spacer

EBI Dbfetch

ID   FR675912; SV 2; linear; genomic DNA; STD; HUM; 1545 BP.
XX
AC   FR675912;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   21-JUN-2012 (Rel. 113, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*46,
DE   clone HLAD005875, exons 1-6
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Wei Wei, Xu Xin, Zhang Xiaozhuang, Ye Ning, Huang Shuiqing, Luo Xianqiong;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
RN   [3]
RP   1-1545
RA   Qu J.;
RT   ;
RL   Submitted (14-MAY-2012) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
DR   MD5; bbabe3bda774d3e9fe53f7347fb97ea2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1545
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="HLAD005875"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..>1540)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D9UAY8"
FT                   /db_xref="IMGT/HLA:B*46:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D9UAY8"
FT                   /protein_id="CBW44100.2"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..>1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=5
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   exon            1513..>1540
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*46"
FT                   /number=6
XX
SQ   Sequence 1545 BP; 211 A; 322 C; 353 G; 159 T; 500 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc       300
     gaggatggcg ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggca tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagctg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacatgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagt ccaccatccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctactgtg atgtgtagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nngtggaaaa ggagggagct actctcaggc tgcgt                      1545
//


spacer
spacer