Dbfetch

ID   FR668236; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FR668236;
XX
DT   22-JUL-2010 (Rel. 105, Created)
DT   22-JUL-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*12XX
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wallis-Jones S.;
RT   ;
RL   Submitted (22-JUL-2010) to the INSDC.
RL   Wallis-Jones S., Anthony Nolan Trust, Routine Sequencing, NW3 2QG, London,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   Wallis-Jones S.;
RT   "A novel HLA-DRB1* allele most similar to DRB1*12:01:01";
RL   Unpublished.
XX
DR   MD5; 5f9a1a42361efebfa533cf366c84497d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="1HLA-DRB1-12XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1XUD4"
FT                   /db_xref="IMGT/HLA:DRB1*12:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1XUD4"
FT                   /protein_id="CBV86413.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQQDILEDRRAAVDTYCRHNYGAVESFTVQRR"
XX
SQ   Sequence 270 BP; 54 A; 68 C; 98 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccagc       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ttgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcggcgag                                        270
//