740
     accaaactca ggacaccgag cttgtggaga ccaggccagc aggagatgga accttccaga      1800
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacgtgc catgtgcagc      1860
     acgaggggct gctggagccc ctcaccctga gatggggtaa ggagggggat gaggggtgat      1920
     gtgtcttctc agggaaagca gaagtcctgg agcccttcag ccgggtcagg gctgaggctt      1980
     ggaggtcagg gcccctcacc ttcccctcct ttcccagagc cgtcttccca gcccaccatc      2040
     cccatcgtgg gcatcgttgc tggcctggct gtcctggctg tcctagctgt cctaggagct      2100
     gtggtggctg ttgtgatgtg taggaggaag agctcaggta gggaaggggt gaggagtggg      2160
     gtctgggttt tcttgttcca ctgggagttt caagccccag gtagaagtgt gccccacctc      2220
     gttactggaa gcaccatcca cacatgggcc atcccagcct gggaccctgt gtgccagcac      2280
     ttactctgtt gtgaagcaca tgacaatgaa ggacagatgt atcaccttga tgattatggt      2340
     gttggggtcc ttgattccag cattcatgag tcaggggaag gtccctgcta aggacagacc      2400
     ttaggagggc agttgcttca ggacccacag ctgctttccc cgtgtttcct gatcctgccc      2460
     tgggtctgca gtcatagttc tggaaacttc tcttgggtcc aagactagga ggttccccta      2520
     agatcgcatg gccctgcctc ctccctgtcc cctcacaggg cattttcttc ccacaggtgg      2580
     aaaaggaggg agctgctctc aggctgcgtg taagtgatgg cggtgggcgt gtggaggagc      2640
     tcacccaccc cataattcct cttgtcccac atctcctgcg ggctctgacc aggtcttttt      2700
     ttttgttcta ccccagccag caacagtgcc cagggctctg atgagtctct catcgcttgt      2760
     aaaggtgaga ttctggggag ctgaagtggt cgggggtggg gcagagggaa aaggcctggg      2820
     taatggggat cctttgattg ggacgtttcg aatgtgtggt gagctgttca gagtgtcatc      2880
     acttaccatg actgacctga atttgttcat gactattgtg ttctgtagcc tgagacagct      2940
     gcctgtgtgg gactgagatg caggatttct tcacac                                2976
//