spacer

EBI Dbfetch

ID   FR675895; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FR675895;
XX
DT   03-AUG-2010 (Rel. 105, Created)
DT   03-AUG-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, allele
DE   HLA-DQB1*06, clone LHLAD000888, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Qu J.;
RT   ;
RL   Submitted (02-AUG-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Chen H., Wang L., Liao K., Zheng Z., Huang C., Li J., Hu Z.,
RA   Zhang H., Shen M.;
RT   "Identification novel alleles of HLA genes";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="LHLAD000888"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D9UAX1"
FT                   /db_xref="IMGT/HLA:DQB1*06:01:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D9UAX1"
FT                   /protein_id="CBW44083.1"
FT                   /translation="DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            <1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06"
FT                   /number=3
XX
SQ   Sequence 652 BP; 123 A; 156 C; 173 G; 100 T; 100 other;
     aggatttcgt gctccagttt aaggccatgt gctacttcac caatgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacggat ttctatccag gccagatcaa agtccggtgg       480
     tttcggaatg accaggagga gacagctggc gttgtgtcca ccccccttat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcatgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer