Dbfetch

ID   FR675925; SV 1; linear; genomic DNA; STD; HUM; 3012 BP.
XX
AC   FR675925;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*04, clone
DE   D10003623, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3012
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 2579591d3a321b72379ecd8a51d7edd7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3012
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10003623"
FT                   /db_xref="taxon:9606"
FT   CDS             join(103..175,306..575,822..1097,1685..1960,2082..2201,
FT                   2641..2673,2780..2827,2992..2996)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5D1W8"
FT                   /db_xref="IMGT/HLA:C*04:01:01:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D1W8"
FT                   /protein_id="CBW44113.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            103..175
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=1
FT   intron          176..305
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=1
FT   exon            306..575
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=2
FT   intron          576..821
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=2
FT   exon            822..1097
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=3
FT   intron          1098..1684
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=3
FT   exon            1685..1960
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=4
FT   intron          1961..2081
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=4
FT   exon            2082..2201
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=5
FT   intron          2202..2640
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=5
FT   exon            2641..2673
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=6
FT   intron          2674..2779
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=6
FT   exon            2780..2827
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=7
FT   intron          2828..2991
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=7
FT   exon            2992..2996
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=8
XX
SQ   Sequence 3012 BP; 571 A; 865 C; 959 G; 617 T; 0 other;
     cattgggtgt cgggttctag agaagccaat cagcgtctcc gcagtcccgg ttctaaagtc        60
     cccagtcacc cacccggact cagattctcc ccagacgccg agatgcgggt catggcgccc       120
     cgaaccctca tcctgctgct ctcgggagcc ctggccctga ccgagacctg ggccggtgag       180
     tgcggggttg ggagggaaac ggcctctggg gagaggagcg aggggcccgc ccggcgaggg       240
     cgcaggaccc ggggagccgc gcagggagga gggtcgggcg ggtctcagcc actcctcgtc       300
     cccaggctcc cactccatga ggtatttctc cacatccgtg tcctggcccg gccgcgggga       360
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga       420
     cgccgcgagt ccaagagggg agccgcggga gccgtgggtg gagcaggagg ggccggagta       480
     ttgggaccgg gagacacaga agtacaagcg ccaggcacag gctgaccgag tgaacctgcg       540
     gaaactgcgc ggctactaca accagagcga ggacggtgag tgaccccggc ccggggcgca       600
     ggtcacgacc cctccccatc ccccacggac ggcccgggtc gccccgagtc tccccgtctg       660
     agatccaccc cgaggctgcg gaacccgccc agaccctcga ccggagagag ccccagtcac       720
     ctttacccgg tttcattttc agtttaggcc aaaatccccg cgggttggtc gggactgggg       780
     cggggctcgg gggaccgggc tgaccacggg ggcggggcca gggtctcaca ccctccagag       840
     gatgtttggc tgcgacctgg ggccggacgg gcgcctcctc cgcgggtata accagttcgc       900
     ctacgacggc aaggattaca tcgccctgaa cgaggatctg cgctcctgga ccgccgcgga       960
     cacggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagcggag      1020
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1080
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ccgtagatct      1140
     cccgggatgg cctcccacga ggaggggagg aaaatgggat cagcgctaga atatcgccct      1200
     cccttgaatg gagaatggga tgagttttcc tgagtttcct ctgagggccc cctctgctct      1260
     ctaggacaat taagggatga agtccttgag gaaatggagg ggaagacagt ccctggaata      1320
     ctgatcaggg gtcccctttg accactttga ccactgcagc agctgtggtc aggctgctga      1380
     cctttctctc aggccttgtt ctctgcctga cgctcaatgt gtttgaaggt ttgattccag      1440
     cttttctgag tccttcggcc tccactcagg tcaggaccag aagtcgctgt tcctccctca      1500
     gagactagaa ctttccaatg aataggagat tatcccaggt gcctgtgtcc aggctggcgt      1560
     ctgggttctg tgcccccttc cccaccccag gtgtcctgtc cattctcagg atggtcacat      1620
     gggcgctgtt ggagtgtcgc aagagagata caaagtgtct gaattttctg actcttccca      1680
     tcagaacacc caaagacaca cgtgacccac catcccgtct ctgaccatga ggccaccctg      1740
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gtgggatggg      1800
     gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc cagcaggaga tggaaccttc      1860
     cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac gtgccatgtt      1920
     cagcacgagg ggctgccgga gcccctcacc ctgagatgga gtaaggaggg ggatgagggg      1980
     tgatgtgtct tctcagggaa agcagaagtc ctggagccct tcagccgggt cagggctgag      2040
     gcttggaggt cagggcccct caccttcccc tcctttccca gagccgtctt cccagcccac      2100
     catccccatc gtgggcatcg ttgctggcct ggctgtcctg gctgtcctag ctgtcctagg      2160
     agctatggtg gctgttgtga tgtgtaggag gaagagctca ggtagggaag gggtgaggag      2220
     tggggtctgg gttttcttgt tccactggga gtttcaagcc ccaggtagaa gtgtgcccca      2280
     cctcgttact ggaagcacca tccacacatg ggccatccca gcctgggacc ctgtgtgcca      2340
     gcacttactc tgttgtgaag cacatgacaa tgaaggacag atgtatcacc ttgatgatta      2400
     tggtgttggg gtccttgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca      2460
     gaccttagga gggcagttgc ttcagaaccc acagctgctt tccccgtgtt tcctgatcct      2520
     gccctgggtc tgcagtcata gttctggaaa cttctcttgg gtccaagact aggaggttcc      2580
     cctaagatcg catggccctg cctcctccct gtcccctcac agggcatttt cttcccacag      2640
     gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg atggcggtgg gcgtgtggag      2700
     gagctcaccc accccataat tcctcttgtc ccacatctcc tgcgggctct gaccaggtat      2760
     tttttttgtt ctaccccagc cagcaacagt gcccagggct ctgatgagtc tctcatcgct      2820
     tgtaaaggtg agattctggg gagctgaagt ggtcgggggt ggggcagagg gaaaaggcct      2880
     aggtaatggg gatcctttga ttgggacgtt tcgaatgtgt ggtgagctgt tcagagtgtc      2940
     atcacttacc atgactgacc tgaatttgtt catgactatt gtgttctgta gcctgagaca      3000
     gctgcctgtg tg                                                          3012
//