spacer

EBI Dbfetch

ID   FR675924; SV 1; linear; genomic DNA; STD; HUM; 2998 BP.
XX
AC   FR675924;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*08, clone
DE   D10005565, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2998
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; 585c1deb75a38ddadc48575546be3772.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2998
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10005565"
FT                   /db_xref="taxon:9606"
FT   CDS             join(75..147,278..547,794..1069,1657..1932,2054..2173,
FT                   2613..2645,2753..2800,2965..2969)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q546I7"
FT                   /db_xref="IMGT/HLA:C*08:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546I7"
FT                   /protein_id="CBW44112.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            75..147
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   intron          148..277
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   exon            278..547
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   intron          548..793
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   exon            794..1069
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   intron          1070..1656
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   exon            1657..1932
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   intron          1933..2053
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   exon            2054..2173
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   intron          2174..2612
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   exon            2613..2645
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   intron          2646..2752
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   exon            2753..2800
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   intron          2801..2964
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   exon            2965..2969
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=8
XX
SQ   Sequence 2998 BP; 565 A; 874 C; 949 G; 610 T; 0 other;
     atcagcgtct ccgcagtccc ggttctaaag tccccagtca cccacccgga ctcggattct        60
     ccccagacgc cgagatgcgg gtcatggcgc cccgaaccct catcctgctg ctctcgggag       120
     ccctggccct gaccgagacc tgggcctgtg agtgcgaggt tgggagggaa acggcctctg       180
     cggagaggag cgaggggccc gcccggcgag ggcgcaggac ccggggagcc gcgcagggag       240
     gagggtcggg cgggtctcag cccctcctcg cccccaggct cccactccat gaggtatttc       300
     tacaccgccg tgtcccggcc cggccgcgga gagccccgct tcatcgcagt gggctacgtg       360
     gacgacacgc agttcgtgca gttcgacagc gacgccgcga gtccaagagg ggagccgcgg       420
     gcgccgtggg tggagcagga ggggccggag tattgggacc gggagacaca gaagtacaag       480
     cgccaggcac agactgaccg agtgagcctg cggaacctgc gcggctacta caaccagagc       540
     gaggccggtg agtgaccccg gcccggggcg caggtcccga cccctcccca tcccccacgg       600
     acggcccggg tcgccccgag tctcccggtc tgagatccac cccgaggctg cggaacccgc       660
     ccagaccctc gaccggagag agccccagtc acctttaccc ggtttcattt tcagtttagg       720
     ccaaaatccc cgcgggttgg tcggggctgg ggcggggctc gggggacggg gctgaccacg       780
     ggggcggggc cagggtctca caccctccag aggatgtatg gctgcgacct ggggcccgac       840
     gggcgcctcc tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg       900
     aatgaggacc tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag       960
     tgggaggcgg cccgtacggc ggagcagctg agagcctacc tggagggcac gtgcgtggag      1020
     tggctccgca gatacctgga gaacgggaag aagacgctgc agcgcgcggg taccaggggc      1080
     agtggggagc cttccccatc tcctgtagat ctcccgggat ggcctcccac gaggagggga      1140
     ggaaaatggg atcagcgctg gaatatcgcc ctcccttgaa tggagaatgg gatgagtttt      1200
     cctgagtttc ctctgagggc cccctctgct ctctaggaca attaagggat gaagtccttg      1260
     aggaaatgga ggggaagaca gtccctggaa tactgatcag gggtcccctt tgaccacttt      1320
     gaccactgca gcagctgtgg tcaggctgct gacctttctc tcaggccttg ttctctgcct      1380
     cacgctcaat gtgtttaaag gtttgattcc agcttttctg agtccttcgg cctccactca      1440
     ggtcaggacc agaagtcgct gttcctccct cagagactag aactttccaa tgaataggag      1500
     attatcccag gtgcctgtgt ccaggctggc gtctgggttc tgtgccccct tccccacccc      1560
     aggtgtcctg tccattctca ggatggtcac atgggcactg ttggagtgtc gcaagagaga      1620
     tacaaagtgt ctgaattttc tgactcttcc cgtcagaaca cccaaagaca cacgtgaccc      1680
     accatcccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg      1740
     cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg      1800
     tggagaccag gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt      1860
     ctggagaaga gcagagatac acgtgccatg tgcagcatga ggggctgcca gagcccctca      1920
     ccctgagatg gggtaaggag ggggatgagg ggtcatgtgt cttctcaggg aaagcagaag      1980
     tcctggagcc cttcagccgg gtcagggctg aggcttgggg gtcagggccc ctcaccttcc      2040
     cctcctttcc cagggccatc ttcccagccc accatcccca tcgtgggcat cgttgctggc      2100
     ctggctgtcc tggctgtcct agctgtccta ggagctgtga tggctgttgt gatgtgtagg      2160
     aggaagagct caggtaggga aggggtgagg agtggggtct gggttttctt gtcccactgg      2220
     gagtttcaag ccccaggtag aagtgtgccc cacctcgtta ctggaagcac catccacaca      2280
     tgggccatcc cagcctggga ccctgtgtgc tagcacttac tctgttgtga agcacatgac      2340
     aatgaaggac agatgtatca ccttgatgat tatggtgttg gggtccttga ttccagcatt      2400
     catgagtcag gggaaggtcc ctgctaagga cagaccttag gagggcagtt gctccagaac      2460
     ccacagctgc tttccccgtg tttcctgatc ctgccctggg tctgcagtca tagttctgga      2520
     aacttctctt gggtccaaga ctaggaggtt cccctaagat cgcatggccc tgcctcctcc      2580
     ctgtcccctc acagggcatt ttcttcccac aggtggaaaa ggagggagct gctctcaggc      2640
     tgcgtgtaag tgatggcggt gggcgtgtgg aggagctcac ccaccccata attcctcttg      2700
     tcccacatct cctgcgggct ctgaccaggt cttttttttt gttctacccc agccagcaac      2760
     agtgcccagg gctctgatga gtctctcatc gcttgtaaag gtgagattct ggggagctga      2820
     agtggtcggg ggtggggcag agggaaaagg cctaggtaat ggggatcctt tgattgggac      2880
     gtttcgaatg tgtggtgagc tgttcagagt gtcatcactt accatgactg acctgaattt      2940
     gttcatgact attgtgttct gtagcctgag acagctgcct gtgtgggact gagatgca        2998
//


spacer
spacer