spacer

EBI Dbfetch

ID   FR671159; SV 1; linear; genomic DNA; STD; HUM; 1007 BP.
XX
AC   FR671159;
XX
DT   30-JUL-2010 (Rel. 105, Created)
DT   30-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*05new, clone ANCB693337AN, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1007
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (30-JUL-2010) to the INSDC.
RL   McWhinnie A.J., HLA Group, Anthony Nolan Research Institute, Fleet Road,
RL   Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Mcwhinnie A.J.M., Wallis-Jones S.;
RT   "A new HLA-C allele C*05XX differing from C*05:01:01:01 due to a 15
RT   nucleotide deletion of nucleotide positions 556 to 570 encoding codons 162
RT   to 166";
RL   Unpublished.
XX
DR   MD5; 08a331181d66251cce332a198977d6ab.
DR   Ensembl-Gn; ENSG00000206435; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206452; homo_sapiens.
DR   Ensembl-Tr; ENST00000383323; homo_sapiens.
DR   Ensembl-Tr; ENST00000383483; homo_sapiens.
DR   Ensembl-Tr; ENST00000383487; homo_sapiens.
DR   Ensembl-Tr; ENST00000400341; homo_sapiens.
DR   Ensembl-Tr; ENST00000400394; homo_sapiens.
DR   Ensembl-Tr; ENST00000400395; homo_sapiens.
DR   Ensembl-Tr; ENST00000434884; homo_sapiens.
DR   Ensembl-Tr; ENST00000458668; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1007
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /clone="ANCB693337AN"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..631,732..>1007)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="C*05new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="The 15 nucleotide deletion in exon 3 does not alter
FT                   the reading frame"
FT                   /db_xref="GOA:E1XUP8"
FT                   /db_xref="IMGT/HLA:C*05:51Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:E1XUP8"
FT                   /protein_id="CBW38447.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEWLR
FT                   RYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="C*05new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..631
FT                   /gene="HLA-C"
FT                   /allele="C*05new"
FT                   /number=3
FT   gap             632..731
FT                   /estimated_length=unknown
FT   exon            732..>1007
FT                   /gene="HLA-C"
FT                   /allele="C*05new"
FT                   /number=4
XX
SQ   Sequence 1007 BP; 175 A; 248 C; 275 G; 109 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaat       480
     gaggacctgc gctcctggac cgccgcggac aaggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agtggctccg cagatacctg       600
     gagaacggga agaagacgct gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn naacacccaa agacacacgt gacccaccat cccgtctctg accatgaggc       780
     caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg       840
     ggatggcgag gaccaaactc aggacaccga gcttgtggag accaggccag caggagatgg       900
     aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga gatacacgtg       960
     ccatgtgcag cacgaggggc tgccagagcc cctcaccctg agatggg                    1007
//


spacer
spacer