spacer

EBI Dbfetch

ID   FR668559; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR668559;
XX
DT   23-JUL-2010 (Rel. 105, Created)
DT   23-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11XX
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wallis-Jones S.;
RT   ;
RL   Submitted (23-JUL-2010) to the INSDC.
RL   Wallis-Jones S., Routine Sequencing, Anthony Nolan Trust, NW3 2QG, London,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Wallis-Jones S.;
RT   "A novel HLA-DRB1* allele most similar to DRB1*11:02:01";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1XUI4"
FT                   /db_xref="IMGT/HLA:DRB1*11:98"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1XUI4"
FT                   /protein_id="CBW30248.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDILEDGRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11XX"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 62 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacatcct ggaagacggg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer