Dbfetch

ID   FR671366; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FR671366;
XX
DT   30-JUL-2010 (Rel. 105, Created)
DT   30-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*113 variant, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Bengtsson M.;
RT   ;
RL   Submitted (30-JUL-2010) to the INSDC.
RL   Bengtsson M., Dep of Clinical Immunology, Rudbeck Laboratory, University
RL   Hospital, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "New HLA DPB1 variant";
RL   Unpublished.
XX
DR   MD5; 71647314de04a906f13443f62b877937.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DB1"
FT                   /allele="HLA-DPB1*113 variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1XUQ0"
FT                   /db_xref="IMGT/HLA:DPB1*129:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1XUQ0"
FT                   /protein_id="CBW38505.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DB1"
FT                   /allele="HLA-DPB1*113 variant"
FT                   /number=2
XX
SQ   Sequence 264 BP; 63 A; 64 C; 97 G; 40 T; 0 other;
     agaattacgt gcaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//