Dbfetch

ID   FR667215; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   FR667215;
XX
DT   27-JUL-2010 (Rel. 105, Created)
DT   20-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*05new
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Jakubauskas A.;
RT   ;
RL   Submitted (16-JUL-2010) to the INSDC.
RL   Jakubauskas A., Vilnius University Hospital Santariskiu Clinics, Department
RL   of Molecular and Regenerative Medicine, Santariskiu 2, 08661, LITHUANIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2010.01572.x.
RX   PUBMED; 20887386.
RA   Jakubauskas A., Griskevicius L.;
RT   "Sequence-based typing showed a novel HLA-DQB1*05 allele, DQB1*05:01:03";
RL   Tissue Antigens 77(2):157-158(2011).
XX
DR   MD5; 8f40f2c8998434c55cc46e28434b703c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1XTW2"
FT                   /db_xref="IMGT/HLA:DQB1*05:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1XTW2"
FT                   /protein_id="CBV36793.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLICSVTDFYPSQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            <1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*05new"
FT                   /number=3
XX
SQ   Sequence 652 BP; 122 A; 157 C; 177 G; 96 T; 100 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcagtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tgatctgctc ggtgacagat ttctatccaa gccagatcaa agtccggtgg       480
     tttcggaatg atcaggagga gacagccggc gttgtgtcca cccccctcat taggaacggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agatgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//