Dbfetch

ID   FR675923; SV 1; linear; genomic DNA; STD; HUM; 2978 BP.
XX
AC   FR675923;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*08, clone
DE   D10001344, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2978
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
DR   MD5; e8013eaab611499b1827191279b34223.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2978
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="D10001344"
FT                   /db_xref="taxon:9606"
FT   CDS             join(84..156,287..556,803..1078,1666..1941,2063..2182,
FT                   2622..2654,2762..2809,2974..2978)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UAZ9"
FT                   /db_xref="IMGT/HLA:C*08:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D9UAZ9"
FT                   /protein_id="CBW44111.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENRKKTLQRAEHPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            84..156
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   intron          157..286
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=1
FT   exon            287..556
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   intron          557..802
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=2
FT   exon            803..1078
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   intron          1079..1665
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=3
FT   exon            1666..1941
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   intron          1942..2062
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=4
FT   exon            2063..2182
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   intron          2183..2621
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=5
FT   exon            2622..2654
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   intron          2655..2761
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=6
FT   exon            2762..2809
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   intron          2810..2973
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=7
FT   exon            2974..2978
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*08"
FT                   /number=8
XX
SQ   Sequence 2978 BP; 565 A; 871 C; 939 G; 603 T; 0 other;
     gagaagccaa tcagcgtctc cgcagtcccg gttctaaagt ccccagtcac ccacccggac        60
     tcggattctc cccagacgcc gagatgcggg tcatggcgcc ccgaaccctc atcctgctgc       120
     tctcgggagc cctggccctg accgagacct gggcctgtga gtgcgaggtt gggagggaaa       180
     cggcctctgc ggagaggagc gaggggcccg cccggcgagg gcgcaggacc cggggagccg       240
     cgcagggagg agggtcgggc gggtctcagc ccctcctcgc ccccaggctc ccactccatg       300
     aggtatttct acaccgccgt gtcccggccc ggccgcggag agccccgctt catcgcagtg       360
     ggctacgtgg acgacacgca gttcgtgcag ttcgacagcg acgccgcgag tccaagaggg       420
     gagccgcggg cgccgtgggt ggagcaggag gggccggagt attgggaccg ggagacacag       480
     aagtacaagc gccaggcaca gactgaccga gtgagcctgc ggaacctgcg cggctactac       540
     aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcccgac ccctccccat       600
     cccccacgga cggcccgggt cgccccgagt ctcccggtct gagatccacc ccgaggctgc       660
     ggaacccgcc cagaccctcg accggagaga gccccagtca cctttacccg gtttcatttt       720
     cagtttaggc caaaatcccc gcgggttggt cggggctggg gcggggctcg ggggacgggg       780
     ctgaccacgg gggcggggcc agggtctcac accctccaga ggatgtatgg ctgcgacctg       840
     gggcccgacg ggcgcctcct ccgcgggtat aaccagttcg cctacgacgg caaggattac       900
     atcgccctga atgaggacct gcgctcctgg accgccgcgg acacggcggc tcagatcacc       960
     cagcgcaagt gggaggcggc ccgtacggcg gagcagctga gagcctacct ggagggcacg      1020
     tgcgtggagt ggctccgcag atacctggag aacaggaaga agacgctgca gcgcgcgggt      1080
     accaggggca gtggggagcc ttccccatct cctgtagatc tcccgggatg gcctcccacg      1140
     aggaggggag gaaaatggga tcagcgctgg aatatcgccc tcccttgaat ggagaatggg      1200
     atgagttttc ctgagtttcc tctgagggcc ccctctgctc tctaggacaa ttaagggatg      1260
     aagtccttga ggaaatggag gggaagacag tccctggaat actgatcagg ggtccccttt      1320
     gaccactttg accactgcag cagctgtggt caggctgctg acctttctct caggccttgt      1380
     tctctgcctc acgctcaatg tgtttaaagg tttgattcca gcttttctga gtccttcggc      1440
     ctccactcag gtcaggacca gaagtcgctg ttcctccctc agagactaga actttccaat      1500
     gaataggaga ttatcccagg tgcctgtgtc caggctggcg tctgggttct gtgccccctt      1560
     ccccacccca ggtgtcctgt ccattctcag gatggtcaca tgggcactgt tggagtgtcg      1620
     caagagagat acaaagtgtc tgaattttct gactcttccc gtcagaacac ccaaagacac      1680
     acgtgaccca ccatcccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1740
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1800
     ccgagcttgt ggagaccagg ccagcaggag atggaacctt ccagaagtgg gcagctgtgg      1860
     tggtgccttc tggagaagag cagagataca cgtgccatgt gcagcacgag gggctgccag      1920
     agcccctcac cctgagatgg ggtaaggagg gggatgaggg gtcatgtgtc ttctcaggga      1980
     aagcagaagt cctggagccc ttcagccggg tcagggctga ggcttggggg tcagggcccc      2040
     tcaccttccc ctcctttccc agggccatct tcccagccca ccatccccat cgtgggcatc      2100
     gttgctggcc tggctgtcct ggctgtccta gctgtcctag gagctgtgat ggctgttgtg      2160
     atgtgtagga ggaagagctc aggtagggaa ggggtgagga gtggggtctg ggttttcttg      2220
     tcccactggg agtttcaagc cccaggtaga agtgtgcccc acctcgttac tggaagcacc      2280
     atccacacat gggccatccc agcctgggac cctgtgtgct agcacttact ctgttgtgaa      2340
     gcacatgaca atgaaggaca gatgtatcac cttgatgatt atggtgttgg ggtccttgat      2400
     tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg agggcagttg      2460
     ctccagaacc cacagctgct ttccccgtgt ttcctgatcc tgccctgggt ctgcagtcat      2520
     agttctggaa acttctcttg ggtccaagac taggaggttc ccctaagatc gcatggccct      2580
     gcctcctccc tgtcccctca cagggcattt tcttcccaca ggtggaaaag gagggagctg      2640
     ctctcaggct gcgtgtaagt gatggcggtg ggcgtgtgga ggagctcacc caccccataa      2700
     ttcctcttgt cccacatctc ctgcgggctc tgaccaggtc tttttttttg ttctacccca      2760
     gccagcaaca gtgcccaggg ctctgatgag tctctcatcg cttgtaaagg tgagattctg      2820
     gggagctgaa gtggtcgggg gtggggcaga gggaaaaggc ctaggtaatg gggatccttt      2880
     gattgggacg tttcgaatgt gtggtgagct gttcagagtg tcatcactta ccatgactga      2940
     cctgaatttg ttcatgacta ttgtgttctg tagcctga                              2978
//