Dbfetch

ID   FR675926; SV 1; linear; genomic DNA; STD; HUM; 3034 BP.
XX
AC   FR675926;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*03, clone
DE   D10006833, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3034
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 99e13ee46eceaa60fe5084f320894a2d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3034
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10006833"
FT                   /db_xref="taxon:9606"
FT   CDS             join(29..101,232..501,747..1022,1610..1885,2007..2126,
FT                   2566..2589,2706..2753,2918..2922)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UB02"
FT                   /db_xref="IMGT/HLA:C*03:100"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UB02"
FT                   /protein_id="CBW44114.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQIQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSPSNSAQGSDESLIACKA"
FT   exon            29..101
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=1
FT   intron          102..231
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=1
FT   exon            232..501
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=2
FT   intron          502..746
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=2
FT   exon            747..1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=3
FT   intron          1023..1609
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=3
FT   exon            1610..1885
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=4
FT   intron          1886..2006
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=4
FT   exon            2007..2126
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=5
FT   intron          2127..2565
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=5
FT   exon            2566..2589
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=6
FT   intron          2590..2705
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=6
FT   exon            2706..2753
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=7
FT   intron          2754..2917
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=7
FT   exon            2918..2922
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=8
XX
SQ   Sequence 3034 BP; 567 A; 864 C; 968 G; 635 T; 0 other;
     cggactcaga ttctccccag acgccgagat gcgggtcatg gcgccccgaa ccctcatcct        60
     gctgctctcg ggagccctgg ccctgaccga gacctgggcc ggtgagtgcg gggttgggag       120
     ggaatcggcc tctgcggaga ggagcgaggg gcccgcccgg cgagggcgca ggacccgggg       180
     agccgcgcag ggaggagggt cgggcgggtc tcagcccctc ctcgccccca ggctcccact       240
     ccatgaggta tttctacacc gctgtgtccc ggcccggccg cggggagccc cacttcatcg       300
     cagtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc gcgagtccga       360
     gaggggagcc gcgggcgccg tgggtggagc aggaggggcc ggagtattgg gaccgggaga       420
     cacagaagta caagcgccag gcacagactg accgagtgag cctgcggaac ctgcgcggct       480
     actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgacccctc       540
     ctcatccccc acggacggcc cgggtcgccc caagtctccc ggtctgagat ccaccccgag       600
     gctgcggaac ccgcccagac cctcgaccgg agagagcccc agtcaccttt acccggtttc       660
     attttcagtt taggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac       720
     ggggctgacc gcgggggcgg ggccagggtc tcacatcatc cagaggatgt atggctgcga       780
     cgtggggccc gacgggcgcc tcctccgcgg gtatgaccag tacgcctacg acggcaagga       840
     ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg cggctcagat       900
     cacccagcgc aagtgggagg cggcccgtga ggcggagcag ctgagagcct acctggaggg       960
     cctgtgcgtg gagtggctcc gcagatacct gaagaatggg aaggagacgc tgcagcgcgc      1020
     gggtaccagg ggcagtgggg agccttcccc atctcctgta gatctcccgg gatggcctcc      1080
     cacgaggagg ggaggaaaat gggatcagcg ctagaatatc gccctccctt gaatggagaa      1140
     tgggatgagt tttcctgagt ttcctctgag ggccccctct gctctctagg acaattaagg      1200
     gatgaagtcc ttgaggaaat ggaggggaag acagtcccta gaatactgat caggggtccc      1260
     ctttgaccac tttgaccact gcagcagctg tggtcaggct gctgaccttt ctctcaggcc      1320
     ttgttctctg cctcacgctc aatgtgtttg aaggtttgat tccagctttt ctgagtcctt      1380
     cggcctccac tcaggtcagg accagaagtc gctgttcctc cctcagagac tagaactttc      1440
     caatgaatag gagattatcc caggtgcctg tgtccaggct ggcgtctggg ttctgtgccc      1500
     ccttccccac cccaggtgtc ctgtccgttc tcaggatggt cacatgggcg ctgttggagt      1560
     gtcgcaagag agatacaaag tgtctgaatt ttctgactct tcccgtcaga acacccaaag      1620
     acacacgtga cccaccatcc cgtctctgac catgaggcca ccctgaggtg ctgggccctg      1680
     ggcttctacc ctgcggagat cacactgacc tggcagtggg atggggagga ccaaattcag      1740
     gacactgagc ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct      1800
     gtggtggtgc cttctggaga agagcagaga tacacgtgcc atgtgcagca cgaggggctg      1860
     ccggagcccc tcaccctgag atggggtaag gagggggatg aggggtgatg tgtcttctca      1920
     gggaaagcag aagtcctgga gcccttcagc caggtcaggg ctgaggcttg ggggtcaggg      1980
     cccctcacct tcccctcctt tcccagagcc gtcttcccag cccaccatcc ccatcgtggg      2040
     catcgttgct ggcctggctg tcctggctgt cctagctgtc ctaggagctg tggtggctgt      2100
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggagtgggg tctgggtttt      2160
     cttgttccac tgggagtttc aagccccagg tagaagtgtg ccccacctcg ttactggaag      2220
     caccatccac acatgggcca tcccagcctg ggaccctgtg tgccagcact tactctgttg      2280
     tgaagcacat gacaatgaag gacagatgta tcaccttgat gattatggtg ttggggtcct      2340
     tgattccagc attcatgagt caggggaagg tccctgctaa ggacagacct taggagggca      2400
     gttgctccag aacccacagc tgctttcccc gtgtttcctg atcctgccct gggtctgcag      2460
     tcatagttct ggaaacttct cttgggtcca agactaggag gttcccctaa gatcgcatgg      2520
     ccctgactcc tccctgtccc ctcacagggc attttcttcc cacaggtgga aaaggaggga      2580
     gctgctctca ggctgcgtgt aagtgatggc ggtgggcgtg tggaggagct cacccacccc      2640
     ataattcctc ttgtcccaca tctcctgcgg gctctgacca ggtctttttt tttgttctac      2700
     cccagccagc aacagtgccc agggctctga tgagtctctc atcgcttgta aaggtgagat      2760
     tctggggagc tgaagtggtc gggggtgggg cagagggaaa aggcctaggt aatggggatc      2820
     ctttgattgg gacgtttcga atgtgtggtg agctgttcag agtgtgatca cttaccatga      2880
     ctgacctgaa tttgttcatg actattgtgt tctgtagcct gagacagctg cctgtgtggg      2940
     actgagatgc aggatttctt cacacctctc ctttgtgact tcaagagcct ctggcatctc      3000
     tttctgcaaa ggcatctgaa tgtgtctgcg ttcc                                  3034
//