spacer

EBI Dbfetch

ID   FP565809; SV 1; circular; genomic DNA; STD; PRO; 2715461 BP.
XX
AC   FP565809;
XX
PR   Project:PRJNA28575;
XX
DT   15-OCT-2010 (Rel. 106, Created)
DT   15-OCT-2010 (Rel. 106, Last updated, Version 1)
XX
DE   Clostridium sticklandii str. DSM 519 chromosome, complete genome.
XX
KW   .
XX
OS   [Clostridium] sticklandii
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Peptostreptococcaceae;
OC   Peptoclostridium.
XX
RN   [1]
RP   1-2715461
RA   Genoscope - CEA;
RT   ;
RL   Submitted (01-OCT-2010) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
DR   MD5; b6ad85b53c5342f954a012140647490b.
DR   EnsemblGenomes-Gn; CLOST_16S_1.
DR   EnsemblGenomes-Gn; CLOST_16S_2.
DR   EnsemblGenomes-Gn; CLOST_16S_3.
DR   EnsemblGenomes-Gn; CLOST_16S_4.
DR   EnsemblGenomes-Gn; CLOST_16S_5.
DR   EnsemblGenomes-Gn; CLOST_16S_6.
DR   EnsemblGenomes-Gn; CLOST_23S_1.
DR   EnsemblGenomes-Gn; CLOST_23S_2.
DR   EnsemblGenomes-Gn; CLOST_23S_3.
DR   EnsemblGenomes-Gn; CLOST_23S_4.
DR   EnsemblGenomes-Gn; CLOST_23S_5.
DR   EnsemblGenomes-Gn; CLOST_23S_6.
DR   EnsemblGenomes-Gn; CLOST_5S_1.
DR   EnsemblGenomes-Gn; CLOST_5S_2.
DR   EnsemblGenomes-Gn; CLOST_5S_3.
DR   EnsemblGenomes-Gn; CLOST_5S_4.
DR   EnsemblGenomes-Gn; CLOST_5S_5.
DR   EnsemblGenomes-Gn; CLOST_5S_6.
DR   EnsemblGenomes-Gn; CLOST_tRNA1.
DR   EnsemblGenomes-Gn; CLOST_tRNA10.
DR   EnsemblGenomes-Gn; CLOST_tRNA11.
DR   EnsemblGenomes-Gn; CLOST_tRNA12.
DR   EnsemblGenomes-Gn; CLOST_tRNA13.
DR   EnsemblGenomes-Gn; CLOST_tRNA14.
DR   EnsemblGenomes-Gn; CLOST_tRNA15.
DR   EnsemblGenomes-Gn; CLOST_tRNA16.
DR   EnsemblGenomes-Gn; CLOST_tRNA17.
DR   EnsemblGenomes-Gn; CLOST_tRNA18.
DR   EnsemblGenomes-Gn; CLOST_tRNA19.
DR   EnsemblGenomes-Gn; CLOST_tRNA2.
DR   EnsemblGenomes-Gn; CLOST_tRNA20.
DR   EnsemblGenomes-Gn; CLOST_tRNA21.
DR   EnsemblGenomes-Gn; CLOST_tRNA22.
DR   EnsemblGenomes-Gn; CLOST_tRNA23.
DR   EnsemblGenomes-Gn; CLOST_tRNA24.
DR   EnsemblGenomes-Gn; CLOST_tRNA25.
DR   EnsemblGenomes-Gn; CLOST_tRNA26.
DR   EnsemblGenomes-Gn; CLOST_tRNA27.
DR   EnsemblGenomes-Gn; CLOST_tRNA28.
DR   EnsemblGenomes-Gn; CLOST_tRNA29.
DR   EnsemblGenomes-Gn; CLOST_tRNA3.
DR   EnsemblGenomes-Gn; CLOST_tRNA30.
DR   EnsemblGenomes-Gn; CLOST_tRNA31.
DR   EnsemblGenomes-Gn; CLOST_tRNA32.
DR   EnsemblGenomes-Gn; CLOST_tRNA33.
DR   EnsemblGenomes-Gn; CLOST_tRNA34.
DR   EnsemblGenomes-Gn; CLOST_tRNA35.
DR   EnsemblGenomes-Gn; CLOST_tRNA36.
DR   EnsemblGenomes-Gn; CLOST_tRNA37.
DR   EnsemblGenomes-Gn; CLOST_tRNA38.
DR   EnsemblGenomes-Gn; CLOST_tRNA39.
DR   EnsemblGenomes-Gn; CLOST_tRNA4.
DR   EnsemblGenomes-Gn; CLOST_tRNA40.
DR   EnsemblGenomes-Gn; CLOST_tRNA41.
DR   EnsemblGenomes-Gn; CLOST_tRNA42.
DR   EnsemblGenomes-Gn; CLOST_tRNA43.
DR   EnsemblGenomes-Gn; CLOST_tRNA44.
DR   EnsemblGenomes-Gn; CLOST_tRNA45.
DR   EnsemblGenomes-Gn; CLOST_tRNA46.
DR   EnsemblGenomes-Gn; CLOST_tRNA47.
DR   EnsemblGenomes-Gn; CLOST_tRNA48.
DR   EnsemblGenomes-Gn; CLOST_tRNA49.
DR   EnsemblGenomes-Gn; CLOST_tRNA5.
DR   EnsemblGenomes-Gn; CLOST_tRNA50.
DR   EnsemblGenomes-Gn; CLOST_tRNA51.
DR   EnsemblGenomes-Gn; CLOST_tRNA52.
DR   EnsemblGenomes-Gn; CLOST_tRNA53.
DR   EnsemblGenomes-Gn; CLOST_tRNA54.
DR   EnsemblGenomes-Gn; CLOST_tRNA55.
DR   EnsemblGenomes-Gn; CLOST_tRNA56.
DR   EnsemblGenomes-Gn; CLOST_tRNA57.
DR   EnsemblGenomes-Gn; CLOST_tRNA58.
DR   EnsemblGenomes-Gn; CLOST_tRNA59.
DR   EnsemblGenomes-Gn; CLOST_tRNA6.
DR   EnsemblGenomes-Gn; CLOST_tRNA7.
DR   EnsemblGenomes-Gn; CLOST_tRNA8.
DR   EnsemblGenomes-Gn; CLOST_tRNA9.
DR   EnsemblGenomes-Tr; CLOST_16S_1.
DR   EnsemblGenomes-Tr; CLOST_16S_2.
DR   EnsemblGenomes-Tr; CLOST_16S_3.
DR   EnsemblGenomes-Tr; CLOST_16S_4.
DR   EnsemblGenomes-Tr; CLOST_16S_5.
DR   EnsemblGenomes-Tr; CLOST_16S_6.
DR   EnsemblGenomes-Tr; CLOST_23S_1.
DR   EnsemblGenomes-Tr; CLOST_23S_2.
DR   EnsemblGenomes-Tr; CLOST_23S_3.
DR   EnsemblGenomes-Tr; CLOST_23S_4.
DR   EnsemblGenomes-Tr; CLOST_23S_5.
DR   EnsemblGenomes-Tr; CLOST_23S_6.
DR   EnsemblGenomes-Tr; CLOST_5S_1.
DR   EnsemblGenomes-Tr; CLOST_5S_2.
DR   EnsemblGenomes-Tr; CLOST_5S_3.
DR   EnsemblGenomes-Tr; CLOST_5S_4.
DR   EnsemblGenomes-Tr; CLOST_5S_5.
DR   EnsemblGenomes-Tr; CLOST_5S_6.
DR   EnsemblGenomes-Tr; CLOST_tRNA1.
DR   EnsemblGenomes-Tr; CLOST_tRNA10.
DR   EnsemblGenomes-Tr; CLOST_tRNA11.
DR   EnsemblGenomes-Tr; CLOST_tRNA12.
DR   EnsemblGenomes-Tr; CLOST_tRNA13.
DR   EnsemblGenomes-Tr; CLOST_tRNA14.
DR   EnsemblGenomes-Tr; CLOST_tRNA15.
DR   EnsemblGenomes-Tr; CLOST_tRNA16.
DR   EnsemblGenomes-Tr; CLOST_tRNA17.
DR   EnsemblGenomes-Tr; CLOST_tRNA18.
DR   EnsemblGenomes-Tr; CLOST_tRNA19.
DR   EnsemblGenomes-Tr; CLOST_tRNA2.
DR   EnsemblGenomes-Tr; CLOST_tRNA20.
DR   EnsemblGenomes-Tr; CLOST_tRNA21.
DR   EnsemblGenomes-Tr; CLOST_tRNA22.
DR   EnsemblGenomes-Tr; CLOST_tRNA23.
DR   EnsemblGenomes-Tr; CLOST_tRNA24.
DR   EnsemblGenomes-Tr; CLOST_tRNA25.
DR   EnsemblGenomes-Tr; CLOST_tRNA26.
DR   EnsemblGenomes-Tr; CLOST_tRNA27.
DR   EnsemblGenomes-Tr; CLOST_tRNA28.
DR   EnsemblGenomes-Tr; CLOST_tRNA29.
DR   EnsemblGenomes-Tr; CLOST_tRNA3.
DR   EnsemblGenomes-Tr; CLOST_tRNA30.
DR   EnsemblGenomes-Tr; CLOST_tRNA31.
DR   EnsemblGenomes-Tr; CLOST_tRNA32.
DR   EnsemblGenomes-Tr; CLOST_tRNA33.
DR   EnsemblGenomes-Tr; CLOST_tRNA34.
DR   EnsemblGenomes-Tr; CLOST_tRNA35.
DR   EnsemblGenomes-Tr; CLOST_tRNA36.
DR   EnsemblGenomes-Tr; CLOST_tRNA37.
DR   EnsemblGenomes-Tr; CLOST_tRNA38.
DR   EnsemblGenomes-Tr; CLOST_tRNA39.
DR   EnsemblGenomes-Tr; CLOST_tRNA4.
DR   EnsemblGenomes-Tr; CLOST_tRNA40.
DR   EnsemblGenomes-Tr; CLOST_tRNA41.
DR   EnsemblGenomes-Tr; CLOST_tRNA42.
DR   EnsemblGenomes-Tr; CLOST_tRNA43.
DR   EnsemblGenomes-Tr; CLOST_tRNA44.
DR   EnsemblGenomes-Tr; CLOST_tRNA45.
DR   EnsemblGenomes-Tr; CLOST_tRNA46.
DR   EnsemblGenomes-Tr; CLOST_tRNA47.
DR   EnsemblGenomes-Tr; CLOST_tRNA48.
DR   EnsemblGenomes-Tr; CLOST_tRNA49.
DR   EnsemblGenomes-Tr; CLOST_tRNA5.
DR   EnsemblGenomes-Tr; CLOST_tRNA50.
DR   EnsemblGenomes-Tr; CLOST_tRNA51.
DR   EnsemblGenomes-Tr; CLOST_tRNA52.
DR   EnsemblGenomes-Tr; CLOST_tRNA53.
DR   EnsemblGenomes-Tr; CLOST_tRNA54.
DR   EnsemblGenomes-Tr; CLOST_tRNA55.
DR   EnsemblGenomes-Tr; CLOST_tRNA56.
DR   EnsemblGenomes-Tr; CLOST_tRNA57.
DR   EnsemblGenomes-Tr; CLOST_tRNA58.
DR   EnsemblGenomes-Tr; CLOST_tRNA59.
DR   EnsemblGenomes-Tr; CLOST_tRNA6.
DR   EnsemblGenomes-Tr; CLOST_tRNA7.
DR   EnsemblGenomes-Tr; CLOST_tRNA8.
DR   EnsemblGenomes-Tr; CLOST_tRNA9.
DR   EuropePMC; PMC3091704; 20937090.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; FP565809.
DR   SILVA-SSU; FP565809.
DR   StrainInfo; 156751; 1.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MicroScope annotation system
CC   http://www.genoscope.cns.fr/agc/microscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2715461
FT                   /organism="[Clostridium] sticklandii"
FT                   /strain="DSM 519"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1511"
FT   gene            124..1446
FT                   /gene="dnaA"
FT                   /locus_tag="CLOST_0001"
FT   CDS             124..1446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CLOST_0001"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   DNA-binding transcriptional dual regulator"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="12 : Regulatory functions"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12794081, 12813061, 20042177, 20069637, 20225862,
FT                   2558436, 6234204, 6296774, 6329723, 92017649, 94012526,
FT                   94077701, 9785448, 9852089; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20133"
FT                   /db_xref="GOA:E3PQY7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20133.1"
FT                   /translation="MDAASLWEKILNVYKTHITKQFYESFFSSIEPVTVRKNKLILLAP
FT                   NYFIKEVIENNHLNNLHNIAKDISSTSYEIQIILDLEEITDMYSDSDSDNGKDIRSYSL
FT                   NPKYTFDTFVIGNSNRFAHAACVAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHYIVS
FT                   NNKNSKILYLSSETFTNELINSIKDDKNEAFRNKYRNVDVILVDDIQFIAGKERTQEEF
FT                   FHTFNALHDANKQIIISSDRTPKEIPTLEDRLRSRFEMGLIADIQPPDFETRIAILRKK
FT                   AQVENRDIPNEVMVHIAKNIKSNIRELEGALVRVIAYSDLTKEEITYELACEALKDIFQ
FT                   SSANNELNSSAIKEKVAQIFSVKMEDFQSKKRTRAIAYPRQIAMYLCRELTDMSLPKIG
FT                   EEFGGRDHTTVIHACDKVASDIEKDEDIKNKINRIITDLKN"
FT   gene            1644..2735
FT                   /locus_tag="CLOST_0002"
FT   CDS             1644..2735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20134"
FT                   /db_xref="GOA:E3PQY8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20134.1"
FT                   /translation="MKITVNQNELQSAINMTLKGVSNKNTIEILKGILFETYEGKLMLT
FT                   SNNLEIGVQTVIDADIQREGKVVIDAKIISDIVRKLPSSDVCLDVDETHIVKISSTSLE
FT                   FNIKGFSGEDFPIPVSIEENYYKEISSDIFKEMVRKTSFAVSLDETKPLLMGELIEFKN
FT                   NSINMVAIDGFRLAIKYIKDDNFVTDSKIIVPGKTLVDISRMIPPSVDKIKLGFDEKHA
FT                   SFIIGETILTTRLLEGEFINYSQIIPKEFSTKLKIHTKDFLYALDRACLVAKNNLIKID
FT                   ISDDNLKISSKNDEIGNLEENIFIELEGSNLEIAFNAKYFMDALKTIDEEYISLELNTN
FT                   VSPCILKPYDDDSYTYLLLPVRI"
FT   gene            2864..3070
FT                   /locus_tag="CLOST_0003"
FT   CDS             2864..3070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0003"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20135"
FT                   /db_xref="GOA:E3PQY9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20135.1"
FT                   /translation="MKEIKLYTEYIKLDQFLKLVNEAASGGEAKVMVLASEVKLNGVVE
FT                   IQRGKKIRPGDIVSVENRSYKVI"
FT   gene            3083..4168
FT                   /gene="recF"
FT                   /locus_tag="CLOST_0004"
FT   CDS             3083..4168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CLOST_0004"
FT                   /product="DNA replication and repair protein recF"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20136"
FT                   /db_xref="GOA:E3PQZ0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20136.1"
FT                   /translation="MLINNITLSNFRNYSKAEANFSENLNLIIGKNGQGKTNLIEAIYM
FT                   LSLGRSFRTNKDKEMMMFDALNTYISSEITAMGRNYKIEIKLGKDIKKAVKINSIPIEK
FT                   LTDLLGIINIVIFSPEDLKLVREGPKERRGFMDREISQLRPNYYSLIHKYQKILVQRNN
FT                   LLKNTKIDENLLDVYDEQLAIVSQKIMAYRKEFIDNITPIASANHYRISSGKEKLNIKY
FT                   LPNITASSEIEFDSSYIFNKFKTSRAEDIRRRTTTSGPHKDDIGIYLGDMDLRSFGSQG
FT                   QKRSAAISLKLSEIQLIFEEKNEYPVVLLDDIFSELDISRQKMLIDSLSEIQTFVTTTE
FT                   AIDFNKEVKTYLIENAKVSLL"
FT   gene            4178..6103
FT                   /gene="gyrB"
FT                   /locus_tag="CLOST_0005"
FT   CDS             4178..6103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CLOST_0005"
FT                   /product="DNA gyrase (subunit B)"
FT                   /function="16.9 : Replicate"
FT                   /function="16.3 : Control"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12682299, 12767818, 17320901; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20137"
FT                   /db_xref="GOA:E3PQZ1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20137.1"
FT                   /translation="METNENKVNHAYGAEQIQVLEGLDPVRKRPGMYIGSTGSRGLHHL
FT                   VYEVVDNAIDEALAGHCDKIYVSIDPDNGITVKDNGRGIPVEIHPKTGKSTVETVLTVL
FT                   HAGGKFGAGGYKVSGGLHGVGVSVVNALSKELIVEVKINGKIYRQEFAYGVPQTELEIV
FT                   GETTERGTCVRFMPDDAVFEETQYKYDTLEHRLRELAFLNKGIHITLEDKREDLQKVKE
FT                   FHYTGGLVEFVRYINKNKSPIHDDVIYFEKKQGDYTVEIAMQYTDAYVENVYSFANNIN
FT                   THEGGMHLTGFKTALTRVINDYAKKSNFLKSKEDNLMGEDIREGLTAVVSIKLPDPQYE
FT                   GQTKTKLGNPQARSAVETISGDNITIFLDENPASARIIVDKALRAQRAREAAKKARELT
FT                   RRKSVLESTSLPGKLADCAEKDPVKSEIYLVEGDSAGGSAKQGRDRKTQAILPLRGKIL
FT                   NVEKSRLDRILSSDEIRNMITAFGCGISNEFDEEKLRYHKIVIMTDADVDGAHIRTLIL
FT                   TFFFRYMRPLIEKGYVYIAQPPLFRIKKGRREEYVYSDKELNERLEEIGRSNQVELQRY
FT                   KGLGEMNAEQLWDTTMNPATRTLLRVTIEDASMADDIFSMLMGDKVEPRRNFIQENAKY
FT                   VKNLDV"
FT   gene            6115..8568
FT                   /gene="gyrA"
FT                   /locus_tag="CLOST_0006"
FT   CDS             6115..8568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="CLOST_0006"
FT                   /product="DNA gyrase (type II topoisomerase), subunit A"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1850970, 1850972, 2168148, 2548439, 2828631, 2830458,
FT                   2834621, 3029031, 3031051, 91139640, 91205604, 92283777,
FT                   9278055; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20138"
FT                   /db_xref="GOA:E3PQZ2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20138.1"
FT                   /translation="MSEEKNEMIDKIVDIEIEDEMRKSYIDYAMSVIVGRALPDVRDGL
FT                   KPVHRRILFAMNDLGLVPEKSYRKSATVVGDVLGKYHPHGDTAVYDAMVKLAQDFSTRY
FT                   PLVNGHGNFGSIDGDSAAAMRYTEAKMQKLTLELLKDIDKETVDFTLNYDERLKEPSVL
FT                   PARYPNLLVNGSNGIAVGMATSIPPHNLREVIDAVVELIDNEEATVEDMMKHIKGPDFP
FT                   TGATIMGKGSIRDAYMTGRGKVTVRSKADIEELPNGKSQIIVTEIPYQVNKARMIEKIA
FT                   DLVKDKRIEGITDLRDESNRDGIRIVIEVRRDVNPNIVLNNLYKHSQLQDVFSIIMLSL
FT                   VNGEPKVLNIRDMLVHYLNHQKNVVRRRTEYDLRKAKERAHILEGLIIALDNIDRVIKI
FT                   IRGSDNGSIAKEKLTEEFGLSDIQSQAILDMRLQRLTGLERGKIEEEFAELMKNIAYYE
FT                   SILQDQSILLGIIKDEMLKIREKHGDKRRTEITEAADEINILDTIPDEEVTVTFTHYGY
FT                   IKRIPMDTYKAQRRGGKGITSMTTRDDDFVEKLLLTTNHSLILFLTNRGRIYRLNAYEI
FT                   PQSGRIAKGTNIVNLIPLEKNEKVTSFISIRDVPAENYLVMCTKKGVIKKTQISEFRKS
FT                   TRNGLIAISLREDDELINVKTTDGEQDFIIVTKKGMAISFDEKQVRDMGRAAMGVRAIR
FT                   LAPDDEVVAMELVDPNKQLLVISEKGYGKRTNTKDYRLQTRGGKGVKTYKISEKTGILV
FT                   GAKAVYKDEEIMIINSDGSLIRMSVNQISILSRVTSGVKVMRTDENSLVVALARIVVPK
FT                   EDENI"
FT   gene            8862..10079
FT                   /locus_tag="CLOST_0007"
FT   CDS             8862..10079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0007"
FT                   /product="putative phosphodiesterase"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20139"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20139.1"
FT                   /translation="MDVFVARQPIFDRNKAVVAYELLYRDSAANFFNSEIGATKATSIL
FT                   LSNSYFNFGIEMLLEDKRAFINFDKVLIKNEVPLLLDKSKIVVEILEDVIPDKNFMTKL
FT                   KELKNSGYTLALDDFTIDYPYKEIIEIVDIIKVDFMLSSKEDIKKIIKKYSNGNKKFLA
FT                   EKIENVDEFNNAVSLGYDYFQGYFFSKPIMVQGKKIESLEISYIKLTNEINKEEPNYKI
FT                   IASIIESDLDMSYKLLKIVNSYSLSSKVNSIPHAVSLMGISELRKWASLVLIGELSFGK
FT                   PTEILRLSILRSKFAELLAEKSSYKSKKHELALVGLFSMIDVLLQKPLDAIFSQLHVSD
FT                   EIKLAIKLDSRSEFYPIYKLVMDYEMGNWEEMDKDLKLLNIYRNIPDIYIQAVKTTDDI
FT                   VKFIKE"
FT   gene            10224..10523
FT                   /locus_tag="CLOST_0008"
FT   CDS             10224..10523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0008"
FT                   /product="putative exported protein precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20140"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20140.1"
FT                   /translation="MSKQSKAGMFLLGGILGAAAGLLFAPKKGVELRENLFEKTMDILT
FT                   DSQGVKEDICSWISNFRHDEDIERPEEEIIISKDFTYKEEPPVDINLEINKETN"
FT   gene            10539..10826
FT                   /locus_tag="CLOST_0009"
FT   CDS             10539..10826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0009"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20141"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20141.1"
FT                   /translation="MEFRIWELGIVMIGLGFLIVCINLAFTIKNVDNTVKKVELLVDDN
FT                   LSEIGQIIGSVAGITTSVDTIVGSATKIVGLVSSAKIISSLGKNKDSRRD"
FT   gene            10829..11149
FT                   /gene="rsbV"
FT                   /locus_tag="CLOST_0010"
FT   CDS             10829..11149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="CLOST_0010"
FT                   /product="anti sigma b factor antagonist RsbV"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20142"
FT                   /db_xref="GOA:E3PQZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20142.1"
FT                   /translation="MSVVINSSFDAEKKIWNLKLGGEIDIYTSNNFKEELQKIYLSEET
FT                   GDVYIDASDLEYIDSAGLGVLIGALKRLKQKDKDIYIRETKPNVKKIFNITGLDKIFKL
FT                   EG"
FT   gene            11152..11604
FT                   /gene="rsbW"
FT                   /locus_tag="CLOST_0011"
FT   CDS             11152..11604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="CLOST_0011"
FT                   /product="RsbW"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20143"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20143.1"
FT                   /translation="MVEINSNNFGVTNGETYDSISMALPSKPEYVGVVRLTVSAIANRM
FT                   GFNIEEIEDIKVAVAEACTNAIKHGLNQDFNVCFDIFEEKITVSIKDNGKGYNTDALNE
FT                   PDLEDPKEEGGLGIFIIKSLMDEVTLKSSVGQGTEIKMIKFLGDGN"
FT   gene            11604..12425
FT                   /gene="sigB"
FT                   /locus_tag="CLOST_0012"
FT   CDS             11604..12425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="CLOST_0012"
FT                   /product="RNA polymerase sigma-37 factor (sigma-B)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20144"
FT                   /db_xref="GOA:E3PR02"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20144.1"
FT                   /translation="MGDVAQKKAKSSKSSQKPYAGSAKYKDITDKELFLIYSENKAIEL
FT                   RNELVKRHLYIAEILSKKFLNKGIEYEDIYQVASLGLIFAIERFDVSKGFEFSSFATPT
FT                   IIGEIKKYFRDKGWSIRVPRRIQELSKKVNTAKSYLQQELHRVPKIEDIAKYLDCTEEE
FT                   VLEAIEASHVYKPKSLDLSYDNEGDDKDILLLDLVGDEDKSFNMIENKDFIENALSKLN
FT                   EIETKIIKDRFFKNKTQMHVANDLGVSQMTVSRMEKKILAKLKKDYEKSLY"
FT   gene            12634..14211
FT                   /locus_tag="CLOST_0013"
FT   CDS             12634..14211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0013"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20145"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20145.1"
FT                   /translation="MNKVLKNIVNITMILVVILPLFTNNVFAYEEQKIDKLIEEYKFGE
FT                   AYKILKENLYDEDKNIDPIKIRKILELEFIVTDTSSMLLHALELVEYGQNSKDYYNQMI
FT                   GYYYLGSVYYELYDDTKAIENFEKMLSIAQSKNYPLGKGMYYMFTGLIYSSYEDYDLAL
FT                   ENFTKAQPYFEEAHLDEHWIFSDFKKDNKFMIDLINIIIGNSQDKSRDFFNLGNSFKDE
FT                   NWNMKYSFMSRCGYELNKIGAFKEAAYMLEESIKTIALADFGDMYNKFSGYLNYDLAYS
FT                   YYSMGDFKRASELLLDEDYTTNNTKLEVERGELINQKLREIENKEIKRQSETKTKIISA
FT                   ISALLVFLLITVVIIIRQYKITDKLNQEVYEKSIRDNMTGLFNRAEIISIYEINMDRDI
FT                   ALGVIDIDDFKNINDTYGHAIGDIVIKDISSIIQNVVGDKGYVGRYGGEEFLVILNKSD
FT                   QYDSKKLLEEIRISIENKKWFFKDSPITVSIGLLNEAKNTSFNNGFKVADELLYLAKRN
FT                   GKNIICHI"
FT   gene            14658..15830
FT                   /locus_tag="CLOST_16S_3"
FT   rRNA            14658..15830
FT                   /locus_tag="CLOST_16S_3"
FT                   /product="ribosomal RNA 16S"
FT   gene            16119..18526
FT                   /locus_tag="CLOST_23S_3"
FT   rRNA            16119..18526
FT                   /locus_tag="CLOST_23S_3"
FT                   /product="ribosomal RNA 23S"
FT   gene            19098..19194
FT                   /locus_tag="CLOST_5S_3"
FT   rRNA            19098..19194
FT                   /locus_tag="CLOST_5S_3"
FT                   /product="ribosomal RNA 5S"
FT   gene            19470..20453
FT                   /gene="asd"
FT                   /locus_tag="CLOST_0016"
FT   CDS             19470..20453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="CLOST_0016"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20146"
FT                   /db_xref="GOA:E3PQZ7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20146.1"
FT                   /translation="MKKFNVAVVGATGMVGRMMLKVLEERTFPIENLYLFSSGKSKGTK
FT                   ITFCDKEYTVEELDEHSFDRKIDIALFSAGGDVSKTYAPIAKSKGTVVIDNSSAWRMDK
FT                   DVPLIVPEVNPDDVKWQSGIIANPNCSTIQSVVPLVKLHERFKIKRIVYSTYQSVSGSG
FT                   VGGIKDLEEGMKGQPPQKYPHPIAYNCIPHIDVFNEDGYTKEEIKMIKETQKILGDESI
FT                   RVTATTVRVPVKYSHSVSINLEFEKPFELDEVFSLLKSTDGVVVVDDVKNNIYPMAIHA
FT                   EGKDEVFVGRVRRDFSIENGLNMWVVADNIRKGAATNSVQIAELFL"
FT   gene            20522..20947
FT                   /locus_tag="CLOST_0017"
FT   CDS             20522..20947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0017"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20147"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20147.1"
FT                   /translation="MSEEQYKKTYKPLIAWMISFPIILTLPSILLSEFTDKIEIAVTLA
FT                   MLMLSVYGLILIIYHGEYVYWINGGPSFKEAKDASSEVRKEYARAHLEKFRNVFIKGFI
FT                   YLISSLVLNLSIWIDIVVVSLMIIVAAIKTMPIKFKN"
FT   gene            21094..21354
FT                   /locus_tag="CLOST_misc_RNA_22"
FT   misc_RNA        21094..21354
FT                   /locus_tag="CLOST_misc_RNA_22"
FT                   /product="T-box"
FT                   /inference="profile:Rfam:8.1"
FT   gene            21415..23517
FT                   /gene="aspS"
FT                   /locus_tag="CLOST_0018"
FT   CDS             21415..23517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="CLOST_0018"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number="6.1.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10562565, 10873442, 1885548, 1944398, 2129559, 92112640,
FT                   93352541; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20148"
FT                   /db_xref="GOA:E3PQZ9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E3PQZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20148.1"
FT                   /translation="MAEFMAGLKRTVYCNVLREKDIDTNQIVMGWVQRRRDLGGVIFLD
FT                   LRDKTGIIQVVIDAKNVSEEDFEKAEGIRSEYVVAIKGRVEKRDEDTINPNLETGTIDI
FT                   RATEVRILSKAKTPPFMIEDASLVKEELRLTHRYLDLRRPAMLENLKMRQQVISTVRNY
FT                   LIEQDFLEVETPILTKSTPEGARDFLVPSRMDKGTFYALPQSPQIYKQLLMVGGVDKYF
FT                   QVAKCFRDEDLRADRQPEFTQLDMELSFVDQEDVIELLEHLFSKIGSDVLKREFKTPFR
FT                   RLTYDEAMSLYGSDKPDTRFGFEMVDLTDIAKTCSFEVFSKIANSTGIVKAINVKGGDS
FT                   FTRTQIEELTEKAVSYGGKGMAWIAIGQDKELKSVLTKFFKKEEMDSILDKMQAEPGDL
FT                   IIFCADKESAVYKILGGLRLDAADMLGLRKKDDFEFLVVTDFPLLEWSEEEKRYVAMHH
FT                   PFTMPKDEDFALMESDPGLVRAKSYDIVLNGVELGSGSIRIHEQELQAKMFSLLGFSEE
FT                   EAKERFGFMLEAFEYGTPPHGGFAFGIDRLVMLLTGSSSIREVIAFPKMRDGSCVMISS
FT                   PSTVSDDQLSELELYTKAQGAVIKKSESKSAVTKETIEYVADLARIHLDESEKMSLSED
FT                   LSNIIAFADELSKLDTSDTLPLDHILPVCNVFREDELEKSYDRDELLKNAKTKEEGCFF
FT                   VPQIIE"
FT   gene            23616..25091
FT                   /gene="gatA"
FT                   /locus_tag="CLOST_0019"
FT   CDS             23616..25091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="CLOST_0019"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADT subunit A)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20149"
FT                   /db_xref="GOA:E3PR00"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20149.1"
FT                   /translation="MKTRIIDMSIKELESALDKSEISSVDIAKSYIAQIEKVDDKIGAY
FT                   LYINKEAVKQAEALDTKRKNGEKLGRLAGMPMALKDNMCTVDMPTTCASKMMQGYMSPF
FT                   DAEVVKRLKGEDAIMLGKVNLDEFAMGGSTENSYYKITTNPHDISRVPGGSSGGSAASV
FT                   VSHQALVALGSDTGGSIRQPASFCGAVGIKPTYGSVSRSGLVAFASSLDQIGPIARNVE
FT                   DAALTLEVLIGHDAKDSTSVKFEKPSYETEIKKDIKGMKIALPREFFEQGVQSDVKESI
FT                   LKAAEKFEKLGAIVEDVKIKNLDYALSAYYIISSAEASSNLARFDSIQYGYRTDEYASL
FT                   EELYKKSRQEGFGKEVKRRILLGTYALSSGFYDAYYKKALKVRTLIKQSYDEIFKDYDM
FT                   ILSPVAPTTAYKIGEKRTDPVEAYMGDIYTVPVNIAGLPALSMNCGFDKEELPVGMQLI
FT                   GSTFSEDTLLRAAYNYEQAYKTEITKTGGVYGG"
FT   gene            25105..26511
FT                   /gene="gatB"
FT                   /locus_tag="CLOST_0020"
FT   CDS             25105..26511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="CLOST_0020"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20150"
FT                   /db_xref="GOA:E3PR04"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20150.1"
FT                   /translation="MVIGLEVHVELDTNTKIFCGCSTKFGASPNTQTCPVCMGLPGSLP
FT                   VLNKKVVDYAVKAGIATNCSITPRGKQDRKNYFYPDLAKAYQVSQYDLPLCHDGYIEIE
FT                   EENENYKIGITRIHIEEDAGKLIHTDGGSLIDYNRAGVPLIEIVSEPDIRSAAQAKAYL
FT                   QKLRSIIMYAGISDCKMNEGSFRCDVNLSVREKGSEILGTRTEMKNLNSFSFIVKAIES
FT                   EFKRQIEVIESGDEVIQETRRWDQELGKSFSMRTKEDAHDYRYFPDPDLAPIVITKEKL
FT                   KEIKDSIEVLPDQRKKTYMDSYGLTAYEADKLVSEKFIADFYEEAVKEGSAKLVANLML
FT                   SEVFRLLGKEEEAEKIPFAPSKLGVLAKRIEEDVISQSMAKKIVELLWKSDKDVDEIIE
FT                   KEDMRQITDVALLEGIISKLIAENEDIVSSYKAGKEKAFQALVGSVMRQTKGKASPSLT
FT                   AKILSELITK"
FT   gene            26819..30253
FT                   /gene="pycA"
FT                   /locus_tag="CLOST_0021"
FT   CDS             26819..30253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycA"
FT                   /locus_tag="CLOST_0021"
FT                   /product="pyruvate carboxylase"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="6.4.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15134465, 6425269; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20151"
FT                   /db_xref="GOA:E3PR05"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20151.1"
FT                   /translation="MKKFKRILVANRGEIAIRVFRACKELGIRSVAIYSNEDRTSLFRT
FT                   KADESYLVGKNKGPVEAYLGIDEIIGLALKKGVDAIHPGYGFLSENAEFARKCAEAGIV
FT                   FIGPTGDMIDNLGDKIKSKIVAKNANVPTIPGVEKPIKSDEEAKEFAAFCGYPVMIKAA
FT                   AGGGGRGMRIVTKEEELLEAFHSAQSEAKKAFGIDDIFIEKYLEKPKHIEVQILGDTHG
FT                   NIVHLYERDCSIQRRHQKLIEFTPAVSLTQKKREQICQDALKIAKAVDYCNAGTVEFLV
FT                   DKNGNHYFIEMNPRIQVEHTVTEMVTGYDIVQSQILVAQGYSLDSPEVGIASQADIKPR
FT                   GFAIQCRVTTEDPSNNFAPDTGKIDVYRTGSGFGIRLDGGNGFTGSVISPYYDSLLVKV
FT                   TAQSRTFEDTIRKAIRSIKELSVAGVKTNTGFLINVLNREEFHKGLCDTHFIADNPSLF
FT                   DIAPKTDKELKVLRYIGEKVVNETKGSKKDFDVPVAPMPPRPSGLVGTKQILDAKGPEG
FT                   LVSWIHEQKKLLITDTTMRDAHQSLMATRVRTRDMTRIARATSVYGNDLFSLEMWGGAT
FT                   FDVAYRFLNESPWERLEDLRQRIPNVMFQMLLRGSNAVGYKNYPDNVIKAFIKQSSISG
FT                   IDIFRIFDSLNWLDGMKLAIEEVRNNNKVAEACICYTGDILDETRDKYTLKYYVDMAKE
FT                   LERLGANILGIKDMAALLKPYAADKLIRALKQEISIPIHLHTHDTSGNGVATVLMAAEA
FT                   GVDIADTAFNSMSGLTSQPALNSVVAALENTSRATGINLDNIEEISRYWEAVRPVYAKF
FT                   ESDLKSGTTEVYKYEIPGGQYSNLKPQVESFGLGHKFKEVKEMYKNVNEMVGDIVKVTP
FT                   SSKMVGDFAIFMVQNDLTPENITQKGQDLTYPDSVVTYFKGMMGQPMGGFPKDIQEMVL
FT                   KGEEPVTVRPGQLLEEEDFEAIMLYLKKTHKIEPNMKDALSYALYPKVFEDYLKYIKDY
FT                   GDLSRMGSDIFFHGLSEGETCEVEIAKGKILVIKLLEIGKVDKEGSRLLAFEVNGNRRE
FT                   IKIYDKNSGQENKVTFTQMADPDNKMEIGASIPGTVLKILVKEGDVVEEKQSLMVVEAM
FT                   KMETNIVAMQAGKIEAILVKEQQQVKSGELLIKLEEI"
FT   gene            complement(30419..31048)
FT                   /locus_tag="CLOST_0022"
FT   CDS             complement(30419..31048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0022"
FT                   /product="putative Regulatory protein, TetR"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20152"
FT                   /db_xref="GOA:E3PR06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20152.1"
FT                   /translation="MPKETFFNLPEEKRQNIYNIAIDEFSNKPYEKVSISQIVSRAKIA
FT                   KGSFYQYFEDKEDLYTYLIDIIGQEKIKFMEKDFDKIEDMDFFEFVRLLYRNGVKFAAA
FT                   EPNLTKIATGFMVNIPKDLKNKIISRNTTSAVDLFNAFIQKAMDKNELRDDIDVNLTSQ
FT                   ILTHMSIAITEFYFDNSNNVSEENFENLLKSADAMIDILKFGLKKQ"
FT   gene            31189..32538
FT                   /locus_tag="CLOST_0023"
FT   CDS             31189..32538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0023"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20153"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20153.1"
FT                   /translation="MKFFTEEAFRNKLIGLLGVLVLFLSQNYVEEVIGSKNAYKSNLYV
FT                   NFELYVNQLESLDTYLTSVQEINNINEIRPVYIENSVMTLMERNRMNMAIVQKKSVNSE
FT                   YFFDAIEVYSGVNKNIEAIISDDSVSEKELIYIKELSKFNRANLENAKQLIEYDNNNYD
FT                   ERKKLEKEIFEIYKEHIEFMSKAYEKSSPENLKLQMEVAKEENNISKESVREKLAKISK
FT                   RVTGLDTLSYFGEPYADERYSWSYTTKKDPKSLDRTDEDVYTFEYVIAENKVNFYQSYR
FT                   IFNEEQEELTEDKMRALADEHINKLGIGGEFVSSEKNKYEYVSENDNRDFDYMTFYYNN
FT                   KDNDIYNESSNIEVKVEKNGRLDSRFYLVTSEPEINWADESLVKEKFNNESKIQSIIKV
FT                   VNSKNEGEFLVMTKEEDKLYIYVYDGESAELKLYDKLDKDRHPFYHRILM"
FT   gene            32569..34218
FT                   /locus_tag="CLOST_0024"
FT   CDS             32569..34218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0024"
FT                   /product="Peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20154"
FT                   /db_xref="GOA:E3PR89"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20154.1"
FT                   /translation="MVKIDFEEIEKDVLDILKRYIAIPSYTNTKSERLVEQFLMSYCKT
FT                   QPYYQANPDYYGLYKIENDPHNRRVFWNMVKGTGNETIVFIHHSDIVEIDDYGRFKSDA
FT                   FNPEPLIGKLRQIKETFDEEIKTDLDSGDYIFGRGTADMKGGGAIQLALMKQYAKAENF
FT                   KGNIVLIVVPDEENLSAGMRGGVKLLSTLKEIYGFDYKLMINSEPHRREDEAKGAFYEG
FT                   SIGKLMSFVYVRGVLAHAGNVLDGFNPVNLMSEIVRRTEINMELADSLDDEVTVPPTWL
FT                   YMKDSKSFYDVSLPLSMYGCLSVLTLSNTPKDILLKLEKICTDSFENVLETMKKNYEVY
FT                   SRYQTKPMNYKVKVKDFYGIYTEAKNLYGESFEMAYKEKFSKLKTGFASGELTMLDANF
FT                   ELVDFVIGYIPSEPTVVYGLMPPYYPHVSNKLFENTDPKITALNNLINEFTVANFGEQY
FT                   NKVNFFPGISDLSYTNVINADETKKALKDAMPLFETLYDVPIEDIKEIAMPCVNIGPWG
FT                   KDLHKLTERVYKVDLLNRTPRLIDHVLQNILG"
FT   gene            34256..35083
FT                   /locus_tag="CLOST_0025"
FT   CDS             34256..35083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0025"
FT                   /product="putative Abortive infection protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20155"
FT                   /db_xref="GOA:E3PR90"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20155.1"
FT                   /translation="MKKIFSAGMFVLIYLAVYYVFQYTYIIVATTYYYVSDTKLQNLEV
FT                   MDWLNNKLPSAIVFAAAISFLVYAWIVKASKKKDIFDYCKFNPISLPKTTALILAGLSL
FT                   VSLNALVVVGISMLLPEAYEAHVENMMGLTSSGGLWMIFSVGLAAPFIEEVMFRGLITN
FT                   ELDRVMSYKWVLFIQALLFGLYHMNVAQGIYTFILAIFMGLTLHWTNSIWAPMIIHIAN
FT                   NLSSALMSEYIDASSDIVNIGFGIWIGLSLLFILPFTLKYLYKTRNEWTSEEY"
FT   gene            35450..36985
FT                   /gene="hutH"
FT                   /locus_tag="CLOST_0026"
FT   CDS             35450..36985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="CLOST_0026"
FT                   /product="Histidine ammonia-lyase (Histidase)"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20156"
FT                   /db_xref="GOA:E3PR91"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20156.1"
FT                   /translation="MQNIILTGNTLTLEDLVEVARHGATVELSEEARQNVITSRAIVED
FT                   IVAKDKVVYGITTGFGEFSKVKISQEDCAQLQENLIRSHACGYGPYFTTDIVRAIMLTR
FT                   ANALSKGYSGVRPQTLETLIAMLNKGVHPLVPEKGSLGASGDLAPLSHMVLPMLGLGEA
FT                   EYQGVHMSGKEAMDKAGIPIIKLDAKEGLALINGTQVLTSTGALAVYDAIGLIKLSDIT
FT                   AALSVEALRGITDAYDPRIHVIRNQRGQMVTAKNMLKLLEGSTYATRQGELRVQDAYSL
FT                   RCVPQVHGASKDTILYVKEKVELELNAVTDNPIVTREGDIISGGNFHGEPMAVVFDFLG
FT                   IGAAEIGGISERRLERLINPQLNDLPAFLTKDGGLSSGFMITQYAAAALVSENKILAHP
FT                   ASVDSIPSSANQEDIVSMGTIAARTARDIIDNVKRVLTTELMAACQAIDFRANDGFVLG
FT                   KGTQPAYDVIRRDVKFMERDNDIEMYKELDKITALIDSREILTAVEKAVELEY"
FT   gene            37035..39065
FT                   /gene="hutU"
FT                   /locus_tag="CLOST_0027"
FT   CDS             37035..39065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutU"
FT                   /locus_tag="CLOST_0027"
FT                   /product="urocanase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15313616, 17395359; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20157"
FT                   /db_xref="GOA:E3PR92"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20157.1"
FT                   /translation="MMKNTEIAGAMTIKLDDFLPEMPKFEEGIRRAPDRGFRLTKEQTE
FT                   VALKNALRYIPEKYHAQMIPEFLEELTTKGRIYGYRFRPEGRIYGKSINDYKGNCVEGK
FT                   AFQVMIDNNLDFEIALYPYELVTYGETGSVCQNWMQYQLIKKYLEVMTQDQTLVIESGH
FT                   PLGLFKSKPDAPRVIITNALMIGMFDNMKDWEIAEQMGVANYGQMTAGGWMYIGPQGIV
FT                   HGTYNTLLNAGRLKLGLGKDANLEGKLFITSGLGGMSGAQGKACEIAKGVAIIAEVDES
FT                   RIETRHSQGWVSKKSADLKEVFAWAKEAQESKTSISIAYHGNIVDVLKYAVDNNIHIDL
FT                   LSDQTSCHNVYDGGYCPEGITFEERTRLLAQEPEKFRAMVESTLKHHYELIKTLTSRGV
FT                   YFFDYGNAFMKSIYDAGVKEIAKNGIDEKDGFIWPSYVEDIMGPLLFDYGYGPFRWVCL
FT                   TGDHEDLVKTDRAAMDCIDPNRRYQDLDNYNWIRDAEENKMVVGTQARILYQDAEGRVN
FT                   IALKFNDMVRKGEVGPIMLGRDHHDVSGTDSPFRETSNIKDGSNVMADMAVQCYAGNAA
FT                   RGMSLIALHNGGGVGIGKSINGGFGLVLDGSHRVDEIIKSAMLWDVMGGVARRSWARNE
FT                   NSIETSAKFNENYAGSGHITLPYVADDSAVKSAVAKIFEGK"
FT   gene            39233..39889
FT                   /locus_tag="CLOST_0028"
FT   CDS             39233..39889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0028"
FT                   /product="Glycine betaine transport system permease protein
FT                   / Glycine betaine-binding protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20158"
FT                   /db_xref="GOA:E3PR93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20158.1"
FT                   /translation="MSKITFIKNVFSLFMERKEFFLTLFIQHMYLTFLAILIITVIGIA
FT                   VGIYMTRNKVLAGFIMGTVNIIYTIPSIALFGFLVALTGVGNKSALIALCIYGLLPVIR
FT                   NTYVGINEVDPFLIQAATGMGSTDRQLLLKVQIPLALPVIFAGFRTMVVMTIALGAIAS
FT                   FIGAGGLGVAIWRGITTNFPEMTFAGSLLVAGLAFVVDFILGLIERLMKNQYVST"
FT   gene            39900..40787
FT                   /locus_tag="CLOST_0029"
FT   CDS             39900..40787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0029"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20159"
FT                   /db_xref="GOA:E3PR94"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20159.1"
FT                   /translation="MKRILAGLILTAILLTLTACSSQEPKTVVIASKPHSEQYILAEML
FT                   SLLIENHTDIKVEKKLGIGGGTSNIHPAMLSGDFDIYPEYTGTGLLFVLKEDLITDSDE
FT                   LYKRVQDRYLEEYNIKWLGLYGFNNTYALAVKESTAQTYNLETYDDLALASKDLVFGAE
FT                   HDFFERDDGYEALKDVYGFEFKDTKEMDIGLKYEAIGSDEVDVINAFSTDGLIKQYNLK
FT                   VLEDNKNFFPAYQAATLIRKETLDKYPELEAVLGKLTGQISDDEMIQMNYQVEKENMDP
FT                   RDVAEQFLKAKGLI"
FT   gene            40787..41743
FT                   /gene="yehX"
FT                   /locus_tag="CLOST_0030"
FT   CDS             40787..41743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehX"
FT                   /locus_tag="CLOST_0030"
FT                   /product="putative transporter subunit: ATP-binding
FT                   component of ABC superfamily transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20160"
FT                   /db_xref="GOA:E3PR95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20160.1"
FT                   /translation="MAIIEFNDVSKAYSENVVLDKFSLAIEQGEFLVLLGPSGCGKTTI
FT                   LKMINGLLIPDSGEIKVKGKLIDEYDLIELRRGIGYVIQQIGLLPHLTVEDNICFVLDL
FT                   LKKPEPEKKSVAKELIKLVGMDEGMLRRYPKELSGGQQQRVGVARALAANPEIILMDEP
FT                   FGAVDEITRRNLQDELIKIHSKLKKTIIFVTHDIEEAIKLGTRIVLLNDGVIERNEKKR
FT                   DFVLLDDRSEYAKKFFESKDFMAYLNTIKIKDLVIKQSDISFDLYDSRSLVKYDSTVLQ
FT                   GIQKSIEVGKETILTVDEENNPYGWFSLTEIYKKLNS"
FT   gene            41862..43943
FT                   /locus_tag="CLOST_0031"
FT   CDS             41862..43943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0031"
FT                   /product="Methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20161"
FT                   /db_xref="GOA:E3PR96"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20161.1"
FT                   /translation="MGKNVQQSIQTKSGLAKQILVTLLPPILIVMVVLSSIGYMYSKMM
FT                   IEEEISYQMEYKLEHTIAEINQSLIAHKRLGEALGKTVASNPNALTQPEYEALLESYLE
FT                   VNADTFGIGVWFEPNIYNNMPAYSPYAYKDGAGVVIDNSYWTEGVDIWNESWYRIGADS
FT                   SGEGAWSEPYYDPGTDVTMITFSYPIVRDSAVIGVITADIDLTSIQKMVADVELAKGGS
FT                   ALLISKEGLYMAGINKDAIMKNNIVEDETTLFHSVSGDILSGKPGNTSIEANGGKNLIY
FT                   YDMAKETNWAVVIEIPEKQLFEGLNKLLGIFAATCIGSIIILAIIIAYFASNLSKRSKR
FT                   ISKVAEHISDGYLAEEIDAKDVNKNDELGDIARGFSNMQQKLQSIIGGFKEDSVKIDES
FT                   SKLLSSFSQDMSTTAESVAMAISDVAAGSADQFEKLKLISETMYGFAEDIEQMSKEVKG
FT                   IEESSSNIKTLADSSSTEMNMVTESFDGLYNNFSSLIEKVKLVGDNVSKVNEITELINE
FT                   ISDQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEKSRESSEEINSIISSVAVETD
FT                   GMINSTKAVSEEINEQKSNIQKAIESFENIKDSVDEIKPKIDKAYEESQRIIEKKDDIL
FT                   VNINLVSEISENSAATAQEIAASAEEMSASVEEVTSSAITLNSMTEEMKERVEFFKMD"
FT   gene            complement(44034..46082)
FT                   /locus_tag="CLOST_0032"
FT   CDS             complement(44034..46082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0032"
FT                   /product="Membrane associated methyl-accepting chemotaxis
FT                   protein (With HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20162"
FT                   /db_xref="GOA:E3PR97"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20162.1"
FT                   /translation="MGFSSIKKKLVFIFSLIILIPMLTTGFVSNMILYKTLSNSYTEQL
FT                   NTTVGNISSIIDENYSGYEAILSQLTENSIAKSSAVIEADIVKKELNGFINANNEILNV
FT                   YIATKNKNMYIYPETELPEGYDPTGKSWYKESLTNSGAILWQDAYTDVATGNTVVTATK
FT                   EIKDEASNQIGVAGIDIDISNLSSLFSDTNIEKTGEVILLDKTGMILASKREDLLGKNL
FT                   NPNRIDTDEDTKDQVVENAFTNPEEADWVGELIDKETSSFEANVFGTDKFIYSLRNDKT
FT                   GWVLIGMIDKKEVYSEIMSMMMTLIGLFAAFIIVALIIGIYVSKSLTNPIKTLKESMEK
FT                   GEQGDLTAVAHIKSKDELGELGTRFTNMLASVKNLVYTVKLSSNNVVNVSEDLTTKAND
FT                   VSSISEEIAKVMDELSLGIQNQAEETEKASQISVEFNENLSKVKDYSNKIAQESETMET
FT                   SNIEAKNAVLELKSKNENTISGMSYIEDSINTLVKETKNIEQILSTILDISSQTNLLAL
FT                   NAAIEAARAGESGRGFAVVAEEVRKLAEQSGNSAENIREIITTIVDTTKVASGNMDNIK
FT                   EDLQKQSSAVSLTETSFDKLNSAIDNIVDKLSGMNDSIEIMTNNSILLTTNIQNISAVS
FT                   EQSSAATQEVNASIMNQLNDIQNVKNQANELYELARDLDVHIEKFKI"
FT   gene            46339..49206
FT                   /locus_tag="CLOST_0033"
FT   CDS             46339..49206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0033"
FT                   /product="putative Serine/threonine kinase, regulatory
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20163"
FT                   /db_xref="GOA:E3PR98"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20163.1"
FT                   /translation="MSIVCNIFGIPSIKKGNAEVSFPYKKAKAIFFYLLVNNHSTRDEL
FT                   ASLFWDELSDSLAKKNLRNALYQIRSLLGDDILLSSEKSLVVLNTDIITYTNPEALSEP
FT                   EVFIKAYKGEFLQGFSIKNAPLFEQWYTQAKQQYKEKYIQNLYTSINEEKAKSEINWNK
FT                   IIKYAKLLTEVDDFDEKAYQILLEGYKNTKAYSQAIESYNKLKSTLERELGIEPDEATT
FT                   TIFNEVLDAMNEKRQNTVSDFSESFGKYSQLRLLEQNQEEFMLDKPPTSFVILGEAGIG
FT                   KSNLISNFLNRLDKKTVLIFKSKCIKTQKNHPYSYFKNLLVNEIGDKALINSWNEHLKS
FT                   IISMMEGNEESILDLMESFFWDAFVAMFKDSNSKIILYIEDIHNMDEKSRNLLEYLLTN
FT                   NISTYMIGSSSIKDKNMISKQFLALIENQRLEFISLSRWDYSKVKLFISQQLPKHMQTE
FT                   TLFDDVYFETQGNFLFIKYYVAAVLSGKDPKRISSDMVFYFEERLNDLSNPAQDVAKLI
FT                   SFFFEDTSFEMINSLSDIKESKLIDVIQELTDKDILKESIQNDSIRFSFTHPKLRQYIY
FT                   ESQTEIKRRFIHNQIGDVIEKQLHDKPADMDLYHRLIFHYMRGANKVKALDYSVKSLNR
FT                   YLNYSHELFPILASGDEALFKDAYMSRKQTQAYLLEIENLLKEVRQKEGQTRDVIIGEI
FT                   AFLHMKGRYLIREGSYEEGTKYINEMISKSIEINDDDYALEAYKQMIYYCIQISEADKM
FT                   QEYIQLALDIAIRRNYHKETGIILRFKGLYYILKKEYTLAREVLTSSINTFTISKEVAE
FT                   KYALNIAAAYNYIGEIHRINNNYHEAIIAYEKAIEIGKSKNAYTSLMVFCINAGQAMYH
FT                   KKDYDKAKEYLDYAKHCQSMVDILWKKAVLDVYLGLIYIINKDKASGMKLIKTAETEAK
FT                   KMKNPEEIGLVAWAKQEAKAHLESR"
FT   gene            49302..50831
FT                   /locus_tag="CLOST_0034"
FT   CDS             49302..50831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0034"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20164"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20164.1"
FT                   /translation="MKKRLAGMFLALMLIIMPFTGCTAQDAVGTTVTETSSALQIDSTY
FT                   FTDRDSKIDYEESTASKIVLSSTTAKITGDGAKLEDKTVKITKEGTYILSGSSDGLNVV
FT                   VEAADTEKVWLVFDNISMKGVSAPIQVLTADKVFITLATGSKNTIEDIDVAENEELNAA
FT                   IYSKSDLTINGSGKLIVNGKYEHGIKSSDDLKMLGGSFVITAANDGLNANDALNIKDSV
FT                   IEISVKGDGIHSDKNVYIDGKSLNIKESEEGIEGKVVDIASGDIDIKSSDDGINATDSS
FT                   LKTDTLSTATPQTADGKETLNKNIKNRQIPPEGFDKMPANFEDLPADVQEKIKNRPERP
FT                   EGEAVPEGQMQRPEGMPRGAGFEIQEGTEIIIRGGDLYIDASGDGIDSNGNLTVSGGKA
FT                   VIEGSGSRGDGAIDYNGTGLVKGGEVLALGGSDMLQSFSSESAQSHIVVTAKELIAVGA
FT                   KITIKDEAGKILYEHINKKAFSALVYSSKDLVKAKNYTVQIGDTILETISK"
FT   gene            51154..52404
FT                   /gene="sstT"
FT                   /locus_tag="CLOST_0035"
FT   CDS             51154..52404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sstT"
FT                   /locus_tag="CLOST_0035"
FT                   /product="sodium:serine/threonine symporter"
FT                   /function="1.2 : Aspartate family"
FT                   /function="1.5 : Serine family"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12097162, 99069355; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20165"
FT                   /db_xref="GOA:E3PRA0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20165.1"
FT                   /translation="MNNLLAKWNQISLVKRIIIGLVIGIILALTVPEQAKGVVILGSLF
FT                   VGALKAIAPVLVLFLVMSAISQHKAGQQTNMKSIIGLYLLGTFLAGLIAVLASFVFPLT
FT                   LTLPGTEGLGDLTPPGGVTEVLKTLLMNIVDNPVKAIFNANYIGILAWAVLLGLALKHA
FT                   AQSTKDMISNFADGIAQMVRWVINLAPFGIMGLVFDAIATSGISTLLGYGQLIMLLVGT
FT                   MFFVALVVNPIIVYVYTRKNPYPLVLKCLKDSGITAFFTRSSAANIPVNMSLCEELKLD
FT                   KDTYSVSIPLGATINMAGAAITISVLTLAAVNTLGIEVDLATAVILSVLAAVSACGASG
FT                   VAGGSLLLIPLACSLFGIPNDVAMQMVGVGFIVGVIQDSCETALNSSTDVLFTATAEFA
FT                   KMRKEGKVFDMIPHKAK"
FT   gene            complement(52468..52608)
FT                   /locus_tag="CLOST_0036"
FT   CDS             complement(52468..52608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0036"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20166"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20166.1"
FT                   /translation="MKKFFRLNLDASLKSNFKRIMKQLRKNVTTFDNFSSIAYKQLYVK
FT                   F"
FT   gene            52781..53401
FT                   /locus_tag="CLOST_0037"
FT   CDS             52781..53401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0037"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20167"
FT                   /db_xref="GOA:E3PRA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20167.1"
FT                   /translation="MNIIEFFISRWDAILQMTISHFSIVILAMIISIVLGVIIGILITN
FT                   NKQLAKLILNIANILMTIPSLALFSVLIPIMGIGKAPAIAGLVLYTQLPIIRNVYTGII
FT                   TIDPSIIEAAKGMGLSNSKIMLKIKIPLAFPVIMAGLRTATVMGIGIGAIAAYIGAGGL
FT                   GEYIFQGINRGNDRMIIIGAIMVSLITILVDKSLGLIQKKYEL"
FT   gene            53414..54538
FT                   /gene="yehX"
FT                   /locus_tag="CLOST_0038"
FT   CDS             53414..54538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehX"
FT                   /locus_tag="CLOST_0038"
FT                   /product="putative transporter subunit: ATP-binding
FT                   component of ABC superfamily transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20168"
FT                   /db_xref="GOA:E3PRA6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20168.1"
FT                   /translation="MIRFENVVKKYNELDKMAVDNLNLHIKKGEICMLLGPSGCGKTTT
FT                   MKMINKLIKSTSGNIYIDDKNIDKVDPIKLRLSIGYVIQGTGLFPHMTIGENIAMVPKE
FT                   LGWDKARIDARIDELLELMELDPKVYKDKRPKDLSGGQRQRVGVARALAADPPVMLMDE
FT                   PFGALDPITRGKLQDEFLRVQEKLGKTIVFVTHDIDEAIKMGDKIAIMKEGKLVQYASP
FT                   AEILSQPADDFVAELIGGNGAIKMMNLIKCKDVLRKLPNIDIESESILALNLMKEQGVR
FT                   NIIVKDKNHKILGYVRYKDAFKNQNASLADILNEIGETVSPGTTLKEALSLMFSMGRKA
FT                   IFISKEKGSIDGIITMDDLLKAVNDDEQDEDTLS"
FT   gene            54519..55241
FT                   /gene="yehW"
FT                   /locus_tag="CLOST_0039"
FT   CDS             54519..55241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehW"
FT                   /locus_tag="CLOST_0039"
FT                   /product="putative transporter subunit: permease component
FT                   of ABC superfamily transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20169"
FT                   /db_xref="GOA:E3PRA7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20169.1"
FT                   /translation="MKIRSADIRQFALMTIIVVILAMLSYYVVNYPQDKIVERFISYER
FT                   ILRATKEHIYIVAISSVLSIFTAVPLGILITRTNFKKFANKVLGVVNIGQTIPSLAIVA
FT                   LFVGVFGIGAKTAILALWIYSLLPILRNTMVGILNLDESVLEAARGMGMTQFRILNKIE
FT                   LPLAMPIILAGIRTAITINIGTAVLAAFVGGGGLGDLIISGNNINRWQIRVLGASFPAL
FT                   LAIFVDTMFAFIEEKTAV"
FT   gene            55262..56203
FT                   /gene="yehZ"
FT                   /locus_tag="CLOST_0040"
FT   CDS             55262..56203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yehZ"
FT                   /locus_tag="CLOST_0040"
FT                   /product="putative transporter subunit: periplasmic-binding
FT                   component of ABC superfamily"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20170"
FT                   /db_xref="GOA:E3PRB1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20170.1"
FT                   /translation="MVRVNMFSKRLSMLFGLIMVVLLILSGCTSGTNESQNKIRVGSKD
FT                   FTEQLILGQITLLALEDAGFEVEDKTNVAGSEQVRSALENDEIDVYWEYTGTGWLMHLQ
FT                   KDEVITNSQEAYEKVKSEDKEANDIVWLDYASLNNTYTIMMNKDDSEKLNIKSISDMAN
FT                   YVNENPGQLSFAADHEFTARPDGLPALEDEYGFAFDGDSLKVMDIGIVYRTLKDRQVDS
FT                   GMGFATDGRIAAFDFVNLEDDMEFFPVYNAAATLRAETLEKHPELADVLNKITEKLDNE
FT                   TMIKMNYQVDIEEKEPKEVAKNWLEEEGLINK"
FT   gene            complement(56308..57159)
FT                   /gene="speB"
FT                   /locus_tag="CLOST_0041"
FT   CDS             complement(56308..57159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speB"
FT                   /locus_tag="CLOST_0041"
FT                   /product="agmatinase"
FT                   /function="16.8 : Protect"
FT                   /function="16.3 : Control"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="3.5.3.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10931887, 9723923; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20171"
FT                   /db_xref="GOA:E3PRB2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20171.1"
FT                   /translation="MNKNIFTFIGFDNEFEESQIVLFGAPFDGTTSFRPGTRFAPNIMR
FT                   NDSFGLETYSPYLNKDLEDYMLFDSGDLDFPFGNPQRIIDMIKEHSKAIVNTGKIPFMI
FT                   GGEHLVTLGSVQSVYEKYNDLHIIHLDAHADLREDYMGQKLSHATVLRRCHDFLGDGRI
FT                   HQFGIRSGTKEEFTWAKDHVDMHPFSLDGLKEVIDELKDKPVYITIDLDVLDPSIFPGT
FT                   GTIEPGGISFLELVGAFKEFSRLNNIVGMDAVELSPHYDQSGMSTAVACKVIREMALIA
FT                   VK"
FT   gene            complement(57152..58000)
FT                   /gene="speE"
FT                   /locus_tag="CLOST_0042"
FT   CDS             complement(57152..58000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="CLOST_0042"
FT                   /product="spermidine synthase (putrescine
FT                   aminopropyltransferase)"
FT                   /function="5.4 : Polyamine biosynthesis"
FT                   /EC_number="2.5.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3526348, 88058963, 89327165; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20172"
FT                   /db_xref="GOA:E3PRB3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20172.1"
FT                   /translation="MELWYTEQQTDEVRFSIKVKQHLYTGKSEFQDVDVFESEEFGKFL
FT                   TLDGLMMVTEKDEFIYHDMITHVAMATNPSIKKVLVIGGGDGGTVRELTRYSHIEKIDM
FT                   VEIDKLVVDVSREYLPITASKLDDPRVSLYFEDGIRFVADTKEVYDLILVDSTDPIGPG
FT                   EGLFTTEFYQNCFNILSDNGILVNQSESPYYDQFSHEMKRAHKKIKNIFPISKVYQFHM
FT                   PTYPSGHWLFGFASKKLDPIKDVDFDKWNALGIKTKYYNPQLHVGCFALPSYVQEMLDN
FT                   E"
FT   gene            complement(58011..58442)
FT                   /gene="speH"
FT                   /locus_tag="CLOST_0043"
FT   CDS             complement(58011..58442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speH"
FT                   /locus_tag="CLOST_0043"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme
FT                   (AdoMetDC) (SamDC) [Contains: S-adenosylmethionine
FT                   decarboxylase beta chain; S-adenosylmethionine
FT                   decarboxylase alpha chain]"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20173"
FT                   /db_xref="GOA:E3PRB4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20173.1"
FT                   /translation="MKIEQLGRHILVEFYNCDKEVLNNHSEIEKHMNEAAIRSNATIVQ
FT                   SAFHTFNPWGVSGAVIIQESHLTIHTWPEFGYAAVDLFTCGDSVNPWIGFEYLSNSLKA
FT                   EKWETSEVPRGPVDKIKAFAKEDLGEVHFKPQTDSEIAS"
FT   gene            complement(59033..60508)
FT                   /gene="speA"
FT                   /locus_tag="CLOST_0044"
FT   CDS             complement(59033..60508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="CLOST_0044"
FT                   /product="arginine decarboxylase"
FT                   /function="16.8 : Protect"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /function="16.3 : Control"
FT                   /EC_number="4.1.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9723923; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20174"
FT                   /db_xref="GOA:E3PRB5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20174.1"
FT                   /translation="MKQNHEILPLIEAMMQYDQRDVVPFDVPGHKHGRGTKELVDFFGE
FT                   KVMRIDVNSMKCLDNIGNPVGVIKEAQQLMADAYDADHAFFLTNGTSSGVQAMIMSACQ
FT                   AGDKVILPRNAHKSAINALILGGITPVYVQPEMNTRLGIAMGVTVEKIKEAIALHPDAK
FT                   AVFLINPTYYGAASALKDITQLCHKHDMAVLVDEAHGAHLHFHDELPMSAMEAGADMSA
FT                   VSLHKTGGSLTQSSALLLKGDIIDKDRVKTILNLTTSTSASYLLMASLDGARKILATRG
FT                   EKMLTDTLELSRSARAEINEIEGLYAFSTELIDAHGVYAFDETKLSINVTGIGLTGFEV
FT                   YDILRDEYNIQMELGDINNVLAIISLGDTKEALCALVSALKDISVKYKKPEFDCQVKPL
FT                   KNPEVVIIPRDAFYMQKKILPLADSVGEIAGEYIMAYPPGIPVLSPGERITKEIIDYIE
FT                   VLKTQKSVLTDNHDPSGEFIKVLKHNNVSSIAI"
FT   gene            60696..61790
FT                   /locus_tag="CLOST_0045"
FT   CDS             60696..61790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0045"
FT                   /product="Alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20175"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20175.1"
FT                   /translation="MENTAYPNLQIDLKKIYQNAKNLVSFANTNGINITGVVKGSDSSK
FT                   EVAKEFIKAGCMGIADSRIEKLAKLKEEGIKEDMMLLRVPMLCEVEQVVRYSEISLNSE
FT                   IVVLEALNIEANNQNKIHKVILMADLGDLREGYIDEEELIKTALHIETKLDNLHMYGVG
FT                   TNLGCFGAICPDESNLGKLVQISEKISALIGRKLEIVSGGATTSLPLLFDSKMPKGINH
FT                   LRVGEAMLLARDLIDLWGYSMEGYHTDTFVLEAQVIEVKEKPSHPIGRIFVDAFGNTPE
FT                   YEDKGIRKRALIALGKKDIGHHDSLIPKLKGITVEGSSSDHVILDVTDAVEEIHVGDII
FT                   EFELYYQAMLYLTASTSVKKVYLY"
FT   gene            complement(61787..62953)
FT                   /locus_tag="CLOST_0046"
FT   CDS             complement(61787..62953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0046"
FT                   /product="YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20176"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20176.1"
FT                   /translation="MDKLSTSFKKSKKEILFSALFFIIIAILIFIPTGFEKNIYVNAEG
FT                   VRAKIIDVDNTSIYNTGMINQGEQTATIKILSGNHKGKEIQGTNMLTGKLEFDKFFEPG
FT                   DTAWALIEQDSSEKIIFANLIDHYRIGNEILLVSVFAVLLIVFSGFTGVRTLLSFLFAL
FT                   LSIWKILIPLMLKGYSPILVSLFVGNALTITTLLLVGGFTKKSYAAIISSISCSFITAI
FT                   TALAFGHIFEINGAVMQWSESLIYAGFKNLDLTGILYGGIYLASSGAILDLAIDISSAL
FT                   EEIQINHPKVSRKSLFDSGIRIGKSVVGSQTTTLLLAYMGSYISVMMVYMAQGTNIITI
FT                   FNSKPIAAEVLHTFVGCIGLVLVSPLTSFVSSIYFTQVDKTEDIKISA"
FT   gene            complement(63057..64562)
FT                   /locus_tag="CLOST_0047"
FT   CDS             complement(63057..64562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0047"
FT                   /product="Alkaline phosphatase precursor"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20177"
FT                   /db_xref="GOA:E3PRB8"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20177.1"
FT                   /translation="MTTSKKILSALFFGFIIISLITAQLLGVNTQSFADNSNSISTSYK
FT                   TPKYIFMFIGDGMSHVQVNAAQVYTGNNESGKVALGELEFTQFPIAGMATTQDSTSFCP
FT                   DSASTATSFASGVKTHSGVIGKKVDKTQDAKNITEIFKENGKKIGIISTVTINHATPAA
FT                   YYAHAESRNQYYDIAIQMATSNIDYFAGGAINKPTGDKKDQKDAYEILAENEYTITKTK
FT                   EDFAKLDKNSGKIYAQSPKLQDSGSMPYSIDYKSGDLKLSDFVRKGIEVLDNENGFFMM
FT                   TESGKIDWACHANDAMSTIADTLELNEAVKVAKEFADKHPDETLIIVTGDHETGGLTIG
FT                   QAYTGYDTAFNLLRNQKMSYVAFDDMIAEMKSNGQIKSLDDVMPIINQNFGLKAPSDGS
FT                   SDSLAMTDYEYKKLQAGFEESMKEEEARTDNQEASIMYGGYDPLSVSLTHILNNKAGIG
FT                   WTSYSHTGTPVPVFAYGAGAELFNGSYDNTDVFFKTLKAVGIR"
FT   gene            65311..68109
FT                   /locus_tag="CLOST_0048"
FT   CDS             65311..68109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0048"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20178"
FT                   /db_xref="GOA:E3PRB9"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20178.1"
FT                   /translation="METQSTKKKITFKKITITIIFMVIIAVISSFGKLLDFWTDFLWFK
FT                   EVGYTSTYIKQVFAKLYIGIPFFVAFTVFMYIYLQRIKSNYYKYMNILTTKDEEKTLNQ
FT                   TMGVVSVLTALFFSFGIAGSFWMQILKFINATSFNIKDPIFIKDIGFYVFTLPLVTEIF
FT                   TFLLGFIIFLMLITIVIYIVLISIRQPMDKEELGSKIRRLRTENSFVSLQKRVMELALD
FT                   QIMLIGVVFFVIIALRSYLASFALLYSETGAIYGAGFTDINVTLGVYRIQMVVSIASAI
FT                   ALILARYKRNKKLAAIGPIALVAVYLLGLGAEIAVQAVIVSPNELARERKYITNSLEYT
FT                   KMAYGLDDIDVENFSVDQDLTYDDLLENQDTISNISLNDYRPTKEAYNQLQGLRNYYKF
FT                   HDVDIDRYIIDGKLTQMFLSVRELDKEALDDNAKTWVNQHLKYTHGYGLTMSPVNKVTS
FT                   SGQPSMVVRNVPPVSDYKELEVTVPQIYFGELTNDYVVVNTDEQEFDYPMGEELQTTKY
FT                   QGTAGIKLNFLNKALYSIREGSFKLLVSGGVNSDSKIIINRNIMDRVNKIAPFLSYDED
FT                   PYAVVVNGKIYYIIDGYTTTKYFPYAEPFNENANYIRNSFKVIIDAYNGDVNYYIVDEK
FT                   DPLVETYSKIFPKLFKPMSDMPKEFISHLRYPQTMFDIQAKMYGTYHTNQPDIFYNRED
FT                   KWEIAKQNYQDKIQEMESLYFTFELPGEGKPEFVLSIPYTPTGKQNMTAFLVARNDGDN
FT                   YGKLKLYEFPKSKTIIGPEQVEARISNNDVISRDLSLWDSRGSQVLRGNILTIPINSSI
FT                   LYIEPLYIRADSEKAIPEVRRIIASYNDKVVMEDTLEKALTSLFGGPSDPNKQIESSVS
FT                   DEPIDIEQMPVDSPLPEDEAGLIKQANELYEQAQEALKSGSLSEYEKKINELGNILKLL
FT                   EQ"
FT   gene            68125..69018
FT                   /locus_tag="CLOST_0049"
FT   CDS             68125..69018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0049"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20179"
FT                   /db_xref="GOA:E3PRA2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20179.1"
FT                   /translation="MINYFNLAAVTEKVTEAVTDEVQTAVEESFNLIKTLKALFLAYGM
FT                   DIIIGILIFLVGLYIARYVRNLSKRIMRKSNVDPSAIGFISQILYFLLLIIVAIAALGR
FT                   IGVPTNSFVAAIGALGLAIGLALQNNLSNFASGILILIFKPFKVGDFIEAAGVSGSVNE
FT                   IQIMNTILYSVDNRKIIIPNSKLTSENVVNFSSAIDRKIQLMIEVDYNSDYKKAIELIK
FT                   TIFKEDPDIYDEPEPTVALREFGESGIKIFALPSVKNENYWNAYYRIMQRIKDDFDANN
FT                   IQIPYPHRMLYMKNLD"
FT   gene            69386..69988
FT                   /gene="rbr"
FT                   /locus_tag="CLOST_0050"
FT   CDS             69386..69988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr"
FT                   /locus_tag="CLOST_0050"
FT                   /product="Rubrerythrin (RR)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20180"
FT                   /db_xref="GOA:E3PRA3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20180.1"
FT                   /translation="MAEKSLKGTRTLGNLIKAFAGESQARGRYNMFAEVAEREGFMRIA
FT                   EVFNETADNERIHAKIFYDHAVAGLEGEEFPVALHVDADYPVVMGNTYTNLVAAAMGEN
FT                   EEWTELYPEFARIADEEGFPKVAASFRMIVDIEKDHEERYRTLAEHVKAENVFKREDKE
FT                   LWKCMCCGYIFDGSAAPNICPVCKQPKAFFKLHCERF"
FT   gene            70066..70278
FT                   /locus_tag="CLOST_misc_RNA_15"
FT   misc_RNA        70066..70278
FT                   /locus_tag="CLOST_misc_RNA_15"
FT                   /product="T-box"
FT                   /inference="profile:Rfam:8.1"
FT   gene            70410..71687
FT                   /gene="serS"
FT                   /locus_tag="CLOST_0051"
FT   CDS             70410..71687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CLOST_0051"
FT                   /product="seryl-tRNA synthetase, also charges
FT                   selenocysteinyl-tRNA with serine"
FT                   /function="1.5 : Serine family"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number="6.1.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1859832, 3029694, 3062312, 7537870, 90384563, 91296775,
FT                   94157910; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20181"
FT                   /db_xref="GOA:E3PRA4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20181.1"
FT                   /translation="MLDIKRIKRDLEEIKPLMAKRGEKDFSFEEVIELDDKRIELLQEV
FT                   EALKNEQNVDSKLIPQYKKEGKNTDELMARLKELSEQIKNLDDKVKEVEEDLFQKLLRI
FT                   PNVPHPDVPTGDTDEDNLEVRKWGEPTAFDFEAKAHWDIGTDLNILDFEAAGKITGSRF
FT                   TLYKDLGARLERSLINFFLNTHTAEHGYTEVLPPFIANRTSFIGTGQLPKFEEDMFKLE
FT                   GFEYFLVPTAEVPVTNIHQNEIMNGDDLTTKYCAYTPCFRAEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFTKPEDSYKELETLTADAEKVLQLLGLPYRVVRICSGDLGFTAAYKYDLEVW
FT                   MPSYNRYVEISSCSNFEDFQARRANIRFKRDKASKPEFVHTLNGSGVAIGRALAAILEN
FT                   YQQADGTVVVPEVLRPYMGTDKIIKK"
FT   gene            71742..73193
FT                   /gene="amyA"
FT                   /locus_tag="CLOST_0052"
FT   CDS             71742..73193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyA"
FT                   /locus_tag="CLOST_0052"
FT                   /product="cytoplasmic alpha-amylase"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="3.2.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1527488, 93015717, 93381452; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20182"
FT                   /db_xref="GOA:E3PRA8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20182.1"
FT                   /translation="MSLNGIMMQYFEWYLEDDGRLWKKLKDDANHLKELGITAIWIPPC
FT                   MKATSTNDTGYGIYDLYDLGEFDQKGSIRTKYGTKEELLEAINVLHDNNIKVYADIVLN
FT                   HKAAADETQRFMAVEVDPMDRNKEVSEPYEIEGWTKFNFEGRNNKYSDFKWSWEHFNGT
FT                   DYNQETEKSAIYLILGENKDWAQDVAEEFGNYDYLMFTNIDYKHPDVYKSTMDWIIWFI
FT                   NETKVDGIRIDAIKHINDWFIKDLVLKSRADFGEEFYAVGEYWSVEMPTIESYLSEVDY
FT                   QLDVFDVPLHFKFHAASYDASNFDMGQLFNDTIVSKYPLNAVTFVDNHDSQPNQSLESH
FT                   VKQWFKPLAYASILLRKDGYPCIFYGDYYGTRGENKIRPLPDMLDKLIKLRMNHAYGIQ
FT                   EDYLDHKHVIGWVRLGDKENPKGCSVIMTSTEAGEKTMNVGEMHKGEIWIDALGHTDAE
FT                   VEIDEKGNGKFIVSDGSVSVYICKD"
FT   gene            73214..74026
FT                   /locus_tag="CLOST_0053"
FT   CDS             73214..74026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0053"
FT                   /product="putative Radical SAM domain protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20183"
FT                   /db_xref="GOA:E3PRA9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20183.1"
FT                   /translation="MYTDARIHYPLDEMTNMLIPVTIGCSYNKCAFCNMYKGEKFAHVS
FT                   LTDIKAQLMNGYKYTEKVFLVGAEPLSIGYEKMKELLELIHEYLPYCALVSSYASIKNI
FT                   SMYTVEQLSILHDMGLRQLYIGFESGLEEALILMKKGHTVNEAIEQAQKLNKAGLLFNS
FT                   IIMYGIAGKGKSVENALATAKMLSQFKSHKIITMNLQIFDDTDLAQMVSSGNFIPADRN
FT                   ERLLEIKTLLEKFNPIEKTVFDTTHPTNIVKLLGTLPDDKAKLLAKLD"
FT   gene            complement(74090..74272)
FT                   /locus_tag="CLOST_0054"
FT   CDS             complement(74090..74272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0054"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20184"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20184.1"
FT                   /translation="MKEIRGYNKLEMLYPDRCMLKWKPMLLSEHGEKLLDHKLEVEKLE
FT                   KDFKKSSKSQKKELL"
FT   gene            complement(74269..75576)
FT                   /gene="uvrX"
FT                   /locus_tag="CLOST_0055"
FT   CDS             complement(74269..75576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrX"
FT                   /locus_tag="CLOST_0055"
FT                   /product="lesion bypass phage DNA polymerase"
FT                   /function="16.6 : Maintain"
FT                   /function="16.9 : Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20185"
FT                   /db_xref="GOA:E3PRC0"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniProtKB/TrEMBL:E3PRC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20185.1"
FT                   /translation="MGEDIDYSKLPRRDVLCIDVKSFFASVEAVRRKIHPLDAYIIVIS
FT                   DFERPGAVVLASSPKVKKEFGIKTGSRKFQIPEDPKLMIVEPSMSLYLEINRRICDIFR
FT                   RFVADEDLLVYSIDEAFLDISATRKLFGEPLEIARKIQKIIWDELKLVVSVGIGDNPLL
FT                   AKLALDNEAKNNKSQIAYWSYEDVPRTVWRIPKLTDMWGISYGYEKKLNDLGIKSVYEL
FT                   AHRNPLFLKSYLGIMGLQLYYHSWGVDYSRISEKVESKHHSYSKGQMLMRDYDSKLEIM
FT                   AVLREMVEQICIRLRKYDMVCEAVSLYISFSKHEASFGFKKTKKLPRATNHTSEIALYF
FT                   DAIFEENWRGELVRQINVSCEEVNPAEAYQLDLFGSIQSEKTNKIDNIIDEIREKYGKT
FT                   SVFRAYNLSHGSTFLHRSGYVGGHKGASSLDKEEKK"
FT   gene            75980..77491
FT                   /gene="yjeM"
FT                   /locus_tag="CLOST_0056"
FT   CDS             75980..77491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeM"
FT                   /locus_tag="CLOST_0056"
FT                   /product="putative transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20186"
FT                   /db_xref="GOA:E3PR56"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20186.1"
FT                   /translation="MSKDNSKKLTLVSLILMIFTSVFGFANMPRSFFLMGYGAIPWYII
FT                   SAVTFFIPFAFMMAEYGAAFKNEKGGIYSWMEKSVGPKYAFVGTFMWYASYIIWMVNVG
FT                   SGIWVVFSNAIFGTDTTSTWSLFGLSSTQTLGILGILWVFMVTFVSTKGLDKIKKITSV
FT                   GGIAVTFLNVVLIIGAIAVFIGNGGQLAQPITGVESFISSPNAAYQSPIAILAFLVFAI
FT                   FAFGGTEVVGGLVDQTENAEVTFPKGLTIAAIVISIGYALGILLCGVFVNWTNVLSSEN
FT                   VHMGNAAYVIMNNLGYQLGQAFGATEAVSVSMGNWMARYVGASMVLALMGAYFTLTYAP
FT                   LKQLIEGTPKELWPGRMSEVEDGMPKAAMWLQCTAVSVMLFLVSFGGDAMSAFFTKLVL
FT                   MTNVAMTLPYMFIAGAFISFKAKKEIEKPFVIYKTQSSAKIASIIVVFTVGFANFFTII
FT                   DPALKGDLSSTIWSIAGPAFFTVVALVMYSSYEKKMGKESNKKVA"
FT   gene            complement(77622..78134)
FT                   /locus_tag="CLOST_0057"
FT   CDS             complement(77622..78134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0057"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20187"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20187.1"
FT                   /translation="MEINNSLPIIDYSDNETGCCPKFHPENWDEKIFNFDELKFIKAST
FT                   KSFMHMPINMGSVMTKTFGAIQGAKAETTEQYLILSKDISSWKSDHYFLVASDVPGYES
FT                   LSLKGNYYAKVYDGAFKELPKWMNEFEELLKSRGYSSHDMMAFYTTCPKCAIHYGHNYI
FT                   VLFSKVS"
FT   gene            78244..78912
FT                   /locus_tag="CLOST_0058"
FT   CDS             78244..78912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0058"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20188"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20188.1"
FT                   /translation="MNYEVNMINIIKIHGISDCYPELIEGTSQWYYCQESKKTFCDLYE
FT                   AEEIVKLGHNFEGMNCHLIHYPEGTVHSPFEMKSNVYIEKPIWNNGKFNFLVVNFDLKV
FT                   IQIYSYEPEYLKLSIIQELPLSITSDCYNLMLKGYPLMLCRDANDGIYEIIWPESKKIV
FT                   IGKTESLIVRDGNDLYFSRWYEDPEYHESVIVRDVNTGAINEEFDGYLRVLPNGVYWRI
FT                   "
FT   gene            78942..79607
FT                   /locus_tag="CLOST_0059"
FT   CDS             78942..79607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0059"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20189"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20189.1"
FT                   /translation="MKLGEIRNQSGFLSNNTLMKYNKKDSIKEGLQNQIVNIQKQIYSV
FT                   SENKFLSIEQKKQMQKDLKEQLNELNKQIIQRDLEIRKEQEEKREEKIKEQLKDKNYID
FT                   DEQQEMTNLFSITSSLNQVKFQTSASIKIKGNAHVLESEIKADEGRGLDVSEKRKKLSE
FT                   MKDKIRGINKKIVKTMNEVNKEIKKSSKKEALRNEEQVSNENEEKRGNNEIQRESRDN"
FT   gene            79576..80289
FT                   /locus_tag="CLOST_0060"
FT   CDS             79576..80289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0060"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20190"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20190.1"
FT                   /translation="MKYSVNLETTKIDYNVVYSKRKTLEISIKAPGIITVRAPIYISEE
FT                   QIEKSVRNKSKWIIEKLAILSKLDITPIKKEYVEGETFMYRGENYLLRVVIDEKLKKPE
FT                   VKLYEDKLIITMPRHDEEAIKDAIWSWYKNEAKMTIADRVEYYSRYFNLKPNNIKIKAQ
FT                   KTRWGSCTYKNDLAFNYKLIMAPPDVLDYVVIHEMCHMEHKDHSKNFWSRVSSVMPDYK
FT                   DKRKWLKEHGMKLCC"
FT   gene            80392..80997
FT                   /locus_tag="CLOST_0061"
FT   CDS             80392..80997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0061"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20191"
FT                   /db_xref="GOA:E3PR61"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20191.1"
FT                   /translation="MKTFEDKSRESYNQKADNYDETPEGIFTLKFKKLLLEEMIIDTNS
FT                   KILDVACGNATFLKMLSNNHSIKGYGIDISEKMIENAKKSCSDMIFEVSSCEHTSFGNE
FT                   MFDIVTVCAAYHHFPDPKSFAKEMRRILKPKGVVYIADIYYPLIIRAILNPFVPLSKAG
FT                   DVKFYSPKEIKLNFEECGFEIFKFKIDGHIQINAFRRI"
FT   gene            81500..81625
FT                   /locus_tag="CLOST_0062"
FT   CDS             81500..81625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0062"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20192"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20192.1"
FT                   /translation="MVFHSLDMRMQQLIMKFLYIVQGYTINKKRLKELNRVISKK"
FT   gene            complement(81681..82118)
FT                   /locus_tag="CLOST_0063"
FT   CDS             complement(81681..82118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0063"
FT                   /product="putative Acetyltransferase, GNAT family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20193"
FT                   /db_xref="GOA:E3PR67"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20193.1"
FT                   /translation="MEYEIKELKLQDLDTLINKYIIYYNDEGGRWTYTLAKIRLEQNFL
FT                   TPSFYGVGLYDKSELLGFAIGCFKQYDDLLIYYLEEILVFKEYQNKGLGTKLLQELESL
FT                   VKKQGAEKINLSTTNEKKHQKFYSRLGFEKSDFLVPMLKKI"
FT   gene            82377..82453
FT                   /locus_tag="CLOST_tRNA1"
FT   tRNA            82377..82453
FT                   /locus_tag="CLOST_tRNA1"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            82607..84517
FT                   /locus_tag="CLOST_0064"
FT   CDS             82607..84517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0064"
FT                   /product="putative Similarities with helicase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20194"
FT                   /db_xref="GOA:E3PR68"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20194.1"
FT                   /translation="MSLEYMENYFKYSKPNILGNEELRYPQVEAYIEIKEYFNSEYDNR
FT                   NALVVLPTGVGKTGFMAIAPFGVSGGRVLIVTPYAAIKNTVIDALNPDIYNNFWLKRNV
FT                   FSSRKFLPTIIEYNGQDTPMEVLNKANIVILNIHKLQSRLDSSLINRVSKDFFDMIIID
FT                   EAHHSTADTWVECVNYFDKSKVLKLTGTPFRTDKKEINGKLIYKYPLSRAMANGYVKSL
FT                   RNNIFIPDELRLTIDKNTDKTYSIQELYALNLKDMEWITRSVALSEDCSEKIVKESIRL
FT                   LEKKKNIGSKIPHKIIAVACSIYHGEEILKLYEKHGYSVALIHSNLEERKKERLFDEIK
FT                   NNLVDVVVNVAMLGEGYDHPYLSIAAIFRPFRNELPYAQFIGRILRFIEDDDAQVEDNI
FT                   GEVIAHKNLELEHLWEKYKVEIQESEIIKRLKDYDDIINKELDSKSTSVDSEEEELGKV
FT                   INIGAYRVESEEYLSTELFELSKKKDAELKQKIRDLKKIFGDNITDEQAKLIIQQAESD
FT                   EDETKRPDLLYSKKKKNIDARIKEDIVPRLMVQYDIDKDKNYLKDLSIIKTKCNYIAKY
FT                   VNKNDGILAFYINDCLKKAIGKERKKWTDEDLDKGLNILDDLEKQLDYSLENQVDNLKK
FT                   R"
FT   gene            84522..84845
FT                   /locus_tag="CLOST_0065"
FT   CDS             84522..84845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0065"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20195"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20195.1"
FT                   /translation="MDILSRLFKLSNLPIITPYNLLDNAKLDNYEYVKYYKKENKFISE
FT                   MKCLVDKVDTIFYYEFDNNNYLQKIMMYQNEKMQCMFNREKELKELKKEYLELDNIQLS
FT                   KIG"
FT   gene            complement(85459..85722)
FT                   /locus_tag="CLOST_0066"
FT   CDS             complement(85459..85722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0066"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20196"
FT                   /db_xref="GOA:E3PR70"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20196.1"
FT                   /translation="MVIADELGYISFDKEASELLFTYLSLRAGRKSTIITTNLSFERWE
FT                   EIFKDPVMTAAMIDRLTHKSFIVNMNGNSYRLKETKLWLSEQ"
FT   gene            complement(85716..86216)
FT                   /locus_tag="CLOST_0067"
FT   CDS             complement(85716..86216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0067"
FT                   /product="IstB domain protein ATP-binding protein
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20197"
FT                   /db_xref="GOA:E3PR73"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20197.1"
FT                   /translation="MSKEFDEKIFCLAKELKLPYTSKFFKDDISQANTESKSYESFLFD
FT                   ILEKEYDLRKENAIKNKIRNAKFPYKKYIEDLIIDDLPSDAKNKVTAFSSLDFVEKGQN
FT                   IILAGNPGTGKSHIAIGLGIKACVAGYSVLFTTIPLLVNELKESRSNKTLRTLNTDFKS
FT                   MIW"
FT   gene            complement(86213..87790)
FT                   /locus_tag="CLOST_0068"
FT   CDS             complement(86213..87790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0068"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20198"
FT                   /db_xref="GOA:E3PR74"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20198.1"
FT                   /translation="MISLMDKQEIILSHFREGKSQWQIHRDTGFDRKTIRKYINDYELK
FT                   KRKLLASDESNMALIEDLTAAPKYDISNRVKRKLSDEIIQKINFYLEENNIKRETGRSK
FT                   QQKKKIDIYECLIEEGYDISYPTVSNYIKTTLDSSKEAFIRQEYQLGEICEFDWGNVNL
FT                   IIAGKARSVQMAAFSSAKSNYRFAYLYHNQKMESFLDAHVKFFNKVGGVYKVVVYDNMK
FT                   VAVKKFVNKNEKYPTDDLLKLSLHYGFKYRFCNVCKGNEKGHVERSIEYIRRKAFSKKD
FT                   TFDSIKEANEYLASELAKLNDRVSKEFNKSPKDILLEELSFLLPIMPSYDIARTIELRV
FT                   SKYSTISVDENKYSVPDCLVGKFVFTKIYPEKICIYYRNNLVAEHSRSYLVHDWCIKID
FT                   HYINTIKKKPGSLHSSTAMQQMNPTLQTIYNKYYTENPKNFIELLELISEHGLNKIQNV
FT                   IYELENLNPISINTEKVKMLCNRNIDEKITIKERSTKIEQYSREILSSYADILNNSSVA
FT                   FQEEAKII"
FT   gene            complement(88169..88393)
FT                   /locus_tag="CLOST_0069"
FT   CDS             complement(88169..88393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0069"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20199"
FT                   /db_xref="GOA:E3PR81"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20199.1"
FT                   /translation="MGKISDKNTRTLITIPKELKTELEEIAKNQNRSFNNLIITILKDY
FT                   INSFCASKRPEKAASNSSDKGSTLEKRPL"
FT   gene            88494..89624
FT                   /locus_tag="CLOST_0070"
FT   CDS             88494..89624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0070"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20200"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20200.1"
FT                   /translation="MIKSIKIRLKPTKEQEILMFKSVGVARFAYNWGLAKWEEMYKKGL
FT                   KPSKAKIRKEFNNSVKKSDDFKWLYEVSGQITSQAFTDLEYAYKNFFNKTSDKPKFKTK
FT                   KKSKKSFYVRYDALKFKDAKVNIEKIGKVKYSSNYNIPQLDNYVNPRCHFDGKYWYLTF
FT                   GFEHSENKAKLDYNLSIGIDLGIKELAYVSCFNKPIKNINKSVKVKKLKKRLIRLQKQV
FT                   SRKYEANKSGDRYNKTSNIIKLEKQIKLLHRKLNNIRNNHLHQTTKMIVKLNPYRIVME
FT                   DLNVTGMMKNKHLSKAIAEQKFYEFIRQIKYKCEFNNIEFLQVDRFYPSSKTCSSCSGI
FT                   KQDLKLKDRIYHCDKCGLTMDRDKNASINLANYKIV"
FT   gene            89939..90403
FT                   /gene="guaD"
FT                   /locus_tag="CLOST_0071"
FT   CDS             89939..90403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaD"
FT                   /locus_tag="CLOST_0071"
FT                   /product="guanine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20201"
FT                   /db_xref="GOA:E3PR83"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20201.1"
FT                   /translation="MDEFMKEAIKEAFEGIGLRAGGPFGAVIVKDNKVIARGHNKVIET
FT                   NDPTAHAEIVAIREATKLLGRFDLSDCILYTTCEPCPMCYSAAHWAKIPLIYYGATQDD
FT                   AKDIGFDDSYIYEVLQNKHSNEKMKICQIDREQCLEPFRKYEEDEERILY"
FT   gene            90616..91434
FT                   /locus_tag="CLOST_0072"
FT   CDS             90616..91434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0072"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20202"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20202.1"
FT                   /translation="MFENDIIKAYALLNIERKIVGVKLIKNKQEFDSYDVINLINPLSY
FT                   CVAVKSASLGHRIKFDKLTSGCGGSTRALGLEKPADDFLDGTAPYRLGLFKDENVAKRA
FT                   ALETGNILSNTYGVLVQPVEFFSSNDKPDVVIAIGKPRELMRIIQGYTYNKGISKQFSM
FT                   SGNQGVCVEATAYPLIHNTVNMSLLCSGTRFLAEWAEDEGAVGIPMSLFSEVIEGIYNT
FT                   VNAVEMDKRKSEISEELTLNNIECMEMEYGKTYYTEYEKEKREKRKNEKH"
FT   gene            91367..92236
FT                   /gene="ssuC"
FT                   /locus_tag="CLOST_0073"
FT   CDS             91367..92236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="CLOST_0073"
FT                   /product="SsuC"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20203"
FT                   /db_xref="GOA:E3PR85"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20203.1"
FT                   /translation="MEKLIIRNMKKKKGKNEKMRSIDKEKKRYFSVVVIRSAFIIAGIF
FT                   LWEYSASSGSYNPIFTSYPSQILKDLMVFFTSGELYKHASITLTEVFWGLFFGSAIGIL
FT                   LAIVFGYFSFIGEIITPIISAISCIPQLALAPVYVLWFGLGLTSKIFLAGLMVFFNVFS
FT                   ATYGAIKSMDKGILESANLLGASHFQTLRTVVIPSCMPWILSGLRGGVSAALVGAIIGE
FT                   YIGSKGGFGWMITYSTSYFNISRVMSCIVILLFVGLGLNKILDIMEQKLLVWRTVTSLR
FT                   MENLKNQD"
FT   gene            92267..93310
FT                   /locus_tag="CLOST_0074"
FT   CDS             92267..93310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0074"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20204"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20204.1"
FT                   /translation="MKKNIKKFTNLVLSAALVMSIFTGCSSNTATPAETTEGSESKELT
FT                   KVVVSEFRGMNYAAVHIADAMGYFEEQGLDVEFAVYGDGPVAFQGMHAGDSQFCMLSIE
FT                   PVFRAFDEGLESKVVAALDTTRLYGFAGSKDITEISQLKGKTVFAGAPGSAPYSFIWSI
FT                   LEEGGLNPAEDVTFAQMQYGASITALEQGTIDASYMDHYNRNKFSAIGANFLVDGADME
FT                   TKKRVFGSEKFEGSIITATKKFVDENPETVQKFVNATVKGAKWLTSHSDEEVAEVLMPY
FT                   HDGSTKEDLIERISLIKIAYSPDCKISAEGYEAMENFSLKTGVLKNKVGFDNIIDMSFV
FT                   EKAQDVK"
FT   gene            93321..94337
FT                   /locus_tag="CLOST_0075"
FT   CDS             93321..94337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0075"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20205"
FT                   /db_xref="GOA:E3PR63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20205.1"
FT                   /translation="MSYIDIINVSKSYADNQVLKNISLSIKKNEFVTLLGSSGCGKTTL
FT                   LRSIAGLGSIDNGKIMLDSEDITHKNPGDRNIGMIFQSYCLFPTMNVFNNVAYGLKLKK
FT                   EPESKIKNEVMSALESVNLLEKVKSYPSQLSGGERQRVALARSLVMKPKVLLLDEPFNA
FT                   IDAKLRKALQLKVKELHKEYDMTSIMVTHDQDEAMIMSDTIHLFKDGVIEQSGTSAELY
FT                   LTPKSKYVASFMGNYNVIEAQIFSKITGGKYSKEHTIGLRPESIEIHKEKLEAKANEFI
FT                   LIGVISNLIPQGNIVRFSVKIMDEYVDVDVLVDRCSGFSIGDKVNLKIKPDKILYFD"
FT   gene            94365..95300
FT                   /locus_tag="CLOST_0076"
FT   CDS             94365..95300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0076"
FT                   /product="putative CobW/P47K family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20206"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20206.1"
FT                   /translation="MSTKLHIVSGFLGAGKTTFIRNVIPFMKGKIALIENEYSDVSIDS
FT                   ELFITEELVIKEIFSGCICCSLIKDFRTTIDELTRNYDLEHIFIEPSGVGSLSDIVAVC
FT                   EDISKTSGKAIEIQSLVTLVDVSSFEDYIDSFGEFYINQIENAKAIIITHIEDVTESAL
FT                   EKIMDEIKAVNNSAVIFSEDYLSYPTQKTLDILETAYNHELNVIGSGKTTPATSYFTTV
FT                   SIHNPNKLSMEELSNLSNIFKNRELGTVLRAKGVIQLVDSSFVHFDFTPNYFDWEYLNN
FT                   SKETKLSVIGKNLNQAYIKGLFSDVLEALI"
FT   gene            95297..96163
FT                   /locus_tag="CLOST_0077"
FT   CDS             95297..96163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0077"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20207"
FT                   /db_xref="GOA:E3PR65"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20207.1"
FT                   /translation="MSITDFNCTYNNGAGVNEEIVQKTKLKFPDAYKNWEDMAVLAKEI
FT                   KNHEDASFCTLPFCHTLEGEALGAVINYGDERIGPRGKDYLTSSIEDLLSISELDFSKG
FT                   RLAEVLKACSYLRQEGENVALYISGPFTILNLLIDLRYVFKAFKKSPEVMEKILEKLRV
FT                   ELLRFIREAQNMGVNIFSYGDSSGGLNILGPKLSEQIVEMFTYPLLKEAQQIITDDSVM
FT                   LLCPKTSFALIGTNKAKWKNVELKESMKYDKACVSMIGKAKFLGEMCIKNKNYILKDGV
FT                   IKSIELI"
FT   gene            96191..97261
FT                   /locus_tag="CLOST_0078"
FT   CDS             96191..97261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0078"
FT                   /product="Uroporphyrinogen decarboxylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20208"
FT                   /db_xref="GOA:E3PR71"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20208.1"
FT                   /translation="MHKKDQMTPNERLGAFMTGKPMDRILAMPVACSMSGLALGMTHKE
FT                   KRSSAVNEANAQIACYERFGNDLAVVEYGLHGVGMALGSEMTDPEDAVPAIIKYILEDL
FT                   DDVDNLDMSKLELKNDKAFQLHLEAAKLIIEKIGHEVPTGVLISGPFTAAASIYKTENL
FT                   LRATRRNPEKLHKLINFCNEALKMICKEFIKEGVLILLCDPIASGTILHQKQYREFVLP
FT                   YTIELMKEIHEAKGMVCYHICGDTTSIVSDMVKSGCDMLSIDNRVDLEYTKQMVGDKVP
FT                   ILGNVDPVEVLYLGNQEDVDLAVKNCIQKGYDSPCGYILASGCDLSGNLPLENIDQFME
FT                   SARKYGKWPLDPANFK"
FT   gene            97297..97953
FT                   /gene="mtbC"
FT                   /locus_tag="CLOST_0079"
FT   CDS             97297..97953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtbC"
FT                   /locus_tag="CLOST_0079"
FT                   /product="Dimethylamine corrinoid protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20209"
FT                   /db_xref="GOA:E3PR72"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20209.1"
FT                   /translation="MFESKEALLKRLSDGVVDMEEEDVIEASKEYIEAGYEAFDGIMQG
FT                   LVDGMNRASVLYDEEEYFVTDVLLCSDAMYEGLNILRPHLPAEEADKAKIKGVIGVVEG
FT                   DTHDIGKNLVKIMLETAGFEMIDLGRDVPLDSFVSKAKEVGADFVCLSTLMTTTMGGMK
FT                   TVVDRLKEEGLRDKVKVLIGGGPISQKYCDTIGADGYSSNAVEAVKLAKKLLVTA"
FT   gene            97967..98998
FT                   /locus_tag="CLOST_0080"
FT   CDS             97967..98998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0080"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20210"
FT                   /db_xref="GOA:E3PR75"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20210.1"
FT                   /translation="MLTPKERLEKVLNHQEVDRPPCICPGGMMNMVTEELMKLCEISFP
FT                   DAHQNPQQMADLSEAVYKEGCFENYGVPFCMTVEAEEFGADIDMGSNIYEPHVINYNIS
FT                   SVSEWEKLEAIDFSKGRSSTVIEAIKILKAKNTEVPIIGNITGPISTASSIMEPVVFYK
FT                   ELRKNNEKAHEYMTFITKQITEFAIKQIEAGADIIAISDPSGTGEILGPKLFDEFAVKY
FT                   INQIIAEVKRLGKRSIVHICGQMKNVYKEVNKIESDVLSFDSIVSISEAKKNLGNRLIM
FT                   GNVSTYIIEFGEMQKIADMTKKCVLDGSDIISPACGLGMKSSLKNVRSMLSALTEGDAK
FT                   NNA"
FT   gene            98991..100778
FT                   /locus_tag="CLOST_0081"
FT   CDS             98991..100778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0081"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20211"
FT                   /db_xref="GOA:E3PR76"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20211.1"
FT                   /translation="MPKIFVKGSSKAIEYLPGQNLLQILHDNDIFIENPCNGKGSCGKC
FT                   KVKITEGSLGEIPEAEKKFLSESEIKEGVRLSCLIHPESDLVIETLHKEREHKILTTGY
FT                   MPEFNLSPSISKKLFEIEKPSLENQISFEDAILKSLSLDEVDFDVLKMIEPFDEAGTAV
FT                   FDKDKVIAIEKGNTTDNIYGLAIDIGTTTVAADLVDMKSGKAILSSSDINPQKKFGLDV
FT                   LTRITYALENEEQAVKNLQHEIVNLINKMTFEMCMSANISKEHIYEVSVAANTTMLHFL
FT                   LGIKDNSIGKSPYAPVFVKSKYIKASSIGININSNGKLYCLPGVSSYIGSDIVAGAFVA
FT                   KLHDSKDNILFIDIGTNGEIVLASKGKLLSCSCAAGPALEGMNISCGMRAATGAIEDMV
FT                   IDKEQVRLSVIGEQQPIGICGSGILAALRELLKTGIVKKDGSFIKKEKLAEDDYRQKYI
FT                   RLNGKKREFMIEDKAKTLYITQSDIRQIQLAKGAILSGFYALLNKSGISINELDKVVIA
FT                   GQFGSHLSVDSLTGTGILPKEVESKITYVGNSSKTGAYMALMSDEVKKDLEKIAKTIDY
FT                   MELGASDGYERLFADCLLF"
FT   gene            100804..101856
FT                   /locus_tag="CLOST_0082"
FT   CDS             100804..101856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0082"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20212"
FT                   /db_xref="GOA:E3PR77"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20212.1"
FT                   /translation="MIAIPKDEMTPKERMDAFGRGEEIDRVPCCPFTGESYATYFGYSL
FT                   DDYNHSTEIIVDTIIRTFHMFRADNCSIGPGLQGIPEAMGARLHFSKNDIPQIAAPAIS
FT                   SYEEISKLKPINPYKDGRLKLYIEALKIVQDKLGNEVNIGNTVGGPFTTTAFLIGTEKF
FT                   LRDLRRNPDKIKEVLEIATLSTLNVMDAIMDLGITPGIADPIASSTLINKSVYREFVFP
FT                   TIKTCQDHIRKRMGGTGIMHICGKTKPVWEEIVSTGIAGFSLDNIEDIGEFRQGYEDKV
FT                   LVIGNVDPVGVILNGTKEDIYEAVRVCCEKGMGSKNGYILASGCDIPIGTPPEKIMHFI
FT                   DAARVYGRMK"
FT   gene            101907..102854
FT                   /gene="dppB"
FT                   /locus_tag="CLOST_0083"
FT   CDS             101907..102854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="CLOST_0083"
FT                   /product="dipeptide transporter; membrane component of ABC
FT                   superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7536291; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20213"
FT                   /db_xref="GOA:E3PR78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20213.1"
FT                   /translation="MLDYIIKRSARGILVIFIIILFSFFIIHMMPGDPVMTMLGDKATP
FT                   EQINSMRKELNLDKPLIEQFLTWIFGFIKLDMGNSLIWQEPVIDIIISRIEPTLILALM
FT                   ATMISVIIGVPVGIKASREHNMIFDKFFSVASLVSISLPAFWIAIIFIHILGVKINLFP
FT                   VAGYRNIESAGLLISIYDLMLPSIVLGVMHSGQIARMTRTQMIDILQQDYLKTARAKGL
FT                   SENKVIHIHAFINALSSIIMVVSFGFAALLGGAAVIEQIFNIPGTGNLVITAVNNRDYP
FT                   LIQGVLLFIGTIFVFTNMFVDILCTLINPRTRFE"
FT   gene            102856..103680
FT                   /gene="yliD"
FT                   /locus_tag="CLOST_0084"
FT   CDS             102856..103680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yliD"
FT                   /locus_tag="CLOST_0084"
FT                   /product="putative peptide transporter permease subunit:
FT                   membrane component of ABC superfamily"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20214"
FT                   /db_xref="GOA:E3PR79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20214.1"
FT                   /translation="MILDKIKLENTQMKLGIILILLPILLALAGPYFTQNDTTSVSPAN
FT                   RLESPHLQNFMGTDNLGRDIFARTCSGIKISLFIGFSVTLVSLIIGVFIGTISAYYPIT
FT                   EKFLMRVVDAIMAFPTIILAIALAGILGAGVKNIIIALSISYFPMIARIAYNSVKQVKE
FT                   TEYVESTIAIGKGDLYIITHCILPNIISPIIVQTTYIFAMAILNESILSFLGVGIQAPM
FT                   PSLGGMVNDGRNYFMTAPWIMTFPGLTISLIVFSLNTFGDGLRIYYDPRERN"
FT   gene            103698..104663
FT                   /gene="dppD"
FT                   /locus_tag="CLOST_0085"
FT   CDS             103698..104663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="CLOST_0085"
FT                   /product="dipeptide transporter ; ATP-binding component of
FT                   ABC superfamily"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7536291; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20215"
FT                   /db_xref="GOA:E3PR80"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20215.1"
FT                   /translation="MCRLLEFNKVVIKAKERKTNVTILEDISFSIEKGQTLGIVGESGC
FT                   GKSITGKSILGLLNKHINITDGEIIFRDKVISNISEKELRTFCGKEIGMIFQEPMTALN
FT                   PLLTIGRQISEPLFIHLKMNKKQAYNKSLELLRDVGINEPEKIIRSYPYELSGGMRQRV
FT                   LIAIAISCNPLLLIADEPTTALDVTVQAQVLRILKKLIKDRNMSLLLISHDLAVISQMC
FT                   EKVIVMYSGEIVEEDTTENIINNPKHPYTKKLLSSARELIKGQEKLTIVNGSVPRPEEI
FT                   ILGCKFSKRCEEVQERCFFNRPLLVSKVNSNGKVKCWENI"
FT   gene            104697..105659
FT                   /gene="oppF"
FT                   /locus_tag="CLOST_0086"
FT   CDS             104697..105659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="CLOST_0086"
FT                   /product="oligopeptide transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 86111606; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20216"
FT                   /db_xref="GOA:E3PR86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20216.1"
FT                   /translation="MNNEYLLEVKNISKKFSSDKNTNPAVKNLNFSLKKGEVFSIVGES
FT                   GCGKTTTGRIILRLIEADSGEIWFKGKEIRTISKKELKNLRPSMQIIFQDPYGSLNPRM
FT                   NVKKLLYEAISSDKDLSKEELKKKTESLVKSVGLSVDDLKKYPHEFSGGQRQRIGIARA
FT                   IATEPDLIVCDEPVSALDLLVQAQILNLLKKMQKDNQYSYIFISHDLSVVKHMSDRVAI
FT                   MYLGQIVEVGTNQEIFDTPIHPYTKLLLDSVLNLEANCSFDLNTEYQDINMSDYDENSC
FT                   CFYHRCPYKDSNCNNYKNEYQKITNTHYVACKKYNLLKI"
FT   gene            105713..107356
FT                   /locus_tag="CLOST_0087"
FT   CDS             105713..107356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0087"
FT                   /product="Related to oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20217"
FT                   /db_xref="GOA:E3PR87"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20217.1"
FT                   /translation="MKKKFLRVLNFMLVFSLLATLLVGCKSETTTQATSQEANEASSTE
FT                   ETLEPKFGGEITVAFQSAPDNFDPDHPSSDWVVTAVTNHTYEGLFEFSGQNQAVPHLAE
FT                   SYKVINDGKGYEIILRKGIKFHDGEEMKADDVKASMERWFKVNPAGAAIADTFTGIDIV
FT                   DDYKLVVNFNEVYAPFINILASPVSRQKMLVKKKEIIDKFGESIITEHIGTGPFYFHEI
FT                   VMGQKVVLKKYDDYVPLELEASGLAGKRVAYLDKVTIEFVPEESVRVSGLKSGQYDFID
FT                   ELSTDRYDEVDSFPEISPTAANYGTIGVVAFNSGKSPFSDINLRKSVAYAINPHDMAAA
FT                   QIGDSKFWSVDDGSWFAEGSIWYDAKAGEGIYNNHNVDKAKEYVEKSNYGGELITILGE
FT                   KADLFMSNGALVLQNQLKEIGLNVEVQLYDKSTYSDYRQNGKWDITLSRWSDMNPDPQV
FT                   FEPWTGTNGWITNWDDEDSRRIDEIFSRMEKEMDYDKRYKIVQEFYNEFWETLPYIKVF
FT                   NDKRLYGIKDNLKGYAGFGQPYFWNVWISE"
FT   gene            107366..108187
FT                   /locus_tag="CLOST_0088"
FT   CDS             107366..108187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0088"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20218"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20218.1"
FT                   /translation="MKNVNVKKASIVLNLQKQIIGIKLIDLKEEFESINLEKPLKNGPL
FT                   CFHFREAMEGHIYKISDENITCEYAKYALGIQKPDSTILEGRSYKYCGLYESNTIAREI
FT                   VESMKYLNQNIYGLIVGPLELMEDADLVVFVDCAETIMRTMQGYAYKYGTPKNLNFFGN
FT                   QASCADLVSKPYSNNDINLTLMCRGMRANGRFDKGELGVAIPINLFDSLLEGIVATANP
FT                   VLNPKEKQRILDQSADYDFEIEFDMSYNYGKGLREYDQKVKDMRIKDRNHE"
FT   gene            108306..109280
FT                   /gene="metN"
FT                   /locus_tag="CLOST_0089"
FT   CDS             108306..109280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="CLOST_0089"
FT                   /product="DL-methionine transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12169620, 12218041, 94124004; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20219"
FT                   /db_xref="GOA:E3PR23"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20219.1"
FT                   /translation="MIESINLQKSFGNTQVFKDINLKIEEGDIYGLVGRSGAGKSTFLR
FT                   CINGLEKYDSGSLMIDGIEVRDYYNKGIREFRKNIGMIFQHFSLMNRKTVYENIALPME
FT                   CWKYNKKDIDKRVKELLELVGLEEKMNDKPKILSGGQKQRVAIARALALNPKILLCDEA
FT                   TSALDPKTTSSILKLLRDINEKLGITIVVVTHQMSVIREICTKVGILEHGELLTKGDVE
FT                   DIFLQQPQSLINLLGEEENSILPSKGKNIRMFYRKEDIATNIISRMARKSDVDFSIVWG
FT                   KLEKYRDGVLGSIVINTEEENVGIITDYLTTLGIKWRLIDNGQ"
FT   gene            109270..109926
FT                   /gene="metI"
FT                   /locus_tag="CLOST_0090"
FT   CDS             109270..109926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="CLOST_0090"
FT                   /product="DL-methionine transporter subunit ; membrane
FT                   component protein of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12169620, 12218041, 12819857; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20220"
FT                   /db_xref="GOA:E3PR24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20220.1"
FT                   /translation="MDNNLTILNSIIWPELLKTFYMVFFSTFFSTIFGFMIAIVLSITR
FT                   KDGLNPNETIYKVLNTLINVIRSFPFIILMVAIIPLTRALVGTSIGPKAAIVPLTVVVS
FT                   PFIARLIESSLNEVDKGLIEAAKSFGASNLQIVFKVMIKESIPLIISSITLAIISIIGF
FT                   SSMAGALGAGGLGAVALTYGYQSFNTTIMYGTVVVIIFIVQIVQATGNFLYRKLK"
FT   gene            109959..110807
FT                   /locus_tag="CLOST_0091"
FT   CDS             109959..110807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0091"
FT                   /product="putative D-methionine-binding lipoprotein metQ
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20221"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20221.1"
FT                   /translation="MKSKKIISLFSIIMLSIAMVGCSINANSSDDTSSEVDTKVEEKEI
FT                   IKIGTTGFFKDIVQEAKKDFESTSGYELEVIVFDDNVTPNIALDEGSIDVNFYQHVPFL
FT                   DAFNKERGTNLVKYGEKGIACTYGIYSSKLKSLEEIPNGAKIGIANDSSNRTRGLRFLE
FT                   SNGFIKIKDGVDLPTKLDVIENPKNLDLIEIDGPKLISSMEDVDAVVGYGIYMLLSGKD
FT                   PKSAIIFDNEEDTKRYADVIVLREDNKNVEWVKHLEAALTNEKMRKYMDEELEGAYIPA
FT                   Y"
FT   gene            110934..112001
FT                   /locus_tag="CLOST_0092"
FT   CDS             110934..112001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0092"
FT                   /product="putative Methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20222"
FT                   /db_xref="GOA:E3PR07"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20222.1"
FT                   /translation="MIQEVMSSNERMKKLIAREKIDRVPVNPLVSLYAAYITNMNAKEY
FT                   FLEPEKAMEAQLLARELHGYDAGPSYNIPDGNGWDFGGLIEIPDSPRITLPKLTKRAIK
FT                   SSNEVEKLKVPNPMTAPAMSRYLRFGELSVEKGFSSVTVGAGSPMGIAESIVGAELLLR
FT                   WIRKEPSLVHRLLRIATDYILEVGQIYVNKFGSENCSAFSTYPMECHELMSPKMFEEYS
FT                   LPYVKEIHEKFINMGIKKWTIHLCGDHTKNLIHWQENIKLVPRTIFTPGHEMDILKTGK
FT                   ALGEDYVIGGNVHTTLMQIGSARDVYKASKEIIEKMKYHPGGFILTPDCVLPSHTPPAN
FT                   VHAMIKACKDFGRYN"
FT   gene            112255..112725
FT                   /locus_tag="CLOST_0093"
FT   CDS             112255..112725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0093"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20223"
FT                   /db_xref="GOA:E3PR08"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20223.1"
FT                   /translation="MYVTVTGKGKLRVIQFSGSNLEHLYSQNHNFVISYTLKKSSEEFK
FT                   KLVWEENEWSVKVNPDTGEIFSKEKIVSKELEFKVPISESQIAIECESKKRGRPKKYDK
FT                   KTVLVNIYLTWSASRVAKYRSDRMRMIDRLKKNMTLTQFKITTKLNLSTNLE"
FT   gene            112954..113112
FT                   /locus_tag="CLOST_0094"
FT   CDS             112954..113112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0094"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20224"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20224.1"
FT                   /translation="MSNTSIEQMKKIIEEKKKKSTQQGKAGSTTSKTNSGPSKGFKSMK
FT                   RAGSLNK"
FT   gene            113145..114959
FT                   /gene="ywjA"
FT                   /locus_tag="CLOST_0095"
FT   CDS             113145..114959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywjA"
FT                   /locus_tag="CLOST_0095"
FT                   /product="putative ABC lipid transporter (ATP-binding
FT                   protein)"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20225"
FT                   /db_xref="GOA:E3PR10"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20225.1"
FT                   /translation="MAENVQNRKHSTWELFKRFVPYFSKYKTTLYLDLFFASLTTLCEL
FT                   ALPLILRKIATVGMEDAALLTKELIWQMAGIYFVLRIIDVLGNYYMSSVGHIMGAKIET
FT                   DMRRDAFSHLQNLSDSFYNNTKVGQIMARITSDLFDVTEFAHHCPEEFFIGALKLVISF
FT                   AILAKIDLVLTMAIFIFIPIMLVSVTKFNRLMRSAFKSQRNHIGDLNAGIEDALLGMRV
FT                   VRSFANEEIEKEKFERDNQKFLGIKKQAYKYLAGFHSMTRIFDGIMYLMVILLGGFFIL
FT                   NGRINAADLLAYIMYVTTLLATVRRIVEFMEQFQRGMTGIERFIEIMDTDVDIKDEPDA
FT                   VELKHVDGKITFDNVSFEYPDDHNKVLSKLSFVVEPGENIALVGPSGGGKTTLCNLIPR
FT                   FYDVTEGNISIDDSNIKNFTLNSLRSKIGMVQQDVYLFSGSVFENIEYGRPGASKAEVE
FT                   YAAKLAGAYDFIMNLHDGFDTYVGERGVKLSGGQKQRISIARVFLKNPPILILDEATSA
FT                   LDNQSERIIQQSLVELSKGRTTLTIAHRLSTIRGAHKILVLTEEGIKEQGSHSELMALK
FT                   GMYYDLYTQGNQEEDTLPEDIDAKKKPK"
FT   gene            complement(115060..116856)
FT                   /locus_tag="CLOST_0096"
FT   CDS             complement(115060..116856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0096"
FT                   /product="Membrane associated methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20226"
FT                   /db_xref="GOA:E3PR11"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20226.1"
FT                   /translation="MKGTVVGTWVKTLSRMYPEDIVKEKMKVAGMDPNKAISPLDDIED
FT                   AKVFRFTNEISKQFSIKEEDLWREIGRDNIKAFYEGYSSFFKKANLFQFLNSMNDVHQV
FT                   VRKRISGSNPPGLDMEIIGTNDVLLTYRSKRGMFNYLHGLIIGAKAHFNEDVKVKELYR
FT                   KDGEMQLQLTFPYEVRKRKTYQINKLMSLGFIKDLGAKVSIFAVIIGLIAGFLTKDVAY
FT                   GYVIAPVVTALFAFIGFKMLSLPLEDIKNELNALSAKNFVITTEIATGKDMYEEIHSAL
FT                   NKYKESVAEDFIGFNSMTEEMQGFSDTLSGISKKMDTTSKDIADVVEQLAYSATTQADE
FT                   TEHGVSMLQDNVESIKNISEQENKNKTELEDALTNIKDSFKALDNTVVSLGNILEKFEN
FT                   VRNESINLKNKGKEIEEIASFVSSISYQTNLLALNASIEAARAGEMGRGFSVVAEEVRK
FT                   LAEQSETAADNIKENVYGFLSEMDNMVSSITDQYDVINSESTSIKQAIEKTESANGKIE
FT                   TVAEKMLVTAVELESQSEKITSMFTNIESLAAIAEENSASTEEVSSNVTSYSEEILKLT
FT                   EGINDFKKLTNEFKGYISTYKL"
FT   gene            117119..118855
FT                   /locus_tag="CLOST_0097"
FT   CDS             117119..118855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0097"
FT                   /product="ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20227"
FT                   /db_xref="GOA:E3PR12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20227.1"
FT                   /translation="MIQVKKLSFDFPAKVLYKEVSFSLEMGQHCAFIGSNGSGKSTLVD
FT                   MIINPDKYMYDGKIIKDESCRIGYASQFAVRDKEQEQTVFEYLSEKFVKNQNSTVAICE
FT                   EMAVAENVEPLFEKYQALLDEFVSMDGDNYISNIQKQLYIAGMRELEETKLSELSGGEY
FT                   KLLQIMKEMLLSQNLLVLDEPDVFLDFGNLNRLCKLINGYKGTLLAITHNRYLLNHCFN
FT                   KILHLEDGDIQEYDGSYSEYRCSQLKEKLKLKQQSIEEQEEIYRTEKMVDALRIRATIV
FT                   ANPTLGNAVNAKQTQLDRLLARQIKEPFIELREPLIEFKPVEAKDDYTVLSVTDYSVSF
FT                   DDVLLENISFELKSGEKVAIVGPNGTGKTTLIKDILKNNHPSIKIDENINYACLSQLTD
FT                   ENIDETKTVFEVMENLGFETKESISGYLEKFCLEGDALKQKVGQLSGGEKNLLKIAMIA
FT                   NTNAELLILDEPTSHLDIYVQMAVEKAISEYKGAVLMISHDFYLIANCADYVLLVEDKT
FT                   LKRMRTRTFRKMVYDKYFNKEYLEVDKKKQELEAKITLAFKMDELMKVEKLCNQLEEIS
FT                   SN"
FT   gene            118864..121119
FT                   /locus_tag="CLOST_0098"
FT   CDS             118864..121119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0098"
FT                   /product="putative Peptidase U32"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20228"
FT                   /db_xref="GOA:E3PR13"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20228.1"
FT                   /translation="MEGKMAELLAPAGNMEALIAAISNGCDAIYLGMQKFGARAYSSNF
FT                   DFESLKEAISYAHLRNVKIYVTMNTIVFENEIEAMKQQMHQLNEIGVDAIIVADLAAFD
FT                   YLVNNFADMEAHCSTQMGIDDLDGTLFFKELGAKRIVLSREVPIEKVKEIKKIAQVPLE
FT                   IFVHGALCVSYSGNCLMSGLIGYRSGNRGRCVGSCRKEYEIIDKTADEALGKNYILSTK
FT                   DLNTIDYIDDLKEIDSLKIEGRMKEPAYVANVVSRYRRALDYKITEEDKTNLSKTFNRT
FT                   FTKGYLFHEDKKDITNILRPNNYGYEIGKISNIVKGMYEIKLTRPLNQNDIIRISHNNE
FT                   DIVLTVVKLYDKEGKLINRANDVGYIKIKEKLSKDDVVYLTKDYLYYKELESSLEKEFK
FT                   RFNLDIKVNAQPNSKLIIEAEGLGFNFLYEGEDILSEAINNPTTKEQVIKQFSRLNDTI
FT                   FELNNVIYEECNVFIPAKLLNVARREIVQALYELKLNSKKKSIKAFKAKEKISFTPREP
FT                   FFTASVTSKEQYDACVSCGIKEIYFDNTVRRNQNDYKEKEGQLLIGGYGGIYHYRKTNP
FT                   FITDYSLNVVNSDSCYELFKLGAKRVTLSYELNKTQIEDLISSYYEKNDGYPALEMIVY
FT                   GRAPMMFSKYCPLKKMNQCGCCKTRSYELKDEHGTFPIITHDDCTTTILNGKILNLLDE
FT                   VQNIEGVEAFRLNFTVESKEQVIKTINMAMKKLKSKDNQIIFNKETDTRGHFNKEIM"
FT   gene            complement(121224..122846)
FT                   /locus_tag="CLOST_0099"
FT   CDS             complement(121224..122846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0099"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20229"
FT                   /db_xref="GOA:E3PR14"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20229.1"
FT                   /translation="MNKNTIFILISILLGSGVGYAYGNQMLGLVPALVIIVLLIAIAIY
FT                   ISASSGITSNKDLINGLKAVVSGDYGYNFKMRLGATGEMGEVAAELDKIMLAVNHMIAK
FT                   MKVSGEQSAYESEKVYHQLEINNEVSSNISHAVEKIAYGSTEQKEHIDEITENSSEMTK
FT                   HASSIADKCEHNYKLSVTVEKSVNDVKQYVDKLLDGIEFTGDVTKTSASKIHDLKRKVE
FT                   NISNFITVVTKISEQTNLLALNASIESARAGEAGKGFAVVANEVRKLAEESRLASEDII
FT                   KIVNEVVKETELVVEQIDSNTATVAQNVSMVSEVKALIEQTATHINQMENEISSIKDIT
FT                   INQAKESEKIAEALAQVSNLSNDIASQTQNVYAACEEQTSSAEQMMSSCEILTKSSKDA
FT                   LDQVKEFSKGIVISELKKKEINRLVSELKKLALTSALTGMDYNQHKKAIDDIVSKEKNL
FT                   SVVYSATPETHNLHYINLNLKMDTVAFREWYKNPLTSKNNYISEVYVPLGSDSPCVTIS
FT                   VPIIDNGQVVGVLGADLELSEIQ"
FT   gene            complement(123186..123761)
FT                   /gene="pdxT"
FT                   /locus_tag="CLOST_0100"
FT   CDS             complement(123186..123761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="CLOST_0100"
FT                   /product="Glutamine amidotransferase subunit pdxT
FT                   (Glutamine amidotransferase glutaminase subunit pdxT)"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20230"
FT                   /db_xref="GOA:E3PR15"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20230.1"
FT                   /translation="MKTIGVLALQGAFIEHVNHIEKLGHKAVEIRKKDQLEGIDGIILP
FT                   GGESTAIGKLLVDFDIKQALKEKIESGFPVWGTCAGMILLAKKLIDDPIVHLGCMDITV
FT                   KRNAYGSQLDSFITVDNIKALDDKPSKLVFIRAPYIEAIGNTAKALHTVDENIVAARQE
FT                   NMMVTSFHPELTDETLWLEYFINNLVIN"
FT   gene            complement(123763..124641)
FT                   /gene="pdxS"
FT                   /locus_tag="CLOST_0101"
FT   CDS             complement(123763..124641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="CLOST_0101"
FT                   /product="Pyridoxal biosynthesis lyase pdxS"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20231"
FT                   /db_xref="GOA:E3PR16"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20231.1"
FT                   /translation="MENRYDLNKNLAQMLKGGVIMDVTNAQEAKIAEEAGACAVMALER
FT                   VPADIRKDGGVARASDPKMIKEIQSAVSIPVMAKVRIGHFVEAQILEALSVDYIDESEV
FT                   LTPADPSLHIDKKAFNVPFVCGAKNLGEALRRIGEGASMIRTKGEPGTGDVIEAVRHMR
FT                   MMNSEIRRIQGLTKEELMNAAKELQAPIELVTYVHEHGKLPVVNFAAGGVATPADAAMM
FT                   MQLGCDGVFVGSGIFKSGDPRKRAAAIVKAVTNYNDPKILAEVSENLGEAMVGINVYSI
FT                   SKDDIMADRGY"
FT   gene            complement(124778..125593)
FT                   /locus_tag="CLOST_0102"
FT   CDS             complement(124778..125593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0102"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20232"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20232.1"
FT                   /translation="MKKNNILFKSFLHKLGIITLILISIFNFSHGSSPVYANHSIGVYI
FT                   DNKPLKMDVPPIIRSGRTLVPISAIGNALSCKITWNERNQSVIIRKQASIIRLSINSKL
FT                   AYIDDNPMHLDYPPVIVNGRTMVPLSFVANALNYDIKWDPVRMNVYVHSDPVNMTMAEA
FT                   KAADSSIKVLDITTLEMNIDGQIKKVQLANVVCANEDNKLLNTGGACILGSISNPKLDE
FT                   IKELLASGNVSVKVTQNLDKDTVIAEVYIDGASLSQLLIELGYANSIKN"
FT   gene            125729..126202
FT                   /gene="yaaJ"
FT                   /locus_tag="CLOST_0103"
FT   CDS             125729..126202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="CLOST_0103"
FT                   /product="YaaJ"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20233"
FT                   /db_xref="GOA:E3PR18"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20233.1"
FT                   /translation="MMNKEFFMREALKEALKSYSINEVPIGCVIVKDGEIIARAHNNRE
FT                   QNKDPLGHAELIAIKNAAKHLGGWRLVGCDMYVTLEPCIMCSGAIMDSRIENLYIGAID
FT                   DKRGCVASYLPILKDRMIPHNVNYEYIQTISPYIIKRFFRHLRRLKKESKNKI"
FT   gene            126311..126400
FT                   /locus_tag="CLOST_tRNA2"
FT   tRNA            126311..126400
FT                   /locus_tag="CLOST_tRNA2"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            126565..128256
FT                   /locus_tag="CLOST_0104"
FT   CDS             126565..128256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0104"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20234"
FT                   /db_xref="GOA:E3PR19"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20234.1"
FT                   /translation="MRILHIANNPNLSTQIKTAIRDRYNGYETVTFDELKNHEKNIDYY
FT                   RLIIIEADCTSQEQCEIVLNKILEAKKYLVNTIIISHGMSVAMKEHLYDNGVMAIIDRD
FT                   KIDLKRFRRYISSIESETQTISSLKNMKIAVVDDSRFSLQVLNDFFDKSGIHTVDYYND
FT                   SEKFLNSDLKYDLYVIDLVMPVYDGEDVIHRIREQNNDGIIILVTQYGDVRAISHCLSI
FT                   GADDFILKPLDFKLFMLRLSSCIKNYKVKKKNINKTNKLYQRAMRDSLTGAYNRSYLKE
FT                   KFSKEFLKGCKNGETFSVILFDLDFFKQINDEYGHQKGDLVLKGTADLVSKLIRKTDVL
FT                   CRWGGEEFLVMLPGAHLEEATIVAEKIRREVETLRVKGVKKITSSFGVTQCQNEDTEDS
FT                   LFKRVDNSLYLAKLTGRNKVVYDEEVYIAKGGIPVNIDWGPFFRSGNPQIDKEHEELIS
FT                   ISNDIISNCFIEDNLEEILVMFKRLLDHVSLHFENEEAILLEHSYEEYEQHKKIHNDLV
FT                   IKAKNMYDALEKGLISPIAVVKYVVQDVVVGHIIKSDFDFFELFNK"
FT   gene            128338..128973
FT                   /locus_tag="CLOST_0105"
FT   CDS             128338..128973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0105"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20235"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20235.1"
FT                   /translation="MTDTQNFINRQEIIDTARMLKDKHVRYSLGAKAVPPAIPKELDCS
FT                   GFVRYCYLAAGIAVPDGSWHQWHVSEPIDKSQLEIADLGFLYDPNKNSEINHIGLYLGD
FT                   GKWIHCSYSAKGVTVDDGKVFKYFRRFINLSKVPEKHLDASTNPPKWMITVTEKEKQYA
FT                   VDSIHVLADLGYILNPSVHIKNLYDSPENWAQWVVLANMAKEFGKKQS"
FT   gene            complement(128945..130147)
FT                   /gene="cdu"
FT                   /locus_tag="CLOST_0106"
FT   CDS             complement(128945..130147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdu"
FT                   /locus_tag="CLOST_0106"
FT                   /product="putative Na(+)/H(+) antiporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20236"
FT                   /db_xref="GOA:E3PR21"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20236.1"
FT                   /translation="MLFSLSLILILGFSLSGIFNRLRLPGLLGMILTGIILGPYALNLI
FT                   SPDILDISSDLREIALIIILTRAGLNIDIKDLKKVGRPAILMCFVPALFEITAVTLLAP
FT                   IFFNISYIEAAIMGSVLAAVSPAVIVPRMIHLIDSGYGKDKSIPQLIMAGASVDDIFVI
FT                   VLFASFMGMYSGEGFNPTSLLLVPVSIISGMGLGIISGFIFVKVFKAIHVRDTVKVLIM
FT                   LSIAFLFVSFEDFIKPYFPVSGLLAVMAFSATILSTYEVLAKRITGKFSKIWVAAEVLL
FT                   FVLVGAAVDISYLKGAGIASIVFILSALVFRIVGVNVSLLGTSLDKKERIFCSIAYLPK
FT                   ATVQAAIGAVPLAAGVGAGNLILTVAVVAILISAPLGAIGVDNTYKKLLHKSKTAFSQI
FT                   P"
FT   gene            130580..130682
FT                   /locus_tag="CLOST_misc_RNA_38"
FT   misc_RNA        130580..130682
FT                   /locus_tag="CLOST_misc_RNA_38"
FT                   /product="SRP_bact"
FT                   /inference="profile:Rfam:8.1"
FT   gene            complement(130734..130889)
FT                   /locus_tag="CLOST_0107"
FT   CDS             complement(130734..130889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0107"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20237"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20237.1"
FT                   /translation="MLFSPFSTLIESIPKSILAYLNIISDLQLDLLILYIKIDRMRIHT
FT                   VQYVKI"
FT   gene            130895..132553
FT                   /gene="dnaX"
FT                   /locus_tag="CLOST_0108"
FT   CDS             130895..132553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CLOST_0108"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20238"
FT                   /db_xref="GOA:E3PR27"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20238.1"
FT                   /translation="MEKNMHKALYRIYRPTSFIDIVGQEQIISILKNQISEGSVSHAYL
FT                   FSGGRGTGKTSTAKVFAKAVNCIDPVNQEPCHKCSVCVQGDMDIIEIDAASNNSVDNIR
FT                   ELRENVVYTPSYGKYKVYIIDEVHMLSQGAFNALLKTLEEPPSHVIFILATTEPQKIPA
FT                   TVLSRCQRFDFKKIDKNQIIARMIKILDELGLTYEEEAIELIAQKSDGGMRDALSLLDQ
FT                   AIAYKELTYQNVVHVIGELDYREFHGFVKGIKEKTTVTLLENLQKIEAQGKDLKVFTRD
FT                   FISYTRDMMVCKSGASQLLSHSGDEIEALEESAALVDMDFIINLIETLSDLEVKIKYAT
FT                   KPKILIEACFIRLTKLTQMISSSSEAATLPQIEELSRKIDELELKISNLEKGVQKPKEK
FT                   VIQYQEEKKAKAAMPYIDDVRLQANIDDSEKQKLEEVKARMTQVHEVLRKQKNVHLKAL
FT                   LMEGEPVRYVNDCIYIGYDDNFAFHKQTIETQINADHISQALTKVFDKPLKVAFIFKRE
FT                   MGNIKKDEIDEEKNIIEEIKQAFPDVPLEIRERED"
FT   gene            132599..132946
FT                   /locus_tag="CLOST_0109"
FT   CDS             132599..132946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0109"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20239"
FT                   /db_xref="GOA:E3PR28"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20239.1"
FT                   /translation="MARKGGFPGGAMPGNMNNMMKQVQKMQKDMEKIQAELSEKEVEAS
FT                   AGGGAVTVKANGKKEIVSITIKQEVVDPDDVEMLEDLVLSAVNEALRSAEEMMSSGMSK
FT                   VTSGLNLPGMF"
FT   gene            132959..133561
FT                   /gene="recR"
FT                   /locus_tag="CLOST_0110"
FT   CDS             132959..133561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CLOST_0110"
FT                   /product="gap repair protein"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11743007, 12769856, 1698765, 2674903, 89313692, 95166174,
FT                   95166183, 98196719; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20240"
FT                   /db_xref="GOA:E3PR29"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20240.1"
FT                   /translation="MDYYSGPISRLIEEFAKLPGVGRKTAQRLAFHVINMDKDQVKALA
FT                   HAIVEAKNNITYCSTCCNIADKNPCSICDSPNRTSDIICVVEDPRDVAAMERTKEFHGK
FT                   YHVLHGTISPMDSITPDMLKIKELVGRMANPELKEVILATNPTIEGEATAMYIARLIKP
FT                   FNIKVTRIAHGLPVGADIEYADEVTITKALEGRREIF"
FT   gene            133931..134773
FT                   /locus_tag="CLOST_0111"
FT   CDS             133931..134773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0111"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20241"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20241.1"
FT                   /translation="MGWRNRPTYIEKWPKHTDVIMFIDENGESSLKNIQKKIKKGSKID
FT                   INEKIFTITGCVINKKNFLEVRENIISLKDKYWDEGKFNYNNIKIKRVCFHSNEVRGRK
FT                   GPFSDKVIDYNNFICDLSGFMENLPATIFSSTIDKEEHCKKYITPLHPYNLCLDFVLER
FT                   FVKYYLKPNEYGVIVLEARGAGEDRFVLNHIKEVIDKGTRCVNDSYFKKIKGVYFNPKW
FT                   CKKHQEQLSYFGLECADLYSYPIHKHIKFNTKDKPFEILEKKIYGYPNYSGYGLKVFP"
FT   gene            complement(135648..135974)
FT                   /gene="malR"
FT                   /locus_tag="CLOST_0112"
FT   CDS             complement(135648..135974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malR"
FT                   /locus_tag="CLOST_0112"
FT                   /product="putative regulatory protein malR"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20242"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20242.1"
FT                   /translation="METKTDMKYNCPIQYTLDLIGGKWKLVILWHLASEGIMRYSELRR
FT                   SLKGITHKMLSQQLKELESDGFIHREEYPQVPPKVEYSLTDFGKSILPVLKGMSEWGTL
FT                   NMNK"
FT   gene            136145..136744
FT                   /locus_tag="CLOST_0113"
FT   CDS             136145..136744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0113"
FT                   /product="Nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20243"
FT                   /db_xref="GOA:E3PR46"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20243.1"
FT                   /translation="MSKNFYEALKERRSIYAISKESGVSNERIQEVINEAVLHTPSAFN
FT                   SQSARVVVLFGENHNKLWDITEASLKKIVPEENFAPTKEKIDSFRNGYASVLFFEDQNV
FT                   VKNLQEQFSLYKDNFPVWSQQSSGMLQYVIWTALAVEGLGASLQHYNELIEEDVAKEWN
FT                   IPSGWKLVAQMPFGKPVSGAGEKEFMPLEERVKTYL"
FT   gene            136795..137493
FT                   /gene="pirA"
FT                   /locus_tag="CLOST_0114"
FT   CDS             136795..137493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pirA"
FT                   /locus_tag="CLOST_0114"
FT                   /product="pirin"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20244"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20244.1"
FT                   /translation="MLRKIYHKNMGSSESPWLKSLFHFSFANYHNPNNINFGVLRVVND
FT                   DLVSSDTGFDMHPHRDMEIITYVLDGELTHEDNMGNRNTISRGHVQYMSAGTGIYHSEH
FT                   NLGKDVLRLLQIWIFPDKKDHKPNYGDFKIDEKDRKNKWFHMVSAKNGEAPIQINQDAN
FT                   FYVIELDKDKETEFLMGSDRQAYIVQIEGSSEVNDINLSERDAMEVVEENLKIKALENI
FT                   HLLVIEMKKA"
FT   gene            137617..138180
FT                   /locus_tag="CLOST_0115"
FT   CDS             137617..138180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0115"
FT                   /product="putative Nitroimidazole resistance protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20245"
FT                   /db_xref="GOA:E3PR48"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20245.1"
FT                   /translation="MRRKDREMSEEFALGIIDKSRYGIVSMIDGDNMPYGLPLSIVRDD
FT                   KNLYFHSAMDGRKVHALVHNQKVSIAFVGEVNVPDNYTKAQLDELAIDESKAVTFISSV
FT                   FTTEFESAIASGTVEKLENEAEKIHAMKLICQKYTPDKMAYFDIAIKVGLGRTNVYKIT
FT                   IESITGKRKKYDSKGIEMKFGRME"
FT   gene            138238..138450
FT                   /locus_tag="CLOST_0116"
FT   CDS             138238..138450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0116"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20246"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20246.1"
FT                   /translation="MRTLKIGKKYRHFKGKEYLVMHIAKHSETLEELVIYQALYGEMGV
FT                   WVRPLDMFLEQVEVNGQMVNRFEEI"
FT   gene            138687..139208
FT                   /locus_tag="CLOST_0117"
FT   CDS             138687..139208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0117"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20247"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20247.1"
FT                   /translation="MIKLIGVLIIVIGFALKLDTIAVVLIAGIATGLVGGLSFPEILSV
FT                   LGEAFITNRYMSLFLITLPVIGILERYGLRERASDLIKSMKTVSAGKVITTYTFIREIA
FT                   AALSLRLGGHVQFIRPLVLPMAQGAAESNHGEISEEDLEEIKGYSAAAENIGNFFGKMY
FT                   LLLVVESCLS"
FT   gene            139229..139375
FT                   /locus_tag="CLOST_0118"
FT   CDS             139229..139375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0118"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20248"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20248.1"
FT                   /translation="MEVEPLGVAKASIPIAIIAFVYSVVQNHMLDKRIQKRALTNKKVD
FT                   KGA"
FT   gene            139378..140292
FT                   /locus_tag="CLOST_0119"
FT   CDS             139378..140292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0119"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20249"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20249.1"
FT                   /translation="MVDILLEIFYILSGLVAFSAAYMAFKDANHPKKIGTAMFWILLGL
FT                   TFMIGKYIPAEIVGIMILAMGGLTAFKQVAIGNQENAPDEFRQRESERIGNKIFLPALS
FT                   MAVFAFLIAQFTTLGGLVGLGIGTVISIIMTLAMTKANPSYISYDGSRLLQQIGSSSIL
FT                   PQLLAALGALFAVAGVGEVISTGISSVIPQGNILLGVIAYCLGMAIFTMIMGNAFAAFA
FT                   VITAGIGIPFVYSQGANPAIVGTLALTAGYCGTLMTPMAANFNVVPAAILETKNEKRVI
FT                   ISQIPFAIAMLLTHIALMYFWAF"
FT   gene            140316..140957
FT                   /gene="pcp"
FT                   /locus_tag="CLOST_0120"
FT   CDS             140316..140957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="CLOST_0120"
FT                   /product="Pyrrolidone-carboxylate peptidase
FT                   (5-oxoprolyl-peptidase) (Pyroglutamyl-peptidase I) (PGP-I)
FT                   (Pyrase)"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20250"
FT                   /db_xref="GOA:E3PR53"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20250.1"
FT                   /translation="MKVLITGFDPFGGEKINPAWEAVKGIKDIIEGAKIIKLEIPTVFN
FT                   KSIEKVKEAMELEKPDIVLCIGQAGGRYDMTVERVAINVDDARIEDNEGNQPIDIPVFE
FT                   DGENAYFSNLPIKAMVEEIKGQGIPSSISNSAGTFVCNHIMYGVLYHINKTYKNMRGGF
FT                   IHVPFINEQVLDKKNQPYMPVEHITKALEAAIKAAVINNEDIKKSGGAIC"
FT   gene            141077..141751
FT                   /locus_tag="CLOST_0121"
FT   CDS             141077..141751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0121"
FT                   /product="putative CAMP-binding domains-Catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinases"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20251"
FT                   /db_xref="GOA:E3PR54"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20251.1"
FT                   /translation="MYDLLFEEKKQEEMKQFFVNLASSGNIKKYKKKELIDIEGYEFVG
FT                   IVLEGTVKQTLYSPQGLEKSLFFLKRGEIFGEMDYFTQSKCELIVKAVEASEVAIINKK
FT                   ALEQALRESPKNYEFFIHSMVRKYRITLFQMKSMVFNKSIKRLADTLLRLSYQDSTKKD
FT                   DKTVLNRIFTHQELAELIGCSRITVTNDLNELKKRKLITVKNKEISIDNLKNLENYLQD
FT                   ED"
FT   gene            141751..141888
FT                   /locus_tag="CLOST_0122"
FT   CDS             141751..141888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0122"
FT                   /product="Putative membrane-associated protease precursor
FT                   (CAAX amino terminal protease family protein) (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20252"
FT                   /db_xref="GOA:E3PR55"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20252.1"
FT                   /translation="MIVGYIFNYLAEKYESFLASWIVHIFANLAINTIGFMMLGIINII
FT                   "
FT   gene            142168..144702
FT                   /locus_tag="CLOST_0123"
FT   CDS             142168..144702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0123"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20253"
FT                   /db_xref="GOA:E3PR30"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20253.1"
FT                   /translation="MYTIIAALIAIGLIFSLFKTFDTRLLEEVEKNLTIENEYYKTSIS
FT                   SQLEKKSEIINNLSTYMESKRQLDYDELLDYMKAMLNKNSNIESIYFGSTDNLLVNGSG
FT                   WIPPEDFDLRTRPWYVKAINHGKLVITDVFLNATSEKYIITIAKPVYSNNGQVIGVLGA
FT                   DLSLDSIVDLISVQDDSYGEFFILNEEFELIAKSRTQDDGKPILEDTSLKISSNISSIG
FT                   TSVAEATLNNEKGYVSISHIDGTNLYVGVFNSIGSENYYDKQWKNILIISVIFLVGLLL
FT                   IMFLIQNKIIIKPAYTLENDIKQISITDNINYRLEELKRDPFENIRKTVNARLAQTEVY
FT                   FRDLLESKDELESSNEELIAAMNQLKAYQEEIEQNQNDLLESKLLLEESQKRNAAIINV
FT                   LPDIIFMYDSKGVFIDCQTNDEAGLVLSKDLFIGKNISEVMPPDISEKAIMSIAKTIET
FT                   GQPQKFEYNINIDGSERTYESRMVKSNDNEVLAISRDITSEKQEQEYILKLTYKDQLTG
FT                   LYNRRYYEEQIEKLSGREFLPLAIMMVDVNGLKLTNDAFGHHIGDELLKKVAKNLISCD
FT                   SKGGFACRVGGDEFLMVFPNTDENEAEYLVDKLYELVSAEKLENIVISISAGWQVRTDV
FT                   SQSIRDTLIKAENHMFRKKIVESQSMRNQTVNIIMQTLSEKNEREKRHSVEVAKLAKEI
FT                   GVSMGLSVQKVKEIELAGLLHDIGKIAIKEDILNKPGKLTEEEYDEIKRHPESGYHILK
FT                   SVDEYSSLAQCVLEHHERFDGKGYPKGIKGTQISLIARIIAVADAFEAMIAQRPYRKSL
FT                   SQEMAIEEIKKNSNIQFDPEVVTAFLKIFDKS"
FT   gene            complement(144767..146101)
FT                   /locus_tag="CLOST_0124"
FT   CDS             complement(144767..146101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0124"
FT                   /product="putative magnesium transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20254"
FT                   /db_xref="GOA:E3PR31"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20254.1"
FT                   /translation="MEDKNQILEFILESPFETILEQIDEIHPVDFLEALGEFDDDPLII
FT                   LEKLPDEYVALLLDYAEDDEKFNLLSLFSKNRQAQIISEMSSDELVDLLGTLDEDEQNE
FT                   IITNMNTEEVEEVKTLLSYDPESAGGIMATEFISIKETDTVNETINYLRTMAPDSETPY
FT                   YIYVVDDLDVLKGVVPLRQIIVSTPDTLIKDIMIENIISAPVDMDQEEVSHIFEKYGFM
FT                   AIPVVDHNGEILGIITVDDVMEIMKEEYTEDMFRLAGLDEEEKVAGTVIGAIKSRLPWL
FT                   LVNLVTATLAAKTVSLFENTIAQIVALATFMPMVAGMGGNAGSQTLTLIIRGIAIGEIS
FT                   YENQAGILKKEIAIGIINGLCLGLVVGVLGYFWVGSLAFGFVIGTAMLLNLIVATISGY
FT                   LVPILLKKVGIDPALASAVFVTTVTDVLGFFFFLGLATVMLQYLI"
FT   gene            146490..148817
FT                   /locus_tag="CLOST_0125"
FT   CDS             146490..148817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0125"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20255"
FT                   /db_xref="GOA:E3PR32"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20255.1"
FT                   /translation="MKSIKSQILIYLVLVAVLIFSSLAYFSTKQLEKLNPYVEAQYLEI
FT                   ATARSDQISKELSGALEQVKMLSQSNVVQDMNKDEIMDFLISVNLGDKYRNMSFSDIEG
FT                   KGMNTKGVELDISEQEQFKEIILGDKDYWISDPFISPYAEENIPIITVSHVVKRDGIKI
FT                   GLINAVFSTAFLDEVVGGIDVGKSGFSWILDDNGNIVAHPSRDISIHTKATHLIPNQED
FT                   IDKVIKDEKGTMIYTCPEGHKFMASFSNIKGSPGWTFIVSIPYEEAFSEISTIIAFFKR
FT                   MTLIYFIIVAFILYLYARTLSKPIENLKKVFERAANGDLNVKADEKINNELGEAGKSFN
FT                   AMLSHIKNLTYRDPVTGLYNFNSFMLELPYKMEGLIGEYGIASISIISIDDFKRINSIS
FT                   GYQTGNKVLETLSKRILNFKMPSEMVARYFGDEIIVFLWEADYESLENRIIKLWQLCGL
FT                   PIDMNQHRFRLKTSIGTSIMSMEKGSYDEVIHEATMAKLKVKNSGGNGYEFYNEAISRM
FT                   IKEEEELDDAISKALEKEELYLVYQPIVDITTSEIISNEALLRWDNESYGRLPIPVVIE
FT                   FAERKGYIEDIGFWILKEACRQNKSWQDEGLGLTAISVNISVHQLEKPDFVDKVKIALE
FT                   LSNLAPEYLELEITETTAMENVNEKLATMLKLKRLGVKISIDDFGTGYSSLSYFTKFPI
FT                   DTLKIDKSFVRDMLEDSNAMTIIDTIINMAKAMDVAITAEGVETLEHMEKLKIMGCDKI
FT                   QGYYISKPQKASVLEQMLKKLP"
FT   gene            148856..150922
FT                   /locus_tag="CLOST_0126"
FT   CDS             148856..150922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0126"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20256"
FT                   /db_xref="GOA:E3PR33"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20256.1"
FT                   /translation="MIKNLGKRKLSIKQEVFYLGVVFSLVTLLLFGGILCTSIYYMQVN
FT                   HAKQALHDSNYHMAMIAKNQSRAISNTLQVLSNNPDVRTAGLSDDEALVSKVRSLYRDY
FT                   YNSDKNIMYIYSGYENGRIIIDNWTSPPEFDPRERPWYKHATDIKENKVVLGRAYQDAS
FT                   TKQWLVSSSTPLYGMDGEFVGVLSIDRTVENMSNIINEKNLYKSQYSFIIDGYGKILVH
FT                   PNQNMIQKTFSYFGAEVPSLSGEINFDEGGEPSWAFYSALGDSEWYLVTIVNKHEVLLP
FT                   LYQTIFILAVISIIIALILGAFQSRVLNTRLGRPLIVLGNRIRKISNGENLEKLKYYHS
FT                   NHEIVEIAQNIEKLASIAVKDKEEKLKTILFSVADGVIATDRKGIVEFVNPVAKAHINR
FT                   LEDRIVGRKIEEIFDIYSETDNCKVAVGLPKSWGENQYYNKEYYAKMRTQSGAEIPIEY
FT                   SISPIKDSKSKITGMVIVFRDYTVKKKKQEKIEYMSYHDPLTGIYNRRYFDEQIIELDK
FT                   EENLPLTIIYADINGLKLANDLKGHATGDKLIKLAASSIKKELRTNDIFSRIGGDEFGI
FT                   VLPQTGAEAAGLLIERIRASLEDKKVEGISLSISFGYATKYKPEEKISSIITDSDSNMY
FT                   SNKITESAIFKKNTIIDFRNAIENKHSMTLEDKLRTKKICDVAMIEMGIKGDE"
FT   gene            150924..151154
FT                   /locus_tag="CLOST_0127"
FT   CDS             150924..151154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0127"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20257"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20257.1"
FT                   /translation="MKRIIPIVITIVVCVYLFVYAVMTLKGMSLSEPLGIKLFMLSIGA
FT                   ISIGVMFAMVIALFRRLREIKEEEDDDISKY"
FT   gene            151135..151452
FT                   /locus_tag="CLOST_0128"
FT   CDS             151135..151452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0128"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20258"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20258.1"
FT                   /translation="MILVNTDYITGKELEMLSLVKGSTIRSKHVGSDIMNSLKTLVGGE
FT                   LDSYTEMMNEARAIATKRMVEEAYNLGADAVVNIRYASSAVMQGAAEVIAYGTAVKFIN
FT                   K"
FT   gene            151467..152333
FT                   /locus_tag="CLOST_0129"
FT   CDS             151467..152333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0129"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20259"
FT                   /db_xref="GOA:E3PR37"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20259.1"
FT                   /translation="MRYEGTVYRPPSEARSLIVQVTIGCAHNRCTFCSMYKDKQFRIRE
FT                   LEEVFEDLKSARAVYPKVKRVFLADGDALVLPTDKLIAILDKINELFPERERISAYATP
FT                   QDIMRKSSEDLALLKEKGLLMLYMGIESGDDTILQKIDKGVASADMLEAGKKAKEAGLI
FT                   LSVTMISGLGGPRGSAAHAIGCAKLVNEMQPEYASFLTLMLEEGTKLYEDYQSGEFLLL
FT                   EPRAVLLELRLFIQNTNLESCIFRANHASNYVALAGTLGADKQRLLNEIDTALKEDDFK
FT                   PEYLRGL"
FT   gene            152445..154025
FT                   /locus_tag="CLOST_0130"
FT   CDS             152445..154025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0130"
FT                   /product="putative Response regulator"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20260"
FT                   /db_xref="GOA:E3PR38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR021800"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20260.1"
FT                   /translation="MYNFNFEDSKFDLDFLAVDSGSKKMLSSNTFYKIIVADDDKDVHT
FT                   LTDMLFQDFDFENSPLQLIHTFSGKETIRAINAHEDTAVLLLDVVMEEMNSGIKVVEHI
FT                   RQVQKNKFTRIVLRTGQPGYAPEESLIRDYDINDYKLKTEMTRQKLYTMMYSCLRSYRD
FT                   LIQIETTKKSLEEMVKISGELFQKNSFDEFLDSIFQHIKLFQKYNYDFDKSIIEKRISN
FT                   NGFIVASCANEFKIISASGKYKSYKNTSIEENIELQDIFAKISNCKHSNKNIVFTEKGF
FT                   IFFNKGVQNSRTFVYIESKKENFDEALIQLLINNYVFALENYQLGDLLIKSQKDIIFTL
FT                   SETIERHSNETSNHVKRVSLLMKFLASRYGLDKKECETLAISSVLHDIGKIGIPDSILK
FT                   KPARLSADEFEIIKNHTTIGYDILRQNNHPHFEKAAQIAYCHHEKYDGSGYPRGLSKTN
FT                   IPLYARMMAIIDVFDALVSKRCYKESYPINEVVDIMRNESGKHFDPILLNMFLEGIDEV
FT                   KDIIYSHND"
FT   gene            complement(154027..154320)
FT                   /locus_tag="CLOST_0131"
FT   CDS             complement(154027..154320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0131"
FT                   /product="Sensor protein (fragment)"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20261"
FT                   /db_xref="GOA:E3PR39"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20261.1"
FT                   /translation="MNSIEHGFSNKEKGKIYIKCTADHEFLYMHYEDDGIGISSENLKQ
FT                   IYEPFFTTNRQNGNSGLGMNIVFNLVNQKLKGTMSAQSTPLEFTSFDFKIPI"
FT   gene            complement(154372..155937)
FT                   /locus_tag="CLOST_0132"
FT   CDS             complement(154372..155937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0132"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20262"
FT                   /db_xref="GOA:E3PR40"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20262.1"
FT                   /translation="MLKSKSRLANKLSFFIAVLLLAVFLLISVFCFRILFTQTQQNLLK
FT                   QVALQEKAISSEIVHIFENARQYTHQMSLNRDITTYLKGVDSKDEIRTHENYPYVLDYL
FT                   TKIKESSPLHFLAWVANEKANFYLDNSNTVPDESYVVKDRPWYEVALSSDKPVFTNPYV
FT                   EWNTRKTVVSSIQALREDTSVYGFVVVDIMLDTIPGIIESRTVDFNDKTFLITSDGTYL
FT                   YHPDKQKIMTESIYDDGLYEAMKSSTFKDFFEEIKYNDTSYFMSSYTIGENGWQLISLI
FT                   DSNRIKKEIINIFTSIVFIVLFFFLLAIISIYFIVSKTTKPYSILSIFADDIANGDFSK
FT                   NIPENYLKRKDEMGVISISFQRIIDAFRDENQSLEEKITEKNRELEEQYEYIFQTEKAA
FT                   SLGNLVAGVAHEINTPLGIGVSTASHISQLNNDVLQKLNDGTMTKEDLKNFMINLAESS
FT                   SLLENNLNRASELIKSFKQVAVDQISEAKTSFLLKDNINSVIISLRSTYKNAGHTIKLD
FT                   CPED"
FT   gene            complement(156118..157701)
FT                   /gene="ybiT"
FT                   /locus_tag="CLOST_0133"
FT   CDS             complement(156118..157701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiT"
FT                   /locus_tag="CLOST_0133"
FT                   /product="putative transporter fused subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20263"
FT                   /db_xref="GOA:E3PR41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20263.1"
FT                   /translation="MISVTNLALRYGDKKLFEDVNLKFTPGNCYGVIGANGAGKTTFLK
FT                   ILSGEIDANAGEVHVAPNVRMSVLKQDHYRYDEHSVLDTVIMGNARLYEIMKEKDALYA
FT                   KEDFTDEDGIKASELEGEFAEMDGWEAESDASSLLQGLGIGTDLHYSLLKDLEGSEKVK
FT                   VLLAQALFGKPGILILDEPTNHLDIKAIKWLEEFLISFDGTVIVVSHDRHFLNNVCTHM
FT                   ADVDFGKIKLYVGNYDFWYESSQLALSLMKDQNKKKEEKIKQLQDFIARFSANASKSKQ
FT                   ATSRKKMLDKINIEDIQPSTRRYPYVGFTMEREVGNDILMVENLSKSIDGVKILDNVSF
FT                   TVRKGDKIAFLGESEIMVTTLFQILAGELEPDSGTVKWGVTITKSYFPKDNAKYFDGIK
FT                   INLVDWLRQYSVEKAETYIRGFLGRMLFSGEEALKEVNVLSGGEKVRCMLSRMMLSSAN
FT                   VLILDQPTNHLDLESITAVNNGLKDFKSNVLFASHDHEFIQTIANRIIYLTETGAKDYM
FT                   MTYDEYLDQI"
FT   gene            158022..159257
FT                   /locus_tag="CLOST_0134"
FT   CDS             158022..159257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0134"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20264"
FT                   /db_xref="GOA:E3PR42"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20264.1"
FT                   /translation="MKKDFIELGITNELSERLLKLRIDTPTQVQVKSIPYILEGRDVIA
FT                   QAQTGTGKTLAFLLPILEKIDVDSEDTQALIISPTRELAIQISEEAQKLISVKGINILS
FT                   AYGGQDVEKQLNKLKKNIPLVVGTPGRILDLIRRESLNLSKLKMLVLDEADQMLHMGFL
FT                   DEVDAIFSYTPSEKQVMCFSATFNKEVKKLAKTYMNEPHYVSVKGQNVTLDEIDQIIVH
FT                   TTDRKKQEALCEMIDTQQPFMAIVFCRTKRRVTALYEDLSQKGYNCDQLHGDLSQAKRE
FT                   KVMKDFRNAKIQLLIATDVAARGIDVDGITHIYNYDMVLDTDTYIHRIGRTGRAGEKGT
FT                   AVTFVTPKHNASLEKLEGDIKADVKKIEMHKAVKHEDSKAKPQAKKKPSFDDFLKKNSK
FT                   KNSRNKGRAPKR"
FT   gene            complement(159260..159781)
FT                   /locus_tag="CLOST_0135"
FT   CDS             complement(159260..159781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0135"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20265"
FT                   /db_xref="GOA:E3PR43"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20265.1"
FT                   /translation="MQNLLLENDIVRVRASSESDIDYIMKTESDPSNSPYVFQWTYDQH
FT                   KAAMENPDILHLLIEDKDTSEPTGYMIVAGVLSPHKSIELMRIAVSQKNKGFGRDSIKL
FT                   LLAYAFDTLGANRVWLDVKEYNYSAQSLYKYLGFAQEGLLREAVFHNGKYDSIYIMAIL
FT                   KKDYLKQKKN"
FT   gene            complement(159876..161090)
FT                   /gene="astC"
FT                   /locus_tag="CLOST_0136"
FT   CDS             complement(159876..161090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="CLOST_0136"
FT                   /product="succinylornithine transaminase, PLP-dependent"
FT                   /function="1.3 : Glutamate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.81"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 98361920, 98361921; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20266"
FT                   /db_xref="GOA:E3PR44"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PR44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20266.1"
FT                   /translation="MKGAVNIQNIIDEGQKYLMSNYGRFPISFSHGEGCRVYDYNQREY
FT                   IDFLGGVAVNILGYNNKKLNDAIATQSQKLIHISNYFWIDTQVKLAKLLVENSFDGKAF
FT                   FCNSGAEANEGAVKLARKYAYRKYGIQKNEVIAMTGSFHGRTLATLNLTDNPKYKEGFG
FT                   PHPEGFKFAKFNDIDSFKQVLTKNTCAVIFEPIQGEGGITPIDSDFIKKVSELCKQNDV
FT                   LLIADEIQTGMGRTGKLFGYQHHDITPDIMTVAKGLAGGCAIGAVIAKVEVADAFQSGD
FT                   HGSTFGGNPLACAAGVATLETILDDELAENAEKIGEYFKLKLQYLSQKYSVVKAVRGHG
FT                   LMLGLELSIPGAAVVQKALYKGFLINCTATNVLRFIPPLIIGTSEIDLLIEILSEIFEE
FT                   LELAA"
FT   gene            complement(161095..161955)
FT                   /gene="argB"
FT                   /locus_tag="CLOST_0137"
FT   CDS             complement(161095..161955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="CLOST_0137"
FT                   /product="acetylglutamate kinase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number="2.7.2.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10393305, 12005432, 2851495, 353508, 74257921, 89121510;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20267"
FT                   /db_xref="GOA:E3PU06"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20267.1"
FT                   /translation="MVNQLTPQQKAHVLLESLSYIKIFHKQIVVIKYGGNAMINNQLKE
FT                   CVIRDIALLKYIGINPVIVHGGGPEINELMTLYKKKPEFINGLRVTDEETMKITEMVLT
FT                   GKIAPEIVSLFSNHDIKALGLSGKDGNIIKAKQKSEELGLVGEITSINPELILSVIEKG
FT                   YVPVISPIGIGENGESYNINADEVAGKIAISLNAKKLILITDVAGVLENHQDPNTVISA
FT                   LNINEAYSYIKKGIIKGGMIPKMFCCLNAVTNGVEKCHIIDGRQFHSILLEVFTDTGIG
FT                   TMITA"
FT   gene            complement(161968..163221)
FT                   /gene="argJ"
FT                   /locus_tag="CLOST_0138"
FT   CDS             complement(161968..163221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="CLOST_0138"
FT                   /product="ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20268"
FT                   /db_xref="GOA:E3PU07"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20268.1"
FT                   /translation="MAIEKEEIPMNKYIVIDGGVSSPKGFLSSGIHSGVKKSGKNDLSL
FT                   VYSEVPAYSWAMFTTNKACAAPVTLSKSHIQDQNIQAIVINSGNANACTGQKGLSDAYE
FT                   MATVTASALNIAPQNVIVSSTGLIGLPLEMDKIKAGIAKAASALSVNGSEEAAKGIITT
FT                   DAHLKTIAVQVTIDNKVVTIGGMAKGSRMIHPQMATMLSIVTTDANIDKTYLKYLLNDT
FT                   TEKTYNMISIDGDTSTNDMVAVMANGKACNNELNANHPEVQSFANAFAFVNEYLAKSIV
FT                   ADGEGATKFIEVQVVNSNTLASAKLAAKSILTSNLVKTSLFGEESNWGRILCSIGYSGA
FT                   QFDMDKLEISLVGDNKETIKIVENGQSTIFCKESAKKLLKERNITILVDFKTGSQNSIA
FT                   WGCDLSHDYVKINSSHIS"
FT   gene            complement(163212..164258)
FT                   /gene="argC"
FT                   /locus_tag="CLOST_0139"
FT   CDS             complement(163212..164258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="CLOST_0139"
FT                   /product="N-acetyl-gamma-glutamylphosphate reductase,
FT                   NAD(P)-binding"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number="1.2.1.38"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1551850, 2851495, 353508, 6761650, 74257921, 89121510;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20269"
FT                   /db_xref="GOA:E3PU08"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20269.1"
FT                   /translation="MIKIGILGSTGYAGSELVRLLSSHPYAEIVFLDSRSYENKSYTDI
FT                   YPHLESKLDKKCSSIDLMDDSHFKNLDLLFCALPHGLSQIAVKQGLKNKVKVIDLSADF
FT                   RISDVASYEHWYQVEHLAKEEVKLAVYGLCEINREKIKTATLVANPGCYPTSILLALYP
FT                   LLKEGVIKAQGIIADSKSGISGAGRNLSDANLFSQCNENIRAYSLCKHRHIPEIEEQLS
FT                   LYSDTTLTLQFTPHLIPMNRGILSTIYADMNKNLSCSEVYDLYITYYSDEYFVRLLSGG
FT                   KLPQTKAVSGSNYCDIGFDIDKRTGKIIIVSAIDNLIKGASGQAVQNMNLMFGLDEHIG
FT                   INQLPMWP"
FT   gene            complement(164367..165683)
FT                   /gene="argH"
FT                   /locus_tag="CLOST_0140"
FT   CDS             complement(164367..165683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="CLOST_0140"
FT                   /product="argininosuccinate lyase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number="4.3.2.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2851495, 353508, 6292860; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20270"
FT                   /db_xref="GOA:E3PU09"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20270.1"
FT                   /translation="MKLWGGRFKTEEDSFMDKFNSSFNIDQRLWEQDIKGSIAHVSMLS
FT                   KCHILSSDEAEKIIKALEQIHAEILDGSLFLEGEFEDIHSFLEYQVTQKAGAVGKKMHT
FT                   ARSRNDQVALDMKLYVKLSGQEVIKSLEKLISAIEQKSNESSFPMPGYTHLQRAQIVTF
FT                   KYHLMAYYEMLSRDMKRIENALSIMDTCPLGSCALAGTTYPIDREFTAAMLEFEAVQKN
FT                   TMDSVSDRDYIIEMISAFSIIMMHLSRLSEEFIIFSTKEFDFIALSDAYSTGSSIMPQK
FT                   KNPDSLELVRGKTGRLYGNLMGILTTMKALPLTYNKDMQEDKQYYFESLDTVIDCITII
FT                   EGVVSTLTVKSENMEKATKGGFLNATELADYLVKQGIAFRDAHSIVGQVVKHCEAKAME
FT                   IDQLSLEELKAFSPHIKEDVYSYIEPSSILKQGTKPDML"
FT   gene            complement(165704..166969)
FT                   /gene="argG"
FT                   /locus_tag="CLOST_0141"
FT   CDS             complement(165704..166969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="CLOST_0141"
FT                   /product="argininosuccinate synthase"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="6.3.4.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11423008, 17611193, 2989674; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20271"
FT                   /db_xref="GOA:E3PU10"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20271.1"
FT                   /translation="MKTNNITKKDKIVLAYSGGLDTSIIIPWLKENYNADIIAACINVG
FT                   QDEDMQKVQEKAIKSGASKVYIADVVDEFVKDYVYKSIKANALYEGKYLLGTALARPLI
FT                   AKKLVEIAHIEGAPYICHGCTGKGNDQVRFEVGIAAFDPDIKVIAPWRIWDIKSREDAI
FT                   DYANAKGIEVPCTKDKIYSRDQNLLHISHEGGDLEDTKNEHKADILYMMTKTLEKASDE
FT                   AEYVELTFDKGEAVMLNGVSLEPHEMLAQLNQIGSNHGIGVLDMIENRLVGMKSRGVYE
FT                   TPGGSILVQAHSLLESLTLDRNTTHTKSILALEYAKLIYDGLWFSPLRESLDAFFEKTQ
FT                   EMVSGTVKIKLYKGNIMPASIDSPFALYDEAISSFGESPLYDHKDAEGFINLYSLPTKI
FT                   QSMMKKKVQQQEALKNNIKAVG"
FT   gene            complement(167022..167245)
FT                   /locus_tag="CLOST_misc_RNA_21"
FT   misc_RNA        complement(167022..167245)
FT                   /locus_tag="CLOST_misc_RNA_21"
FT                   /product="T-box"
FT                   /inference="profile:Rfam:8.1"
FT   gene            167580..167837
FT                   /locus_tag="CLOST_0142"
FT   CDS             167580..167837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0142"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20272"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20272.1"
FT                   /translation="MSKLSDMENIGPTLEQRLINAGITTPIELRKLGSKSAYVILKEHD
FT                   IDACINTLYALEGAIQGIRWHDLADDIKADLKRFADSEKK"
FT   gene            167850..168137
FT                   /locus_tag="CLOST_0143"
FT   CDS             167850..168137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0143"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20273"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20273.1"
FT                   /translation="MKKQEELLQKNIRQFYVYMLRCKDNSLYTGYTVDIDMRFKLHCEG
FT                   TASKYTRARLPVSLVYVERHDTKSSAMKRECSIKKLSKLQKEALIKNSIV"
FT   gene            168138..168241
FT                   /locus_tag="CLOST_misc_RNA_30"
FT   misc_RNA        168138..168241
FT                   /locus_tag="CLOST_misc_RNA_30"
FT                   /product="SAM"
FT                   /inference="profile:Rfam:8.1"
FT   gene            168301..170613
FT                   /locus_tag="CLOST_0144"
FT   CDS             168301..170613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0144"
FT                   /product="putative 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20274"
FT                   /db_xref="GOA:E3PU13"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20274.1"
FT                   /translation="MIKIFDGGFGSQLISKSICFECPEELNLTQGEVIKQIHKEYADNG
FT                   ADIITTNTFGANPLKLKSYDLEDKVMEINVAGINLAKTTGKEIAFSVGPTGEFVKPVGD
FT                   VSFEEMYEIFYRQLEAITISQPDYVIFETFSDIGELRAGIIALKDIFKKHNIKIPILAS
FT                   MTYDSIYTLTGVSPAAQGVILDALGVDAIGINCSKGPKDILELLVEIEKYTSVKLIAQP
FT                   NAGMPEIVGEDVVYSMSASEFANQMKPYFELNMGYIGSCCGSTPEFTKELRRLVDSIEV
FT                   KNIKENKASSHGYLASKGKVVSSEAFILIGEAINPHARKAVKLYMEEFDIKGLTSVISE
FT                   QCLKGADVIDINVNAEGADKKALARELVISGQLNSDFVLCIDSKEPEIIEEALKNYAGK
FT                   ALINSVALDEKELSEILPLAKKYGASVIGLCIENEILPTTIAETVEIAEKLQSRLLSEG
FT                   IRAEDIYIDPLLFTNKTYSISPLDTVEIVRQLSNKGIKTSLGLSNVSYGMKNRDRLNQT
FT                   LLSMLIGSGLSMAIASASSKGIVETIESAQILMGKEKISNKTYIELEDIDKLTIEGELI
FT                   YQLINKEEPSAFDSLLAEKTEQEVINTMLIALDQAGKLYDEKTIFLPDMMQVVEKVQGL
FT                   FDRLENKAKSSHTLVFGTVYGDIHDIGKNIVKSVLKPFGYNIIDLGKSVTKEAFVAKAK
FT                   EVNADIIGISALMTTTMVNLEPTIEYIKSELPNVKIIVGGAVVTEDYARKVGADGYSKD
FT                   AIKAIGLVKSLTEVDEK"
FT   gene            170613..171248
FT                   /locus_tag="CLOST_0145"
FT   CDS             170613..171248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0145"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20275"
FT                   /db_xref="GOA:E3PU14"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20275.1"
FT                   /translation="MRINLNLDAKELLKYIDRPYDEAEVSELISEIKPSLGYKVLPANI
FT                   TDFMVKLCGYDIKSYYLAKGLENSTKAIFIWATLGKELDDKIHDLLSEDKIYKATLLDE
FT                   LASFAVDFLMEKLYLRLKQDYIKKRKFLTLRYSPGYGDIAIDESEKLIKLDDTCTISYN
FT                   GSMLIPQKSITAIVGTSSTLELRNYPKGIGLCRGENCYACKTWACMKT"
FT   gene            complement(171254..172900)
FT                   /locus_tag="CLOST_0146"
FT   CDS             complement(171254..172900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0146"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20276"
FT                   /db_xref="GOA:E3PU15"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20276.1"
FT                   /translation="MLNLMNLKIRTKILVIPLAILIISNILLAGVSTYVAQMYLNQQMV
FT                   QDGELFANNALENYRRMKFVNDKEINKYLREISESEYLIYASFSRSDGTITYHSNEEMR
FT                   DQKYTDKTILGLMETKKGGSANYYYPAIKKEVLNISIPLNAQAGSFFHIGLSLDNVHNS
FT                   VRTLMMAFLVVTAAILAVSFIILLTISKKIINPIQSLSLSCNELANGDLTNETPAFGTD
FT                   ELGEMSLGFNTMKENLKSMVRSIVDISNTVKDSSSQINVSSEQLTQTSEHIASAIGVLT
FT                   EGSEKQVDFMEEIMENANDIGQQVDQVDGEMQKLSSSSKIMNKDLDEVLTSMQSMEMQM
FT                   DIISDSTEKSLHTIKDMDLISNQIGNIVEVINDIANQTNLLALNAAIESARAGEAGRGF
FT                   AVVADEIRKLAQKSIESANDISELIKTTQQTIGKSRDSIAQGQQESSKGKEVVHQVASS
FT                   VKNVQSTFKMNIDNMSNLGNSLQLLTNSKENIIKNLTEINAIISDYAASAEQVSASTEE
FT                   QTASMQEMSSLAEELFTKAEELDGQITKFKI"
FT   gene            173211..174233
FT                   /locus_tag="CLOST_0147"
FT   CDS             173211..174233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0147"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20277"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20277.1"
FT                   /translation="MKVSIKELEKGMIIDSDIFSKKGALLLYKGFKIENPDLVAIVLHR
FT                   NGIDQILVKNEVPSEVVKVVESEDVKQRIAHEVRLFKEEFVQIMNEVKEDVRRFEETND
FT                   ISEIKDLDKGLELAHEYENSIFTLFQMIEKIKLENQDDYAQIVETSLLAYSIGKWLYLS
FT                   EKELKEISEAALLSQIMEYAHFDFNQDPASVKGANSVSTDILKAAFQIQERMDGSGYPK
FT                   GLTRTQIHPYAKVIAVADVFQNLTTGGELAEKLSVFEAVRIMEREYITKLDVKSLYVFL
FT                   HRVGSKFIGSSVRLSDGTVGEIVFVPENEVSMPYIKLEDGHVVNLQSPEYKDKHIVEIF
FT                   "
FT   gene            174267..174881
FT                   /locus_tag="CLOST_0148"
FT   CDS             174267..174881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0148"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20278"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20278.1"
FT                   /translation="MYVMEMNLEDIIAEKDEKDQRLLMAEFRNLGGYETLGEFFEDLEE
FT                   MSEKNDPKAIRLYRFAEWLSHESLFYSLVNLLEDLKSSVHTEYAIKAITKIPNEPKALC
FT                   EAVSKVLDSVQRFQEPGVLYQAVALLHRMEMVDSSVRACLRTRRRITLDENVLREVSNR
FT                   MENLAKYEEDFHKNSDVRADFASKDKFIEFANEFINFKNTL"
FT   gene            174971..175483
FT                   /locus_tag="CLOST_0149"
FT   CDS             174971..175483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0149"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20279"
FT                   /db_xref="GOA:E3PU18"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20279.1"
FT                   /translation="MIDIFVLQFMNSISNPLFDNVMTFITKLGDKGLIWILLALIMLYY
FT                   KQTRTYGIAMIMALLLTLVLGEGIIKNIIQRDRPFIKHSFDVIINHPISYSFPSGHTAS
FT                   SFTVLGIFLFGIKKYRFSCFILAFLIAFSRLYLGVHYFTDVLGGAVLGLMDAYLVYRLY
FT                   LRKKLQT"
FT   gene            175518..176210
FT                   /locus_tag="CLOST_0150"
FT   CDS             175518..176210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0150"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20280"
FT                   /db_xref="GOA:E3PU19"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20280.1"
FT                   /translation="MENNCVPKDKKFVPVIESKLRKKIVEVPKEIYQASGINIFAKRIK
FT                   SLMFSTDVALIKNSNADGVIAVYPFTPQLSITQAIIEVSPSPVFCGVGGGLTTGQRSID
FT                   IALHAELNGAFGVVLNAPTPNALIMEMKKRIDIPIVITVVSEKEDIAARIKAGVSIFNV
FT                   SGGAKTASIVSKIRDEFPEMPIIATGGPTPESILETINAGANAITYTPPSSGELFSQIM
FT                   ENYRGGLK"
FT   gene            176213..177277
FT                   /locus_tag="CLOST_0151"
FT   CDS             176213..177277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0151"
FT                   /product="Metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20281"
FT                   /db_xref="GOA:E3PU20"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20281.1"
FT                   /translation="MRIQVEDIQKDMIIDEDVYSNQGNLIVGRGFSVSNAMILKNLLRQ
FT                   HRVDKVKVLTLSEEVAPPSPKEKIDQEIVDFKLEFHDTVSTIENEISSILGGEIEEEKL
FT                   NSLVESSLSMQSGTTLNIFQMMQKVKDSDDVTYSHCYSVSLSAYAIGKWLKLSEEELKE
FT                   LTLSAILADAGKASVPKEILMKKGFLTEQELNEMKKHVQYSYDMLDGYPISEQVKNAIR
FT                   YHHEREDGSGYPEGLKGDKIPYYAKIIAIADVYTALTSKRPQREKLTPFEALKIMERDF
FT                   MDKLDVTILTEFLKRIAENYIGNPVKLNDDTIGEIVFLSVHKLSRPVIKTTQGDKLIDL
FT                   GNKENAKLEIVEFL"
FT   gene            complement(177354..177932)
FT                   /gene="rpsD"
FT                   /locus_tag="CLOST_0152"
FT   CDS             complement(177354..177932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="CLOST_0152"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20282"
FT                   /db_xref="GOA:E3PU21"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20282.1"
FT                   /translation="MARPMGPRFKVARSLGVNVFDHPKALNRGVKPQKKISEYGKQLRE
FT                   KQKLKAYYGVLEKQFKIYVEAAMHSKGNSGEKLVQRLEQRLDNMTYRLGFASTLRQARQ
FT                   MVVHGHILVNGKKVDRPSYKVEVEDTISLKEKSKSIAIFKDSFTSTTTNLPYLEKNLND
FT                   FSGKLIAEPKRDQVPIEVTDSYIIEFYSK"
FT   gene            178309..179427
FT                   /gene="trmU"
FT                   /locus_tag="CLOST_0153"
FT   CDS             178309..179427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="CLOST_0153"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="2.1.1.61"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12549933, 1729205, 99030459; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20283"
FT                   /db_xref="GOA:E3PU22"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20283.1"
FT                   /translation="MKKRVVLGMSGGVDSSVSAVILKEAGYDVVGIFMKNWDEKDEDGV
FT                   CTATEDYEDVRRVADQLGIPYYTVNFEKEYWDRVFSYFLDEYNKGRTPNPDVMCNQEIK
FT                   FNAFLDYALKLDADYIAMGHYARVEERDGKFYLLRGVDNNKDQTYFLSRIGQKALSKSL
FT                   FPIGELEKSKVREIAEKNELYTAKKKDSTGVCFIGERDFDAFLDKYLLSKKGDMINVDT
FT                   GKKISQHHGLYHYTLGQRKGIGIGGVGSGEPWFVVGKDLKKNLLYVAQGEQHEALYSTS
FT                   LIGEAPAWTLDEEPVFPLHCTAKFRYRQQDIPVTVHKMEDGNIHIVYDNPVKAVTPGQV
FT                   AVLYDADICLGSSIIKSIEPVNSKYKYLNPTF"
FT   gene            179493..180398
FT                   /locus_tag="CLOST_0154"
FT   CDS             179493..180398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0154"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20284"
FT                   /db_xref="GOA:E3PU23"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20284.1"
FT                   /translation="MDKETKSYLKIALAGSLWGMIGIFVQTLRGFGLSAEFVAFSRVFL
FT                   GFALLAGWFLIKDPSILKIDLKGLISACVIGVISQGLFNLTYFASIQRVGTFTAVVLLY
FT                   FSPVFMFLLGTFMYKEKADKRKIISVLICFAGCIFGVSGGDFSALKADLPGISLGLIAS
FT                   LSYSLMPALSKKTASSYNPFTIIIYSFMFGSLMLLPFAKPMNELYMLQDLRLVVLLIAF
FT                   SIFVAAMPYCLYIPSLHNVQVSKLGVIASVELIVSIAIAAVFLKEPVRLGNLIGVAIIL
FT                   VSIVAMNKPPVKMIKREISQ"
FT   gene            180567..180875
FT                   /locus_tag="CLOST_0155"
FT   CDS             180567..180875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0155"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20285"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20285.1"
FT                   /translation="MKIAILVNEDTMKRCTGKGCFNAFFNRLDSFSDYGPEAQILGFTH
FT                   VGGDLEHKIEKLKKNKVEAVHLSSCLRRRYSGYQELLERLSKDFEVKGYTHGRAILD"
FT   gene            complement(181045..181500)
FT                   /locus_tag="CLOST_0156"
FT   CDS             complement(181045..181500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0156"
FT                   /product="general stress protein 20U"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20286"
FT                   /db_xref="GOA:E3PU25"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20286.1"
FT                   /translation="MANKKNANTVTQFLNVHLSDLHVMYTKLHNYHWNVEGRGFFQLHA
FT                   KLEELYDGVAGELDEVAERILQLGERPFATMKDYLANAKIKEVESKGISPDEVLSALQK
FT                   DYEYTIESLKNGIDIAGEADDPVTEDMLTGMLAGYEKNLWMIKAYLA"
FT   gene            181778..182149
FT                   /gene="gloA"
FT                   /locus_tag="CLOST_0157"
FT   CDS             181778..182149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="CLOST_0157"
FT                   /product="Lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20287"
FT                   /db_xref="GOA:E3PU26"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20287.1"
FT                   /translation="MEFKFAHNNINVLDLEKSMAFYEKALGLKEVRRKEASDGSFILVY
FT                   LGDGSSAHQLELTWLRDWDRPYNLGDNEFHIAFTVDDYEKAHEHHKQMDCIVFENPSMG
FT                   IYFIADPDNYWLEILPQNR"
FT   gene            182290..182793
FT                   /locus_tag="CLOST_0158"
FT   CDS             182290..182793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0158"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20288"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20288.1"
FT                   /translation="MLCQNCKQNEASISYMQVINGAVTKVSLCEDCAHEKKIKPIDINI
FT                   PFSVKDLFASLMDMDKSSTYEAEKEKACPKCRSTYSRFQSLGKVGCEACYETFKDELSP
FT                   LIRRVQIKGEHIGKIPEHAAFDIKRKREITKLKTELSHAIQAEEFEKAAELRDKIKLLE
FT                   KEVG"
FT   gene            182793..183827
FT                   /gene="mcsB"
FT                   /locus_tag="CLOST_0159"
FT   CDS             182793..183827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="CLOST_0159"
FT                   /product="McsB"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20289"
FT                   /db_xref="GOA:E3PU28"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20289.1"
FT                   /translation="MNENAEASKLEDMRKSIVVSSRVRLARNLEDYNFPNKLEANEAKD
FT                   IISKVKESLDGYDINFNAVIMAEADMLYKEYLLENHLISKEMSEEAKGAVFINEQNTLS
FT                   IMVNEEDHLRIQALLPGLHMDNAYEMCDKLDDLLEKNLRYAFRENLGYLTSCPTNLGTG
FT                   MRASVMVHLPALVEMGFITPILENATQIGLAVRGLYGEGTQFIGSLFQVSNQLTLGFKE
FT                   EEIVNSIMGITRQIIEKEIEAERILVSKLGIVLQDRISRCLGILATSRVMKINESMNYL
FT                   SKIKLGIRLGWITGISDEEINRIMIKVQPGNQIIDYKAKSQEQIDTGRANLLRTIFKDV
FT                   DFVG"
FT   gene            183842..186307
FT                   /gene="clpB"
FT                   /locus_tag="CLOST_0160"
FT   CDS             183842..186307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="CLOST_0160"
FT                   /product="protein disaggregation chaperone"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14550559, 14640692, 91294166, 93015925, 93388583,
FT                   99428468; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20290"
FT                   /db_xref="GOA:E3PU29"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20290.1"
FT                   /translation="MMENFTERAKQAIELAKREASKLGHNIAGSEHILLGLMAEGQGIA
FT                   YQVLYKFGLTLESLVREIIDLEGIGLPNTHFQGFSPRTKGIFELSIMEAKMLGHSYIGT
FT                   EHLLLALLKEKECIGCRLLMEKGIDYNLVFKEIMNLLGGSSAGKEPNQAGNTSSMNSQN
FT                   PNTPTLNQYGVDLTKEADENRLDPVIGRSKEIERIIQILSRRTKNNPVLIGDPGVGKTA
FT                   IIEGLAQKINSGDIPSTLKNKRIMTLEMGNLLAGAKYRGEFEERVKKIVEELKANKDVI
FT                   IFIDEIHNLAGAGGAEGAIDASNIMKPALARGEIQVMGATTIDEYRKHIEKDSALERRF
FT                   QTVMVDEPNTEDSIKILHGLRDRYEAHHKVKITDEAIKAAVDLSHRYITDRFLPDKAID
FT                   LIDEAASRVRLRKYMEPDNIKELEDKLSKLSMEKEEAIATQDFEKAAKIRDEEKQIKEQ
FT                   LGENKEQWTKKNYTSTEVVLEKDIAEIVSSWTGVPVTRLQMEESTKLLDLENILHKRVI
FT                   GQEEAVEAISRAIRRARTGMKDPKRPIGSFIFLGPTGVGKTELSKALAEAMFEDEDSIV
FT                   RIDMSEYMEKHSVSKLIGSPPGYVGYDEGGQLTEKIRRKPYSVVLFDEIEKAHPDVFNM
FT                   LLQILDDGRLTDSKGRTVDFKNTVLIMTSNVGATTIQKQKTLGFSTVTDEEKKEKAAYE
FT                   KMKDNVMVELKRSFKPEFLNRVDDIIVFHALTDRELEKIVYLMISNLEKRLMDKNITIE
FT                   LDEAAMKLITKNGYDLEFGARPLKRAIQRLLEDEISEKLLRGEINDSDNIKVTAVDDKL
FT                   DFVVKTKTV"
FT   gene            186330..187691
FT                   /gene="radA"
FT                   /locus_tag="CLOST_0161"
FT   CDS             186330..187691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="CLOST_0161"
FT                   /product="repair protein radA homolog"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20291"
FT                   /db_xref="GOA:E3PU30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20291.1"
FT                   /translation="MAKVKTKYICQQCGYESAKWWGICPECNSGGSMVEEAYTQKETAR
FT                   AKKQSSHLQKSVDLKSVEGTEADRFTTHISEFDRVLGGGIVRGSLVLIGGDPGIGKSTL
FT                   LLQLAHHISKEKKVLYISGEESAQQIKLRASRLFSGDMNMLILAETNLDTIEGEILAVM
FT                   PDVVVIDSVQTVSSPELTSLPGSVSQVREATGRLMNIAKANNISCFLVGHVTKEGAIAG
FT                   PRVLEHLVDTVLYFEGERFNTYRMIRAVKNRFGSTNELGVFEMTDKGLIEVSNPSKILL
FT                   SEHSVGAPGTAIVCTMEGTRPMLVEIQALVAPTTFAVPRRTATGIDFNRLNMLLAVLER
FT                   RAGLRIQSQDVYVNLTGGIKIYEPSLDLGIACAVASSFSNREIKNNVAFFGEIGLTGEI
FT                   RSVSFGEKRINEALKLGFEEVIVPYSTAKDLKNINSIKITGVKDVKMALAEAFK"
FT   gene            complement(187893..188279)
FT                   /locus_tag="CLOST_0162"
FT   CDS             complement(187893..188279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0162"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20292"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20292.1"
FT                   /translation="MELNEFTQKVEEVLIRHKSILDIMTKLQETDARTTRAVAKAVTEC
FT                   GCISIKASKQQLSTEVDYSELDKFTSNHIDGELCPRCKEQLVHEIGDHIFYISALCNTL
FT                   NLSPGDILSKKHDEITTLGKFSLF"
FT   gene            188411..189490
FT                   /locus_tag="CLOST_0163"
FT   CDS             188411..189490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0163"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20293"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20293.1"
FT                   /translation="MVKKILRIIVSLVGVTIGAAFYIYLERIVPQYAPESLVLKIGLAS
FT                   IISLSFGLIFYFFSPYIMNLGQKAANKIENEVSSMPTGEILTSSIGLIIGLIIAYFISG
FT                   LVINIPLVGTPIATLIYIFFGYIGYNIASRRKEDLANLINAVKPIGGKEKGSSKKSSHA
FT                   IPPKILDTSVVIDGRIADIAQTGFVEGKLVVPTFVLEELRHIADSADDLKRARGRRGLD
FT                   ILNMMQTELKLDVEICEMDFDDIAEVDMKLLKLGQVLDGKVLTNDYNLNKVAQFQGVKV
FT                   LNINELANSIKPLVIPGEEMLVTIVKEGKEQNQGIAYLDDGTMIVVEGARKLIGQTFQV
FT                   LVTSVLQTAAGRMIFAKPK"
FT   gene            complement(189498..190331)
FT                   /locus_tag="CLOST_0164"
FT   CDS             complement(189498..190331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0164"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20294"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20294.1"
FT                   /translation="MVVRSSLIRGFDIKEKSSKWLIGILIASLISFYIWSIYSGNGVLE
FT                   AVKHSLVKTMGFYLSWCFARELDPDAKVEAFYGLAPLFIIFIFVDEVLILPGIFFLLLT
FT                   RILTRSSGSMVTNFDLIFVLFFSVYLYFFYSFIFPLSASIFIFADYKLKGGQKRNIPYA
FT                   SFMLIISLLSFLNLYTIEKTETSIIDILMVSLITPMFAFRLSTLKNILSTSDRDKYFLS
FT                   PKRIKLAGILLLMSSTALAINYGYIFQMGFLWMAMLGISIPHIKNLKTLQKPLEG"
FT   gene            190470..190868
FT                   /locus_tag="CLOST_0165"
FT   CDS             190470..190868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0165"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20295"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20295.1"
FT                   /translation="MYQILGDEVYDSQDIAKKIEQYTSFTVREDMSKRTKRDDALAFKL
FT                   SIPVKKLDPTAKDYIEDDTEINHLMILADEMSNSQMENLGLKFAIQKSYAYTYDEVKNE
FT                   ILLVSGIMHISNGRRKLPDVMKRLLSQV"
FT   gene            190975..192183
FT                   /locus_tag="CLOST_0166"
FT   CDS             190975..192183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0166"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20296"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20296.1"
FT                   /translation="MKVALGLITKYINANISILDFLKNANKFGHEIDALIICYSHGYDR
FT                   PFVEKLEREFPKTYLIKVNHSYDMERDLRKRGIRAKDFMPLIYAETLENYGLLPYSTYR
FT                   NTVLIKAMLLEMDALFFVDTDVYPLLLKPSHRKSNLPDYISLKDTKELEDYELEEIDFF
FT                   ERHFKYLSQKDVMVTTSDYSGYYIIPPMEYSHLDEYLGGLQKESAIDFVKSCSGTGCIN
FT                   FASEEEKPYSTDKFLGGNMAIKLKAFKELPPFFSTTYMAGDELVLTRGEDTLMGTFAKN
FT                   NQLKAVDIDTLIFHNTYSDFPKVPDIVNSVAIKDRFYYASLGWIGRNPFMNYINGNDYK
FT                   ALYEKQKELLVKSSVHTARYLKDRRFLIMPTAIDSAMKSFNRVIDEYELSMEGFDHIKM
FT                   KLI"
FT   gene            192201..193394
FT                   /locus_tag="CLOST_0167"
FT   CDS             192201..193394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0167"
FT                   /product="putative Starch synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20297"
FT                   /db_xref="GOA:E3PU36"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20297.1"
FT                   /translation="MKVLLVNHFPLEGSGSGIYTKNIASKLTELGHEVMVILPEHTNIS
FT                   KPYITKSILFRSEANKGEKVDAEFNFPCFTTHPKSNNTFYQLTDEQMHQYIDLMQIAVD
FT                   EAVATFKPDIIHCQHLWIAPYCASKTGVPYVATAHGTDLKGLVLDSRYVPYALEGAQKS
FT                   KKIITISKQVDYEVGEKYSVPDSLRRLILNGFDESIFNLKPVSRKEVLASFGLPDAGHV
FT                   VSFVGKLAHFKGVDLLLKAAKIYEEEVEDVMTLIVGHGELYDELNNLRRSLGLKHVYML
FT                   GHQHQEKVADIYNIADVSTVPSRQEPFGLVAIEALACGTPVVVTNGGGLVDFVDDTIGS
FT                   VIDEEDYEALAKSIISEIKNPDKKAKRKRAHEFAMKQFSWNRVINEVIDVYEKAINE"
FT   gene            193432..195168
FT                   /locus_tag="CLOST_0168"
FT   CDS             193432..195168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0168"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20298"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20298.1"
FT                   /translation="MRRVMVIPVYYSRSKSEGHQDGDSVYDHPTPIDEDGTLKRTLESI
FT                   RIIKNQDFQLVILVSPTSEELTDRAKEKVNKILSEVNLDIQTFIFTPAELEKIKALAAE
FT                   QDVDQSVIKLMNIRGYANVRNMCIYTAYILGAEMAMLIDDDELFEKEDFVDLASQYIGG
FT                   RLYGKTIDGVAGYYLNKYGNYYDDVDIEPWMTYWDRFGFKGKAFDKIIGQEPRIKLTPF
FT                   AFGGAMIIHRNLFKTVPFDPNVTRGEDIDYLINAKMFGFHFFLDRELSIKHLPPKKTHP
FT                   VWKRFREDIYRFLYEKAKIDSQRDLPNMNKVTSHDFDPYPGNFLTNELEDMIFKANIML
FT                   AMDYLSNGDIESAKETMNNIYLSKYDAMPKFNVFDAFIELQKDWKSLLSFTKQYMIDIR
FT                   AIMDMAEFGYVKKYDKKSELVSMSRDEMETLLKSMDFFKNLEDDEINTLAAIAKMKEYP
FT                   ENTFIGKSNEKVVRMRIIYKGVVRIQKETLSGDSVDLAILEKGDYFGESFDKNFTSYVD
FT                   IIAEEDCELIEIEHADLVSLIESQPMLGIRILQMLNAKLSLKLKTLNERYTLLSDRGSS
FT                   IY"
FT   gene            complement(195301..196797)
FT                   /gene="pepA"
FT                   /locus_tag="CLOST_0169"
FT   CDS             complement(195301..196797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="CLOST_0169"
FT                   /product="putative cytosol aminopeptidase (Leucine
FT                   aminopeptidase) (LAP) (Leucyl aminopeptidase)"
FT                   /EC_number="3.4.11.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20299"
FT                   /db_xref="GOA:E3PU38"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20299.1"
FT                   /translation="MDIRISKHGESTVLCDTAIIPFTEGIEISEGLLYLDSDVEAMISY
FT                   LVKDKIFTGKKEQIESFRLAREENPRNIILVGLGDDQCIDQETVKLAISSAIRKAKQLK
FT                   SKVVEIHQIFNSCSTSSKEMVSLVAKYTILSDYDFGDYKTPKEDSVDILEVNILVGPDE
FT                   DMSILEKALDEGVMEGQSICVARTLVNEPANIMTPTMLAEEAKKYGKEYGFDVKVMDEA
FT                   DIKALDMQAFLSVGKGSAEPMKLITMKYHGNPNDPEIYGLIGKGLTYDSGGYSIKPTDG
FT                   MHTMKSDMGGAAAVIGAMIMVASQKLKINVTAVVASCENMISGHAYKPGDIIGSMAGKY
FT                   IEITNTDAEGRLTLADALTYAVKEEKATKLIDIATLTGAAIVALGEKVIATLSSDDDMF
FT                   AQFDAASKLASEKIWRLPLEKEYKKMLKSEVADLKNSPGRPAGTITASLFLEEFTSGLP
FT                   WVHLDIAGPSWTDKASSLCPYGGTGAGVSLLYHFFKKSSY"
FT   gene            196977..197558
FT                   /locus_tag="CLOST_0170"
FT   CDS             196977..197558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0170"
FT                   /product="putative 50S ribosomal protein L25 1 (General
FT                   stress protein CTC 1)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20300"
FT                   /db_xref="GOA:E3PU39"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20300.1"
FT                   /translation="MKLMKRDEKAGALRKQDMIPGVVYGHGIDAISVKVPRKEFVKSYE
FT                   KFRQTKTFNCEIDQSPHQVYIKDVQRDVLNPEKITHFDLLKVSSSDKIHTRLPIVLLGR
FT                   ENIERQGLIVQQSLNDIDVKYQVGKGLESIEIDIVNFKDGDMLKVSDIKVPDYVDVLED
FT                   MDMLVASIAHPKVEAEPVEGEEVAEVPLVE"
FT   gene            complement(197677..198699)
FT                   /gene="ilvE"
FT                   /locus_tag="CLOST_0171"
FT   CDS             complement(197677..198699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="CLOST_0171"
FT                   /product="Branched-chain-amino-acid aminotransferase
FT                   (BCAT)"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20301"
FT                   /db_xref="GOA:E3PU40"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20301.1"
FT                   /translation="MQIENIDWGKLGFNYMKTDFSYISYYKDGQWDEGKLIEENTLTIS
FT                   QSAAALHYGQQTFEGLKAYRTKNGDIQLFRPDENAKRMIKSCNRIMMPEFPVERFVDAC
FT                   KKVVKANERFMPPYGSGATMYLRPFLIGVGDNIGVKPAPEYIFCIFCMPVGPYFKGGMT
FT                   PVNFITSEYDRAAPYGTGAAKVGGNYAGSLYPHELAVKSGFADCIYLDPATHTKIEEVG
FT                   AANFFGITKDDKFVTPISPSILPSITKYSLLHIAKEYLGMEVEERDCLIDNIDEFKEAG
FT                   ACGTAAVITPIGGISHNGKLHVFHSETEVGPVTKKLYDTLYGIQFGDVDGPEGWVVKVD
FT                   "
FT   gene            complement(198944..200278)
FT                   /locus_tag="CLOST_0172"
FT   CDS             complement(198944..200278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0172"
FT                   /product="putative NADH oxidase (NOXase)"
FT                   /EC_number="1.6.99.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20302"
FT                   /db_xref="GOA:E3PU41"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20302.1"
FT                   /translation="MNKIVIVGANHAGTAAANTIMGNYKDAKVTIFDANSNISFLGCGM
FT                   ALWIGEQIAGAEGLFYSNKEKLEAQGAVVHMEAPVESIDFDKKIVYATLKDGSKVEESY
FT                   DKIILATGSMPIIPDIPGRDLENVQKVKLYQHADEVIQKLKTEDIKDVVVVGAGYIGVE
FT                   LAEAFERNGKNVTLIDIADTCLPAYYDEEFTELMKQNLKDHGIKLAFGEKVLELKGDTK
FT                   VKEVVTDKGTHKADMVVLSIGFRPNNELGKDKLELFRNGAYVVNKNQETSIKDVYAIGD
FT                   CATVYDNSIQGTNYIALATNAVRSGIVAAHNAGGTALESAGVQGSNGICIYDLKMVSTG
FT                   LTLAKAKSLGIDALATDYDDLQKPEFIESENPSVKIRIVYDKNTRVIIGAQMASTYDMS
FT                   MGIHMFSLAIQEKVTIDKLALTDIFFLPHFNKPYNYITMAAISAK"
FT   gene            200560..202821
FT                   /gene="clpB"
FT                   /locus_tag="CLOST_0173"
FT   CDS             200560..202821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="CLOST_0173"
FT                   /product="protein disaggregation chaperone"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14550559, 14640692, 91294166, 93015925, 93388583,
FT                   99428468; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20303"
FT                   /db_xref="GOA:E3PU42"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20303.1"
FT                   /translation="MKKCSVCKKNIAMLFASTYENGKPEMKGLCLNCAKKMNIPGIDDL
FT                   IKQTGMSEEELSAITDQMNDSMSMFDEDSEMDFLSNFKDADKEDEIQIEENEEAEAHQD
FT                   EVEDKEPSKKKKKKKKYLDTFGTNLTDKASKNQIDKVIGRDKEIQRVIQILNRRAKNNP
FT                   VLVGEPGVGKTAIAEGLAVRIAEKQVPSKLLNAEVYLLDMTAVVAGTQFRGQFEGRMKS
FT                   IITEAQSYGNIILVIDELHNIMGAGEVHGGTMNAANILKPALARGDVQIIGATTLSEYR
FT                   KHIEKDSALERRFQPVMVDEPSEEESIEILKGIKGYYEDYHQVSISDEVIEAAVKMSNR
FT                   YITDRFLPDKAIDVIDEAGSRANLVNEVLTSIEDYKTQLMQSTYLKDQASEKGDFEGAA
FT                   YYKAEEIRLTQKIELLEKSAKTPLTIEDVAHIIEAWTKIPLKSITEEEAIKLLNLEQRL
FT                   HQRVIGQDEAISSISRTVRRNRSGFRKRRKPASFIFVGPTGVGKTEVVRALAKEMFGSE
FT                   DDMIRIDMSEYMERHTVSKLIGSPPGYVGYDEGGQLTEKVRRRPYSVILFDEIEKAHAD
FT                   VFNMLLQILEDGRLTDAQGRTVFFENTIIVMTSNAGTSYKSKSMGFGNANTLEESEHIK
FT                   DALKEVFRPEFLNRVDDIVVFTRLSKPQLREIVDLMIKEVQTELAEKGISLHVSDEVKE
FT                   FLLEKGYDDKYGARPLRRVIQRYIEDEISELYLRKEILDKDSISAIMLNAQVSIVKSHE
FT                   "
FT   gene            202814..204313
FT                   /locus_tag="CLOST_0174"
FT   CDS             202814..204313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0174"
FT                   /product="putative Alpha-amylase precursor (1,
FT                   4-alpha-D-glucan glucanohydrolase)"
FT                   /EC_number="3.2.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20304"
FT                   /db_xref="GOA:E3PU43"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20304.1"
FT                   /translation="MNEKKARFISIGMIALAVLVGIFGYTRPEKLLSKEGVYYYIPVGD
FT                   YIDSNGDGVGDIQGIIGNLDSLNDSNPNTSTDLGVNGIVISPVYLAKGANKSEPLDYYK
FT                   IDPEYGNLIDLEELISEANKRGMKVIMEMEFNHTSIDHEWFRQALSSAKSPFRSYYNLK
FT                   GLDYQPRTESRLVNEESLWHRLNGVKYFSYKDYMTADLNYESAELRNDIKEIAIFYLET
FT                   GLNGLKLKNANNIYTYYEEPNEDSRLEKNLDWWQSFRLACKEVDPDVYLIADVNDRAAV
FT                   IAPYFKEFNTVMNVFAGERAIPYMIKSGKDMSADNGMFAKQMDNISSSYKKYGKNPIDG
FT                   IYLSDESGTIMSKVGNHAKKSKLAASIMMTLPGNPFIYYGDELGMNDEKIQNPDSTIYN
FT                   HYTDLIRLRQLHPALKTGSLIETSDDNVHVLSYIRYDSKEKENLLVIHNLSDDTQSAYI
FT                   RELKSYDEKNIIHSTSNHDVMDKNLSKVQLSGYSTLVISLK"
FT   gene            204730..206691
FT                   /locus_tag="CLOST_0175"
FT   CDS             204730..206691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0175"
FT                   /product="putative MutS family protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20305"
FT                   /db_xref="GOA:E3PU44"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20305.1"
FT                   /translation="MNKAIQTLEFNKIKERLSEFCQSSLGKQLVDNLYPAVNIKAVETR
FT                   LKETKEAVRLLKAGMIPPLGGLSNISMLLEKTEKGMILEASELTAINDFLRACRNLEQF
FT                   MNKHKELIPLISEYILSMKSYKDIEEEISYSVSGALVLSQASKNLGRIRRLKENQKEKI
FT                   EKTLQAFLSSNSNKSLIQEFFISEKNGHYTIPIKSAYKNHVEGSIIETSSTGSTVFIEP
FT                   KAISKLAGEMQMLEAEEMAEQYQILAGLTGLIYENISSIKQNMELMATYDLIFAKARYA
FT                   ISINAAMPEINLKRHIRIVNGRHPLLEGRVVPLNIEVGPDFNTLVITGPNAGGKTVTLK
FT                   TVGLLILMTQCGLFIPADESSQIPVLDDVLVDIGDNQSIENALSTFSSHMQNLGIILKK
FT                   SSNNTLVLIDEIGTGTDPAEGAAIAAAILEELSRKGSLTIATTHYGEIKEFAVRHPLFR
FT                   NASVLFDKETLSPLYELIMGESGESNAFWIVEKFAFPSGVINNAKRYLMTNEKNKAASY
FT                   ITEKDKEKLQSEFEKNKQRQLEKQTLKEERLSSIEERKVDYSKGDRVRLLDTDEIGLVY
FT                   EEADKNDNVTVYLSNEYKKILRKRLSLMEKAQNLYPSDYDLDTLFTDYSARKLDHDIKR
FT                   GSKRALKKIQKDMRGKNR"
FT   gene            complement(206904..208649)
FT                   /locus_tag="CLOST_0176"
FT   CDS             complement(206904..208649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0176"
FT                   /product="Methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20306"
FT                   /db_xref="GOA:E3PU45"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20306.1"
FT                   /translation="MKSIKNKMIAIMLGLVIVSLVSTLTLSLLSSFKVTEDIINSQFEE
FT                   KLIAADNMLEIYLKEQFGELKSNSSGNLVDSNGIAIAGQYDYIDKLSDSMSIVATVFEK
FT                   QGNEYVRVLTTVKDEAGKRAVGTTLDSNGKAYEAISKGESYFGEADILGVQYMTHYSPI
FT                   LGENKEVIGIYFTGKTIADVEKIAQDGKMDTIKSVAMIVALILLIIAALSYYIGNSISK
FT                   PIVALTTALDTQAELDFSANENNQLNKFTTRRDELGKMCKALIVMQENVAEFIRKTSES
FT                   AQSVASASDDMTAKTQQAATTSEEIANTIEEIARGASDQAKDTEITAQNIDDLGNLLDE
FT                   DSRKLMQLNDAAKSIETQKEEGFVIIHELIDKTMQNNEATETVYSIIMSNDESAKKIQE
FT                   ASEMIQSIADQTNLLALNAAIEAARAGEAGRGFAVVADEIRKLAEQSNSFTNDIKLVIE
FT                   ELRSKSQAAVTTMQGVKLMFDDQSKSVNQTGDKFEMIAKAIDSIKLIIDSLNESSMQMT
FT                   DNKNSIIDLVSNLSAISEENAAGTQEVAASTQQQAATIAELANAGDSLASVAEELRALV
FT                   YKFKV"
FT   gene            208806..210500
FT                   /gene="ptsI"
FT                   /locus_tag="CLOST_0177"
FT   CDS             208806..210500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="CLOST_0177"
FT                   /product="phosphotransferase system (PTS) enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20307"
FT                   /db_xref="GOA:E3PU46"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20307.1"
FT                   /translation="MYKGTGVSRGLAIARALVISNQEISVKTYEVEDVKSESQRVTLAF
FT                   HKAKLEIEEFISTLTNEEEKNIINTQLMMLEDPELLKEIDNYIKDNSVNAESAIDKILD
FT                   AYIAMFEQMPDEYMSQRAVDIKDIKTRVLLTMTRRTRMDAIELDHDCIIVADEILPSYM
FT                   TQLDQTKVVGFISSKGGVNSHSSIIARSMQKPMIIGLKDVVTQLKTDDMLAIDGSKGMV
FT                   YVNPDEALITDFEKQMEAMRLQRELLRMLPDVTATKDSHHIGLYANIGSIEDAKYAAEN
FT                   KAEGIGLFRTEFIYLNQSELPSEQYQYEIYKSVLKLMKGKEVVIRTVDIGADKQLDYID
FT                   IPKEDNPFLGLRGIRLCLVNKEMFKTHLRALLRASMHGEMKIMYPMISSLEELQTANYI
FT                   LEECMLELDEENIPYKRNIKVGMMVEVPSAAINSDILAKHTDFFSIGTNDLIQYTVAVD
FT                   RMNEQLLNLYSPYDPAVLRLIKLTAENARKNNIPVSICGEAASEEALLPLFLAMGINSL
FT                   SMSAGEILPLRKKVGEFQLKLLKTISEEVMALETAGEIKNHLKKYMR"
FT   gene            complement(210511..211128)
FT                   /locus_tag="CLOST_0178"
FT   CDS             complement(210511..211128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0178"
FT                   /product="N-acetylmuramidase (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20308"
FT                   /db_xref="GOA:E3PU47"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20308.1"
FT                   /translation="MKKRKRRKKKLPKNFYIFLRFASTGLITISIMMIIIFAGREIASL
FT                   PEKKRIHDDEIRKENFIEAMLPYAEENQQKYRIFPSITIAQAILESNWGESTLSKNYSN
FT                   YFGIKSIRETDQRIVFQTNEYIDGKLVQIPGAFRAYDNLAASMAHHGLLVGTADRYKPV
FT                   VESVTYQEAAKALYACGYSTDPNYPDKLIELIEKYKLYDYDS"
FT   gene            211405..211716
FT                   /locus_tag="CLOST_0179"
FT   CDS             211405..211716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0179"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20309"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20309.1"
FT                   /translation="MENSEALKVLHHLEDLLKQEDNKAIYDLMTHDFKSRVGMDHYLRL
FT                   EKYRLNLSLPLCLVHIYEASDEKMMLRVKQESKSDHESFANILFVKEEEMWKLSGVLT"
FT   gene            211859..214528
FT                   /locus_tag="CLOST_0180"
FT   CDS             211859..214528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0180"
FT                   /product="LPXTG cell wall surface protein, zinc
FT                   carboxypeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20310"
FT                   /db_xref="GOA:E3PU49"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20310.1"
FT                   /translation="MKSKKVGKLGKAVALIVALLMVVSLAVPAFAQDTKAVSGPVVSMT
FT                   EPKEVVFEARMSTDTKVSDLKWYFGDKELSAWKKWSMETGDFTAGPFITFTKEPVIENG
FT                   LLKATISFDRLFDTTDLSQRRPYNIRLKYPEFIGTYELKAVNEAGQQQAKLDVSLVPYE
FT                   SYMSYDQMKAAVADIKNSAKADRFVNLEVYGTTVQGRPMDLGIIAKDKEAVDKYLNETT
FT                   PMMLENPEKMIADIKANKADYKTVIFMNNIHPDEQPGVDAVVKLFNDYAKEDFIDYATT
FT                   DENGKKVNKRINVDNLLEDFILVFSFTQNPDGRVANTRANANNLDLNRDNGFQTQPETQ
FT                   AMVAQISKYNPLIFLDYHGFVQEFLIEPCTPPHDPNYETDLLYSTMLELANIMGRAGVE
FT                   NSKYEDYIIPMIDYGTGWDDATSAYTATYAMHHGALGHTIEVPEMNEDSFKAAIHTGYA
FT                   AADYAINNKDVLMLNKLEYYKRGVEKLDSREADKAIVNAQNEIKGRPRGSNESFFPDYY
FT                   VIPMGLDAQKNAVAAFDMIAYLERNGVKVHELKSDAGAYKKGDIVVDMAQAKRGYANQV
FT                   LYSGVDESEWAEMYAEIVTNFPAQRGFDVMEVRDANLFTGKLGDVTISKAPSSSITDAD
FT                   FYLIHNNSLETVKAVNHAIEMGHKVVRADLGQGKEGFAVDKACLEMLVDKHALKFEALD
FT                   KMPEGKEITSKTVYAPAMSTAYFALEAMGFDVVTDANEADVLVTDSGSLDPELIGTKPM
FT                   VAIGGSAMAAIGESGKIAGLEVKTTDFYHEGLLKSTNNASSMYSLGYSSDDTMYSSSGT
FT                   WLEKLPAGFTALSTVKNTGDYFVAGWWPGHEQVKGKVMSTVGMVNGQKTVLYAGNLTNR
FT                   LHTQYLYRWISNAVYELQ"
FT   gene            214975..216405
FT                   /locus_tag="CLOST_0181"
FT   CDS             214975..216405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0181"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20311"
FT                   /db_xref="GOA:E3PU50"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20311.1"
FT                   /translation="MEQNKKKFSMPSAYTILFAIIVVVAILTWIVPAGQYEMTELNGKE
FT                   VPVPGTYQQVERTPQGIFDIITSPAKGYQDAVDVALFILIIGGFLGVVMKTGAIDAGIA
FT                   QVTNKLKGKEKIMIPILMVLFGVGGTSYGMAEETIAFYPLLIPVFVAAGYDTVTAVAVI
FT                   LLGAGVGVLGSTVNPFATGIASGFAGVSLGQGIVLRLLILVVGEIAAILYVMRYAEKVR
FT                   KDPTKSITYATREEDIKHFGAQQEGTSFPELTGKRKLILGLFALTFAIMIYGVIPFEDM
FT                   GITAIPTLWWWFTELASLFLIMSIIIGLVAGLSEKELIGAFVDGSRDLLGVALIVGLSR
FT                   GITVVMNAGNMTATVLNLGERTLASTGSVAFTILTYLFYIPMSFLIPSTSGLATLSMPI
FT                   MAPLGDFAGVARDVVITAYQSASGIVNLITPTSAVVMGGLAIGRVPYDKWLKFVGKFMV
FT                   IIFLITVAALAIGALGIL"
FT   gene            216537..216905
FT                   /locus_tag="CLOST_0182"
FT   CDS             216537..216905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0182"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20312"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20312.1"
FT                   /translation="MNSAYCMVLVINDIAKYETILKKLFDMGIGATSVDSMGMGKFLLE
FT                   SDIKIPFFGTIQQMVEGNRPYNKTVFSVIRTKSVLDEAVAMIKTELHLESETGKGFMFV
FT                   LPVLDYHGFEEEGSLVED"
FT   gene            complement(216902..217945)
FT                   /locus_tag="CLOST_0183"
FT   CDS             complement(216902..217945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0183"
FT                   /product="ApbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20313"
FT                   /db_xref="GOA:E3PU52"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20313.1"
FT                   /translation="MKKRLFLFVLLFVFSILTTGCQMKPEQKLISTGPNFFLNSVLDVK
FT                   ILDEGKDIEKINEDITMKVQSLENVLTSKTSSSEVSKINQNAGISPVSVSDETFLVISE
FT                   GIKYSELADGSFDITVGPLANLWGIGTEAAKVPTEDELKKALSLVGYEKVVLDKNAKTV
FT                   YLTEKGMALDVGAIAKGYVTDEINSILAKYEVKSAIINLGGNIYARGDKNGSPFSIGIQ
FT                   NPYSEHGDYLGIYRDTDFSMVTSGTYERYFEQDGKKYHHILSTTDGYPVENEIAAVTII
FT                   SKNSMMADALSTSVFALGTEKGFELIDSLPDSDAIVITKDKKIILSKSMADSFELKNTE
FT                   FTIEYRD"
FT   gene            218293..219972
FT                   /gene="gspE"
FT                   /locus_tag="CLOST_0184"
FT   CDS             218293..219972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="CLOST_0184"
FT                   /product="general secretory pathway component, cryptic"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20314"
FT                   /db_xref="GOA:E3PU53"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20314.1"
FT                   /translation="MPNKKMRLGDILIEAGILTIDQLEDALVLQKQKNKKLGELLIDEK
FT                   ILTEEQILGVLEYQLGIPYVDLNKYYIDPKAPKIISESLAKKHNLIPIGMNRGKLMLAM
FT                   SDPLDMIATDDIRITTGLELDLVISSKNDIKKAINIYYDSTELAEKAVEEFKSQSDVQE
FT                   IDDDIEDEDIINAPMVRLVNTIISQAVRSKASDIHIEPFEKNVRIRYRVDGELKEVMSP
FT                   AKSTHSALVTRIKIMGKMDISEKRIPQDGRVETIIENHAIDMRISVLPTVYGEKIVIRL
FT                   LDRNAIIVGKEELGFTAHNLELFDKIIKAPEGIILLTGPTGSGKTTTLYTILKELNQIN
FT                   KNIITVEDPVEYRLHGVNQVQVNTKAGLTFASGLRSILRQDPDIVMVGEIRDAETAQIA
FT                   TRAAITGHLVLSTLHTNDTASSISRLIDMGIETYMVSSSVMGIIAQRLVKKICTKCKES
FT                   YEATDEELHFLGINEKVTLHKGKGCNACSGTGYSGRTAIHEVLVMDREIRNLINEKKSI
FT                   DEIKDKARSKGLKTLNESCKELVLSGITTMEQLIKITYSVDI"
FT   gene            220099..221157
FT                   /gene="yggR"
FT                   /locus_tag="CLOST_0185"
FT   CDS             220099..221157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggR"
FT                   /locus_tag="CLOST_0185"
FT                   /product="transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1676385; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20315"
FT                   /db_xref="GOA:E3PU54"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20315.1"
FT                   /translation="MNVLELLDKAISENASDIHITVGLPPIMRVNGALIKMQETPCTPR
FT                   DSLNIVNQMLKSKQRDELEEKGEIDFSYSEQSIGRFRANIYKQRGSYGVALRVVPMYVP
FT                   TIEGLNLPPILKDLSMKQRGLILVTGPTGSGKSTTLAAMINHMNNNRGSHVITIEDPIE
FT                   YLHRHNKCMINQREIGNDTKTFSNALRAALRQDPDVILVGEMRDLETISTAITAAETGH
FT                   LVLSTLHTVGATKTTDRIIDVFPPYQQQQIRTQLASVLEGIISQQIIPRADGNGRVAAF
FT                   ELLIATPAVRNLIREGKTHQLMTSLETGSKFGMNTMDSALIKLYKDGVIDNENLRKYAV
FT                   DIDMINKQIGYY"
FT   gene            221170..222387
FT                   /gene="gspF"
FT                   /locus_tag="CLOST_0186"
FT   CDS             221170..222387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="CLOST_0186"
FT                   /product="general secretory pathway component, cryptic"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20316"
FT                   /db_xref="GOA:E3PU55"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20316.1"
FT                   /translation="MATSFKYKAVDASGRVVEYTHQANTKEEVLKMIREKGFTPIRIQA
FT                   EEQKSKDVGDMSLFQSRVKIKDISVFCKQLYTMLNAGMPLSNALDVLGDQTENKVLRRT
FT                   VKEVYSEVQTGLILSQAMKKHKKVFPNLLITMVEAGEMTGNLDNVLAKMSEHYEKENKI
FT                   NSKIKGAMVYPAILSVAAVGVVIFLLTFIMPTFTEMFTSSGVELPGPTKLLMSISDALK
FT                   NYWYIFIAVIGTIIVLFRGYIKTSAGKRQYDTLKLRIPVIGTSVTKIATSRFTRTLSTL
FT                   MASGIPIVPAMEAAANVTNNQVVIDGMNKVIEDVKKGLSISFLLKSMHFFPPMVISMVG
FT                   IGEESGSLEEMLSKTADYYDEELDASIQKMLSLLEPMLILFMGVIVGFIVISMMLPIFD
FT                   LSSTVQ"
FT   gene            222452..222841
FT                   /locus_tag="CLOST_0187"
FT   CDS             222452..222841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0187"
FT                   /product="putative Fimbrial protein precursor (Pilin)
FT                   (Strain K122-4)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20317"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20317.1"
FT                   /translation="MMEKMRNKKKKGFTLIELIVVIVILGILAAIAIPRLGGFTDTANK
FT                   ATAEAEARTVITALSTIYAEDPTTTTDTAIEGYTEATTAVTDLTGKLNGTFTVTDSTNG
FT                   SIDMTYVFKGWTVTITDSAIVSTSK"
FT   gene            223182..223610
FT                   /locus_tag="CLOST_0188"
FT   CDS             223182..223610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0188"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20318"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20318.1"
FT                   /translation="MKNRKGVSLIWVIIALVFVSIMTMSISTIAQSNILQAKRQDDTLQ
FT                   AYYIARSGAELTYEALITSSPSLLIPFTSSSNSGNTHTLTQNNIVIGEGNADIKVTSYN
FT                   IDTVKRIKIESTGKLNNVTKTIYLEFDASTYGDIRWIY"
FT   gene            223656..225056
FT                   /locus_tag="CLOST_0189"
FT   CDS             223656..225056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0189"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20319"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20319.1"
FT                   /translation="MKKSNKGVTLLELVIVLALLTFGIGIAVNMILFSRNAQAKTLEEF
FT                   DFQSEMRQSSQVVNNEIRNSTVVFAVPQDTFNNKKAMWNYLGLEDSKTLVQYTWNEADS
FT                   RHDRIELYKSDQDISLNLMFKQLTPNSKLIEFTLQGYIDGKTDPKMTIKSEIEAFNSVV
FT                   VEDGGSPSYPATALAYRTDDTPGPQTKAGKKVVAAITLVLDESGSMANNMSGGRVTSSN
FT                   PSRISILRNRAKALIDQFSGLGNIYVGIIPYSDDAYISGTKSFVLANGTNVNTIKNKID
FT                   SLTAQGMTNTGDAMRVSYYATKQFKDSPNSIDNTLPTDTKVIPYMILLSDGDPTVFSAT
FT                   TREWVGWWIFGHYEYSGYKQDSGYVISDRISDDSESKNTSQWSSMGYSEYIGQNLVVGG
FT                   DLEIKSHVIGFSNDATNAQTIANYINAEYHSANSDVELEAVFDEIGGTILKEMWHIYGP
FT                   YVDDESDD"
FT   gene            225082..227166
FT                   /locus_tag="CLOST_0190"
FT   CDS             225082..227166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0190"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20320"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20320.1"
FT                   /translation="MRRGMTLIEIIISIALIGIIAFGILPAISAQYSMVHKTKNITVDS
FT                   FDSQSKVENEVVSKRTELRDKTKTINDFSPIQNFNILGVNVNAYDLKVTSSKFGNRTID
FT                   IFLSKQLAEREQFSSLTANNVRIEVVGGTSNDFANLASGTPSLEGKVDAITDSTWYTNV
FT                   YKWYVSDPGISNPLFPDDYKQISQYVIPPNQIKITDLNPYANRFLRFSVTPVDKHGVRG
FT                   SEVFSDNTVLVVGVEWRAGTNAWADKNLDTKFDDSQGDARIKTEYLFSLFDTQNPLKDF
FT                   INPETSVDIKNSALFIPRRIDAGTQVVSDINLVGISFIDWKVDDSIFLSTNIYSTGESD
FT                   INLLTRNGSIVLHRYIQFDSNGQVVLGSNGNPIDINDGSKINTQGDVYLTSEGAGNIIL
FT                   QPYSGINLGDNIFIKANGIVMLDNNAFMKAKTSITIDTTKKLGILSNRNIRMNNAFIQL
FT                   EDNLTSGKRVDLLSNNIVFLKDTLLDGKNPSSILNISSKEGNIFDNSIIKNLITFIKGP
FT                   SLMKGGSWDSLSSIKVDDGSILKFEKMDDGTKVNNVGSLNLGNTGSIQFANSMIEDLEN
FT                   PLELTLTDIGINQMNITSNYGRNIGYADASTSSFVNGVFQNIGSGNTNLEYKIDITDVS
FT                   NVKDIQVSFDGSQTLTVTGTLNNPTIPVSATLTVRDKYIKDKNNMPVEIAIPKPITITN
FT                   "
FT   gene            227218..228237
FT                   /locus_tag="CLOST_0191"
FT   CDS             227218..228237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0191"
FT                   /product="putative Type IV pilus assembly protein PilM"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20321"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20321.1"
FT                   /translation="MKQNKSKLGLSSKKKDVKCLSIDIGSSYIKFAVGQKMGRRLKVEK
FT                   TFKARLPAGVYENGHMHNIQEMKSIIQGALNANAVKLKDVICTLESTDAIKRELVVPAV
FT                   APEDLSEMVSYEIGQYLPIDINSYVLQYKIVREFEEENVKKYELLVAALPKEIVHNIYS
FT                   MLIEMGLDPYALDIHSNAVDKIAAEYELFNEASIKENTAAFLDLGHENINVIIVEKGQY
FT                   KFNRLIKNGTRDFEKLTTEFEFKSIDEISQHLDVVDRWIEEIDKVFKYYTSRSVDNTID
FT                   KIFIYGGISVMEGLDTYIHERVNIPVELIKSIDNVEIVAGNEYTLAQSLNAISAIIRL"
FT   gene            228252..228812
FT                   /locus_tag="CLOST_0192"
FT   CDS             228252..228812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0192"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20322"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20322.1"
FT                   /translation="MRDFNFFAPYEQEPKKKASGSNVLMIVAAGLLALCLALVIFNTMT
FT                   LMSLEKSITNLDSNMNEPDFKAKVANVQAKQAELNSLKTDQVFFEALDIVMDKQNKVNE
FT                   AAVRLIAEQVPDNLHLTDLSIVEDKIDIKGKSYNKVAVAQFQHNLRQTEEFDNLFVSEM
FT                   VKEEAYYNFSIMLKAKGDETDEN"
FT   gene            228865..230214
FT                   /locus_tag="CLOST_0193"
FT   CDS             228865..230214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0193"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20323"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20323.1"
FT                   /translation="MFFTFVYTPQTEKLETLKQEEQAKQNEYAQMQALISSEGNVDLEI
FT                   ETIKNQLLPVARTYFGDIDQEETIVILDDFAQKADLDIKGIRFSEPVKTSLTELKANEA
FT                   SASGEAQPPAPAPAENTAPPEGTQAQVAAPPAVSDNFTTRPVEVEFEGNYNKLMDYLVE
FT                   VGSYYKRISSYSMQLKSDLDKPLSGTIFMNFHCVDSVDKYVPQDPSILEYNFIPRSSKD
FT                   NPFEAYSWSYKITTIPGVITSPVSQQGIIVGPSELGMYYLPEQTKEDPISMEKTMELGA
FT                   QNPLPLALNIFDEKLLYSFEDRILKTFALDKGNTISGKLEKDLESEENLYSITYTFDGE
FT                   EAETEVYLDLQSKKLTIDKHPQYLSLFVNADKKLDNILGLIVTDAKGMDYRVFLANKID
FT                   WTNKKELRGVLPESIAYPLTVKNVFVRDNSDTSTKNAKLSFDELKVAYMK"
FT   gene            230628..230975
FT                   /locus_tag="CLOST_0194"
FT   CDS             230628..230975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0194"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20324"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20324.1"
FT                   /translation="MKKVDFKDGMPYKAPLHFDCATLKLQGLEETGASKFWMGVTHFLP
FT                   GGGAEYAYEDSPTEKVYIVLEGEVLVKSKTEEFLLKKMDSIFIGPNEGREIINKTNMPA
FT                   TMLVVVNYPEA"
FT   gene            230988..231776
FT                   /gene="kduD"
FT                   /locus_tag="CLOST_0195"
FT   CDS             230988..231776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="CLOST_0195"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.125"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1766386, 2836407, 92114798; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20325"
FT                   /db_xref="GOA:E3PU64"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20325.1"
FT                   /translation="MKEMSNQEMKNMFSLEGKVAVVTGGAGSLGEGVATGLALHGADVV
FT                   VTGRTIETLQSTVKKVEELGKRALAIACDVTNEDQVKAMAKQAVDAFGKIDILVTVAGI
FT                   AKRFPAEEFPVEAFEQVMDINVTGTFIPCKVIGNVMKEQGHGKIITVSSVRAFAGHPGG
FT                   YAAYGTSKGAVALLTKQLATEWAKYNINVNSVAPTIFWTPLTQEVLEDEKLKKIFLDRI
FT                   PMGRAALVQDMVGTTVYLSSAASDFITGQIIYVDGGCTAG"
FT   gene            231798..232757
FT                   /locus_tag="CLOST_0196"
FT   CDS             231798..232757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0196"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase precursor"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20326"
FT                   /db_xref="GOA:E3PU65"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20326.1"
FT                   /translation="MSEEIKEKAKKEIKNITIYGSGLMGSGLAQVFASDENLNVTICTR
FT                   NIANSKIHESMSQNLKPFIDKGIYTEDYAINLISRVRISDDREASAKNADFIIECIPEN
FT                   MELKQNLFAELESYCSEDTILATNTSVMSISEIAMKTKKKDRVVGAHFWNPPYLIPLVE
FT                   VVKGDETSEETMDLTMKLLKKAGKHPIYVKKDVPGFVANRLQHALWREAISIVERGIAD
FT                   AKTVDEALKFGPGLRLPILAPIENADMVGLDLTLSIHSYILKYLEDSHEPSKLLKELVE
FT                   KEELGFKTGQGFQSWTKEEADSSRERLSEYLIKVLYNK"
FT   gene            232786..233724
FT                   /locus_tag="CLOST_0197"
FT   CDS             232786..233724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0197"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20327"
FT                   /db_xref="GOA:E3PU66"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20327.1"
FT                   /translation="MAKKVLVDLTHPFHADIPVWPYFAKPKIDTMHNLAKSGVLTQKID
FT                   VVMHCGTHADAPRHVMEYEFDGKRARYTHEMPLDAYYGDAVCLDIKVDRWGLITADHLY
FT                   DACKRANIKPEELEGMVICLRTGMHLKFDDTREYYHYSCGTGREAGEWFAKYKPKCVAM
FT                   DMQALDHPLHTTMGKNGGYVGMNLIGNSGKPITDEYIEKFGIEAYAEFNKDTFIDVFGK
FT                   DKYMEAYGMLENHGLEGTWEPCHKLMMGNGIVGVENLGGDLDKVVNKRFKFMAFPIRWW
FT                   LGDGSMVRCVAEIDEDDINDVPDRVYNYGGF"
FT   gene            233751..234584
FT                   /locus_tag="CLOST_0198"
FT   CDS             233751..234584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0198"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20328"
FT                   /db_xref="GOA:E3PU67"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20328.1"
FT                   /translation="MSNLDNKVILTVAPTGAWPTKKETPYVPLQPREIADEIYACWKAG
FT                   ASIAHIHVRDDEDKSSMSFEKFEETVRYIRETDCDIVINLTTSGQLGLDDEARMKHVIE
FT                   LKPDIASYDCGSMNWMHSSVFENSPRFLEKLGLAMQENNVKPEIEIFDAGMIYNALYYL
FT                   KKGILKAPLHFQFVLGAAGGMDATVENLVFLKSLLPENCTWGALGIGKGHLPIMYAALA
FT                   LGGHVRVGMEDNVFYSKGVLAKSNVEFVERTKRIVKELNKEIASPDEARQILGLK"
FT   gene            234613..235233
FT                   /locus_tag="CLOST_0199"
FT   CDS             234613..235233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0199"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20329"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20329.1"
FT                   /translation="MEMKVTQDSMGTHLDWKHEGITPKMIDWFWSNMEKGFILWHPSQH
FT                   ETLEWAVAPKHGNPIGSVHIAPQTWNDGTRQNLYIRFEDLATVPANVKEYIVYEHCVVV
FT                   AGLGFGPESLEVEEVMGYRIHQWEKTDYGVVGKSSAIGMKKKETPEQGITWSEHCAEEI
FT                   GNWGAFLPQLYNLYQVVTNTDYNPYADLTVEGKGKDLNYKYIR"
FT   gene            235368..236909
FT                   /locus_tag="CLOST_0200"
FT   CDS             235368..236909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0200"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20330"
FT                   /db_xref="GOA:E3PU69"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20330.1"
FT                   /translation="MDNVNMNEIGYKSDEQDLFKKREADALAIADSISDGIYITDKNGV
FT                   VTAINKAFTEITGIKAADIVGKNMQQVWNNVVLNSDPAFIEIKPEDKANVFYMFNNGKK
FT                   KTLKTRKPCSIALLVLKEKKPISVLTTIDRMNKRVLITGTPFLDEDKNVVQVLTIIKDL
FT                   TELFVLREKLEEVEKEKAKYLSEIKNLKKDIKERQLYKDLISKSSSMDRVIKLIENVSK
FT                   TDATILITGETGVGKEVVARTIFKNSKRANGPYIRVNCAAIPENLLESELFGYEKGSFT
FT                   GASQNGKLGLFEMANNGTILLDEIGEIPVKLQPKLLRVLQEREIKRIGGTSNIKIDVRV
FT                   IAATNLNLEDEVKKGNFREDLYYRLNVIPIELPPLRERKEDISLLVYNFLGKFNKAYGR
FT                   TKDFDITALEILENYSWPGNVRELENSIERLVVIGDEHLITRNTILSVLGQDKFYEAST
FT                   ETIDGTLKEAVDKFERNILEKTLKSCGSTYKAAKILGITQSTVVRKAKALGITEW"
FT   gene            237133..238095
FT                   /locus_tag="CLOST_0201"
FT   CDS             237133..238095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0201"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20331"
FT                   /db_xref="GOA:E3PU70"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20331.1"
FT                   /translation="MKILGISCGRKMSNTEILVKEALMGAEELGAEVEFVRLQDLNLKP
FT                   CTGCNACVVSLMEKGGTGDCVIRDDDFKFIDEKIMDCDGIIVGSPIYEKTPSGQLKILN
FT                   DRMGPSHDVAMRMIAKKIREQKNITTGNGPDERSFKTRAASLIAVGGSEWDNLALPMLH
FT                   LFTLSMQMEVVDKMLVNWVALPGMVALKDDELARARKSGRHVAKTLMKPIEEAEYIGEE
FT                   GMCPLCHSKLLEVRNGDSNYPIICGICGVKGTLSVVDNKVKFEVKEEDKAHSHIRLSGK
FT                   FEHCDELKNVSLKPAPNVHELPQRLEKYKTYLTPSRPIS"
FT   gene            238124..238981
FT                   /locus_tag="CLOST_0202"
FT   CDS             238124..238981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0202"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20332"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20332.1"
FT                   /translation="MSIEFNPMRSLIYVDVVKEDYRHMLKHWLYRHHIPDSISQFGPYV
FT                   TKYAFYPALPTPPEGDRFGTIRMQLTEHYWTVNPFTSNFKNKAFTEFFPIDILKWQGNI
FT                   PDDSKVAALEGEEVVKLEGDDARASGGDNGCPPFIFAFVPICWEEDFKGSQRTVEDGPN
FT                   YRWQFVMKYPEGVTMQEGDKWFYEEMIPKFKGMPDVLRILSSKIIQQVNGCPYHRVVEM
FT                   WFNCPSAWYRSAVEKAKEIKKPSWAKYDAFPYLKPKFEIASLFLTDIAESDNYSQYRGY
FT                   ITMR"
FT   gene            239009..239233
FT                   /locus_tag="CLOST_0203"
FT   CDS             239009..239233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0203"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20333"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20333.1"
FT                   /translation="MKLKISITNGIIGGAIGGIISFVINYFLVPVPQNALQNGFGNLIS
FT                   GLISGFLAAFIGFMIYLSKENKSDSKMIS"
FT   gene            239315..240220
FT                   /locus_tag="CLOST_0204"
FT   CDS             239315..240220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0204"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20334"
FT                   /db_xref="GOA:E3PU73"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20334.1"
FT                   /translation="MEYKSFDDLIKKVQNLDSMKKVAVVSAQDEHTLEAVFKAKKDNIV
FT                   EPILIGNKKKIIEILSGLHESVLEESIINVESDSEAAEKAVELINENKADFIMKGKIQT
FT                   ADLLRAVVNKENGLRTGKVMSHIVIHEIPTYHKLLAVTDGGMMMYPSLDEKKQILENAV
FT                   STFLALGYENPKVAVLAAVETVNPKMQESVDADMLKKLNIKGEIKNCIVEGPISYDLTM
FT                   SKESASIKGFVSPVTGEADIIVVPNITVGNILGKSLVYSAGAKMAGFIVGAKVPIVLTS
FT                   RGSTSEEKYLSLALSASAVK"
FT   gene            240244..242025
FT                   /locus_tag="CLOST_0205"
FT   CDS             240244..242025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0205"
FT                   /product="Thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20335"
FT                   /db_xref="GOA:E3PU74"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20335.1"
FT                   /translation="MKKLLTGNEAIARGAWEAGVKFASAYPGTPSTEILENTALYKEDI
FT                   LAEWAPNEKVALEAVIGASFAGARTFAAMKHVGVNVAADPLFTFSYTGVNGGMVLISAD
FT                   EPGYHSSQNEQDNRNYAKFAKIPMLEPSDSQESKDMMKLAFEISEDYNTPVMLRVTTRV
FT                   CHSKSIVKCSDRQEAGIKEYSKDLNRYPVPSNVGGMRKRVEERLTKLQEYSNNTKLNFI
FT                   EWNNKKIGVIASGACYRYAKEVFGDSVSYLKLGFTNPLPNEKLVEFCSEVEKIYVIEEN
FT                   DSYIEDQVRILGFDCLGNNFFPYTGEMTPDVIRNTVYGKTNDTLDYDSAKVVPRPPTLC
FT                   AGCPHRGFFLELKKKKNVVVSGDIGCYGLGHADPYNVGDWCIAMGASLSMGHGAQQVFN
FT                   MKENSNTRVVSMLGDSTFFHTGMNSLLDVVYNSSNTVNVILDNRITGMTGHQENPGTGY
FT                   TLQGKKTKEVDIEKVVRAFGMDNVVVIDPNDLTAVKNALDWALSLDEPSVIITRWPCIL
FT                   KNLSIEDEKEFEGVFMSKCKVDTDKCIGCKACIRTGCPAISFDKDNKKSSISPDSCVGC
FT                   EVCLQVCPVKAIGKVEV"
FT   gene            242027..242596
FT                   /locus_tag="CLOST_0206"
FT   CDS             242027..242596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0206"
FT                   /product="Pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20336"
FT                   /db_xref="GOA:E3PU75"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20336.1"
FT                   /translation="MVKSILLVGVGGQGTILASKLLTTGLMEAGYDVKMSEIHGMSQRE
FT                   GSVSSQVRYGDEIQSPVIEIGGADILVSFEKMEALRWFKYLKPNGKVIVNDYEIDSMPI
FT                   LSGKEEYSQGIIDEISSRASTIVIDAQKYALQLGNSKVMNVILLGSIIKAMELEAINWE
FT                   KIVRDNVKPQFVEVNLKAIEVGMNLL"
FT   gene            242607..243263
FT                   /locus_tag="CLOST_0207"
FT   CDS             242607..243263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0207"
FT                   /product="putative membrane protein precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20337"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20337.1"
FT                   /translation="MKKGDFVWIAALLVWVLILVVPSSRALFISVTDAHPYAGGFIKFA
FT                   ILASMGDMLGIRVIKGEWIAPKGLMYKALVWGIIGLMVTLVFTVFMGGAAAAQASGKLP
FT                   FNGSILAQAFFGSSIMNVTFGPMMMVFHRFTDMYIDSKCDNKEVKVTMRELIEKNDWNS
FT                   LVEFSWLKTCPFFWIPAHTIVFLLPSHYRVIVSAFLSIALGLLLAFAKKESHNEV"
FT   gene            243253..244320
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0208"
FT   CDS             243253..244320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0208"
FT                   /product="branched-chain fatty-acid kinase"
FT                   /function="16.8 : Protect"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="2.7.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094682, 12427936, 15241682; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20338"
FT                   /db_xref="GOA:E3PU77"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20338.1"
FT                   /translation="MKYNILAINPGSTSTKLALYENDKEIFCNTLEHSAEEIEKYDKIQ
FT                   DQFEMRKNLVISSLLEKGYDIKSLSAVVGRGGMVPKVKSGAYKVNETMVDRLKFNPVIE
FT                   HASNLGALIAYEIANEVNISAYIYDSVRVDELNDVARISGMPEISRTSTSHALNSRAMA
FT                   MKVAKMNGKKYSDMNFVVAHLGGGISVSVHEKGRMVDILADDEGPFSPERAGRVPCKEL
FT                   IDLCYSGEFDKKTMNKKLRGNGGLKAYLNTVDVREVDEMIERNDEKAKLILEAMAYQVA
FT                   KGIGDLSTVVEGKVDAIVLTGGIAYSKRITALIKKRVEFIAPVEIMPGENEMESLAMGI
FT                   LRVLKGEEEASEYSE"
FT   gene            244484..245686
FT                   /locus_tag="CLOST_0209"
FT   CDS             244484..245686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0209"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20339"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20339.1"
FT                   /translation="MKNRDLYLNQLIQFKDKKLIKVITGLRRSGKSTLLSLFKNHLITS
FT                   GVDRNHIIRMNFESFEFDEITNYKELHEYINKRILDPNKRHYILLDEVQQVSSWERVIN
FT                   SFFVDANVDIFITGSNAYLLSSELSTLLSGRYVEIKMQPLSFKEYLEFLDSDKEMSLQE
FT                   KFNQYLEYGGLPTIVELLDNPDTIGPFLEGIYNTVLMKDVIERNGVRDAALLESILKFI
FT                   AANIGSIVSTKKISDYLTSSGRKTTSDTIDNYMKMLENAFIIYKANRYDLKGKMFLKTL
FT                   EKYYIVDIGIRNKLIGLRNTDYGHVLENIVYLELLRRGYEVTIGKIGSLEVDFVASKPK
FT                   EKIYYQVSATIMDEKTRERELRPLESISDNYPKYILTMDKTVFNDYSGIRVKNIIDFLL
FT                   E"
FT   gene            complement(245828..246376)
FT                   /locus_tag="CLOST_0210"
FT   CDS             complement(245828..246376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0210"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20340"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20340.1"
FT                   /translation="MRKLIVVFAFILALLGSNLTYAEVQDDSIKSDDALKTFMSSKNSK
FT                   LSDQALNNLMKSINKASANYNVDKELIVAVMWQESNFNPSLTYNRCIGAMQIHVNTGKA
FT                   YGYTSEDLYNSDINIDFGTRYLSGHIQSYGGDVLKALSAYNQGTTRVNKGNYSTKYQSQ
FT                   VSAKMETIKTYVATYVASH"
FT   gene            complement(246626..247882)
FT                   /gene="ybbC"
FT                   /locus_tag="CLOST_0211"
FT   CDS             complement(246626..247882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="CLOST_0211"
FT                   /product="YbbC"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20341"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20341.1"
FT                   /translation="MTLAMGSLAFSNPITEDEYSYLREVLLSLNDTQATNPIAEAPAQN
FT                   VVPYYQTVLGNERLLSEYSHLIDGKRVGIVTNHTGVNSKLERTVDVLSAYPKISLTSIY
FT                   SPEHGLDGTVAAGKYVESYTDAKLNLPVYSLYGKTRKPSPEMLTNVDVLVFDMQDIGSR
FT                   TYTYMSTLNYCMIAAKENNKTLIVLDRPNPVGGLNVEGYVLEDKYKTFVGVDNMPMAHG
FT                   MTAAELAQFFNRNIGCKLEIVPMKNYTRAMVWQDTGLPFVQTSPNIPNIESAFAYMATG
FT                   IGDGTGLGQGDKFTWVGGKGFNSQTLANALNAYKLPGIVFVPEDKGDKGGVKLQVTDYH
FT                   SFNPAKTGVYILATANLQKKLTVPVEKNGVIPMFEKNMGGSRFGQDLLNNRSPDQIVKS
FT                   YSNEVENFKNLRKQYLIYN"
FT   gene            complement(248098..249243)
FT                   /locus_tag="CLOST_0212"
FT   CDS             complement(248098..249243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0212"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20342"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20342.1"
FT                   /translation="MEVMKIQDLRYLLENAEHPSVTIYLPTIPGDKDTNRILIKNSISK
FT                   ARDAIKEKDYDVRDIEENLKAFTLMGEDLSFLNAQKEGLAVFINKHELKTYRLPHAFEE
FT                   TVIADNIFHIKPLLPVLTENIDYYILAISKNTLALYSANRFEINPIDIPDMPKNMDEAL
FT                   QYDIDESHLGRRPAKVSGGSLGAATHGENIGDETEKEFVLRYCQIVEKYISTFLNSKNK
FT                   TLVLAGVDYISSIYKEASSYKNISEKTISGNPETMTTSSLRDQAWHIVKPQLLIDSEKA
FT                   VAHYGNLSNTDRTVDSISQIVKASHVQRIDTLFLSKSAEPIPGVYDKENDRVNTDYADP
FT                   HEVQDLIGISVRQTLLAGGKIYYLDHAHMPEHKPIAAILRY"
FT   gene            249525..250229
FT                   /gene="yvrO"
FT                   /locus_tag="CLOST_0213"
FT   CDS             249525..250229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvrO"
FT                   /locus_tag="CLOST_0213"
FT                   /product="putative ABC transporter (ATP-binding protein)"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20343"
FT                   /db_xref="GOA:E3PU82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20343.1"
FT                   /translation="MNTLIKGVNVSKIYKMGEVDIRALSEIDFEIYDCEFLVLLGPSGS
FT                   GKSTLLNIVGGMDSLTSGELYYKGKPIHNGGKKLLTEYRRDAVGFVFQFYNLMPNLTAL
FT                   ENVDLAREISSSPLDSKDMLEKVGLLDRKDHFPSQLSGGQQQRVAIARALAKNPEILLC
FT                   DEPTGALDSVSSREVIRILKEFSRSFEKTVIVITHNASIAQTADRVMYIKDGKIEKVEV
FT                   NKNPIPVEEIVL"
FT   gene            250226..252589
FT                   /locus_tag="CLOST_0214"
FT   CDS             250226..252589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0214"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20344"
FT                   /db_xref="GOA:E3PU83"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20344.1"
FT                   /translation="MTLYKKLFRDLMEHKGANIAAIVVIAIGLMMYAAFAMVMQTLELS
FT                   IDKFYSDSKFPDGFVTVLTMPKSKIADIKDIEGIDQAEGRLREDIRIADNFGTFSTETK
FT                   YLRLVSSNKSVGTYIIEEGKSPRAGYMETVVDPMFADANDLKVGDKIPVIAYGKNVDLT
FT                   ISAIGRSAENVYALRNSSEIYPDPIIFGVGFMDITSLEKLTGKGHYTNVVFTIKDDADF
FT                   DYIKRTIERELRPYGFISIVEKKDQESNLLLTNEMKQLEVSSTMLPLVFLSVSSMILYI
FT                   MIKRIVEQQRGQIGILKAFGYSSLSIRMHYTSYCIVIGLLGGIIGGLFGLIFYQPLMSL
FT                   YMMFFNMPILEGQILVSYLFRSIAISVVFAIFAGYRGSTQALLLSPSEAMREKEPVLGS
FT                   RSLFEKIPLLYKALTTKGKMALRNISRNPARSFFVFVGIAFTFTLSVIPWTFMGQVDSM
FT                   LFERYDDVEKYDVKVALSDLNALESVETELTRHKEVYRAEGMLEIPVFFTNEHIKEPVS
FT                   VIGLKENSNLYTVIDDDKNPVNIYKGGVVLSERLADKLRVKTGDYLTMESPYMRDKDKK
FT                   ESVRVISTVKQNVGINGYMDIEYLSAVLGYSPAANSVLLRAKPNTAAVLKDIYEESPKI
FT                   TGINDTNEMIEKLKKFMGSFMGSMYYVALIAIVMGVAIIYNSYVIILSERKRELSSLMV
FT                   LGMSEKEVLSIVTFEQWFIAIFAMLFGIPLSQSAVTAMGKSASTDMFSLAVKLDLNSLI
FT                   IAFVVTIIAIVLAQVMASRKIKHLNIVDALKSNE"
FT   gene            252600..253835
FT                   /locus_tag="CLOST_0215"
FT   CDS             252600..253835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0215"
FT                   /product="putative Efflux transporter, RND family, MFP
FT                   subunit precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20345"
FT                   /db_xref="GOA:E3PU84"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20345.1"
FT                   /translation="MKKSIKFILIGIIAVLAIGYTVYSMTKPLEVKATKVEKADLISDF
FT                   KEDAIVVSEDSYTISPPYDAKLTFIVEQGANVKSGELIASMDDVDLKNQKSQLSAQLKS
FT                   VGGQQAMSKSPVYDSQVESLNIAIAMGKDQIARLETSYERAKALYDSGAIPKVEFEAAE
FT                   NALHDAKNQVKLKESELALIYESAAEKPGTSTYYSGQKEALQAQIRTIDEKLAKTKIYA
FT                   PASGVITKSNAKSGAFVSTMTPIIELSSATQTVARANVLVQDAAALKLGQNVTVTQKIR
FT                   NEEKHYPGTIVKISDYANTMQSPLGLEEQRVEVDVAFQSEEKLFLGYDLSLTIETMRKN
FT                   SVIALPKTTVFEIDDKKYVWKIDGQTLKKQEVETGYESDFDYEITQSLSEGDLIILDPN
FT                   DAQLEEGKKVKY"
FT   gene            253947..254732
FT                   /locus_tag="CLOST_0216"
FT   CDS             253947..254732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0216"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20346"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20346.1"
FT                   /translation="MQHYSREKKGLKILNLLFYLLMIGANALANTNIFGQATTEEISAK
FT                   YSNLFTPAGITFAIWGVIYIMLGYFVLYQLGKNGYGARKEATEKIGLWFIVSCILNGLW
FT                   LFFWAFDMIGLSMIAMIALLIVLYLIYFRVYTVEAYLYNDEKKGFLLPFSLYTGWISVA
FT                   TIANFAAFVKYMNWNLFNLPEALWVSIGIAVAVLVNLFFITMRKDKAFGFVGIWALAGI
FT                   VYARYLDGNLMPVGYVAGVAIFVLLAVIINSHGRKSHSN"
FT   gene            complement(254910..256847)
FT                   /locus_tag="CLOST_0217"
FT   CDS             complement(254910..256847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0217"
FT                   /product="putative cell division protein ftsh"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20347"
FT                   /db_xref="GOA:E3PU86"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20347.1"
FT                   /translation="MSRKEKLEKIKKKLTKRRISFIIIVMFMVYSLAMYGNIQLQKDKK
FT                   DEVSYIPYTQFQQMIEKNQVEYVFLSSNNSNMQFLPTLEYLNSQKITPDEDYELLLEDL
FT                   DKTKETSVDAKILPKDGKFKFITENPAYPEFRSELLAKGIRVFSFNPPNDLVYFLLSTF
FT                   QIMLPVALIMGFLVFYQRGMDPKENEITTKVPDTNFSNIAGYSSLKNDSKYILDFLENP
FT                   KKYNDIGARLPNGVIFYGPPGTGKTLMAKAIAGEAGVPFFKVNGSDFVELYVGLGARRV
FT                   RKLYKTARKNAPCIVFIDEIDSVGGARGQNRGTSEDDKTLTALLNELDGFSGNEAVITI
FT                   AATNRLQDLDPALTRPGRFDRQLAVPLPDRNERMSILELYVKSKKISESVIIENLAKKT
FT                   IGFSPSELENLMNEAAIKAVINGHEVIEQTDIDEAYLRILIKGDKKDKPLESDSQRKIV
FT                   AYHEAGHAIVGHLLGQPVLEVSIIPTTSGAGGYTLNEPKEGLASKADMKNRVKMLYGGR
FT                   AAETIIAKSEDDITTGAVNDIEQATMIISSIIKSWGMHDSVINLDVLGMSRPNDDYIKD
FT                   AKALAEELFNETKQMLTKNREKLDLIAETLLEVSIIDGEHFIKIMHENKIEHEKITIEE
FT                   ETIESNISEA"
FT   gene            256999..258285
FT                   /locus_tag="CLOST_0218"
FT   CDS             256999..258285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0218"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20348"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20348.1"
FT                   /translation="MRIIDMKGIIKGQDVPKIAYRPVKSLEDRIYFEKVQGTLEEQWTE
FT                   GIYRYDIAEQKLTRVDTGEHSNNPSMYDIEVPGSYEDVLAIKDMDYIYYCVSSEAEKEQ
FT                   ILSFFRLNLESDTQDDIINFSFSKDEYVYKGLEILTEGYFIFTLSDAKTPFESNQYDKV
FT                   YLVDVDERRIYEIHDLLFKLTAGKREVIGKEVKYLLVEEVYLSEEEELELLLSDDVELA
FT                   IDIPEEMTEDFVFKNSLRILPFQNFLNLVKSGSRYYEYKVLDSIFMDGVIRIVGETPNM
FT                   LYYKKNKHEHVLKSSRDFNERRLKGKEEIFSIDKESLNISKIMELGDKSLLAFEDETVY
FT                   EIEEDDEKVKIASTRGDSFSFEYEKDVSDIEAKEYFYDLFNHRYLVIGVIKSKDKFSGS
FT                   FLKIVDMYEIEEDRKCEDLFIIDDTVFIG"
FT   gene            258299..260671
FT                   /locus_tag="CLOST_0219"
FT   CDS             258299..260671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0219"
FT                   /product="DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20349"
FT                   /db_xref="GOA:E3PU88"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20349.1"
FT                   /translation="MPSRIEISVRSLVEFVLRSGDLGASSSFSPTRMQEGIRIHQQLQQ
FT                   IKGRYIEKELPLRLDIKVNDIDFRISGRADGLMLDEGFYIIDEIKSTAKSLSNCEEEEV
FT                   HLAQAKFYAYIYALDNKLDNIGANVTYYSLHDEDIKTFEHEYEREELETYVTHILHSYS
FT                   LFCMLLERLKDERDKSILTLEFPFDSYRKGQKKMINDVYRAISQKKRLFVKAPTGIGKT
FT                   ISTIYPALKSLIYEDNEKIFYLTSKTINREAASDTLMLLKDAGLSVRAIALTAKDKICP
FT                   YGSCDLNACDYARGHFDRINSAIYDILETQDIITRDVILSYSESHKVCPFEFALDISLF
FT                   CDVIIGDYNYAFDPAVYLKRFFAEQMGKYIFLMDESHNFIDRARDMFSASIEKTAFLDL
FT                   RKLIKSAIKDHTMIPKELSDVLKSIGHINAGFLKLKPEQAKTEFSQKALPENLIKAIRG
FT                   FIENSDYYFSEYPNANEEAFYQDLLSLYFEAHAFIRIAELYDERYTMIGYQYDKNLRIK
FT                   LFCIDPSALVKDALSRCTSLIAFSATLIPASYYISMMGGLEDAVYLMLDSPFNPERLKV
FT                   MIDSSVSTRYSHRQRSIDRVVQRIHSAVSSKNGNYIAFFPSYEYMNQIYEEFSKAYEEI
FT                   ECIVQERSFTELQREDFLKRFVDQNTHVMVGFAVMGGAFSEGIDLKGDRLSGAIIATVG
FT                   LPGISYELDLIMEYFNNEGKNGFDYAYRYQGMNKVMQSAGRVIRTSSDKGFILLLDDRF
FT                   LEASYQNLMPREWLDFERVSSPLEIKNSLEQFWQEEK"
FT   gene            260782..261540
FT                   /locus_tag="CLOST_0220"
FT   CDS             260782..261540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0220"
FT                   /product="putative Type IV fimbrial biogenesis protein,
FT                   prepilin cysteine protease (C20) PilD"
FT                   /EC_number="3.4.23.43"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20350"
FT                   /db_xref="GOA:E3PU89"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20350.1"
FT                   /translation="MGILVFLYGLIFGSFYNVVIYRIPADKSIAKGRSMCGSCNHTLAA
FT                   KDLVPVLSWVFLKAKCRYCGSKISMRYPIIELVTGLLFYIAYASSGSIWEFLFYVSLWS
FT                   MLLITAMIDYDEMIISDAVLLVFTVVGLVSILGMKAGLLTRVYGLAFGFGFYFAIYYVA
FT                   KLIYKKEAFGFGDVMLMGALGIFMGFRDTVLTSILSFYVALIIIVIMKIFGKKTGLRQE
FT                   IPFGPYICIAAFLVSLYGDEIVNLYLNLFM"
FT   gene            complement(261615..262424)
FT                   /locus_tag="CLOST_0221"
FT   CDS             complement(261615..262424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0221"
FT                   /product="Metallophosphoesterase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20351"
FT                   /db_xref="GOA:E3PU90"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20351.1"
FT                   /translation="MKKKKRLYPLLSLMLLLPFLLYHGNNALDITTFEIPYDELSGLRI
FT                   LHLSDLHNKSFGKNQEKIIEKINEIKPDLIVFTGDLVDGRRKGHQNALTLMDALSKNYT
FT                   VYRVNGNHDFGDNGYALKSKLDELHIVTLENACDTYYYNDIPVQIKGVDDPISYDRASR
FT                   ETEFKNSLEILDDMVYNILLSHRPEHFNDYVESGYDLVLTGHAHGGQLRLPMLGGVIAP
FT                   HQGILPAYDAGAYTSGPTTMIVSRGLGNSLFPFRMFNNPELVVIDFK"
FT   gene            complement(262425..263273)
FT                   /locus_tag="CLOST_0222"
FT   CDS             complement(262425..263273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0222"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20352"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20352.1"
FT                   /translation="MNEIDYRAIYKSDLYKKLVLRLLSLTAAILLVFTSTSYAQMPSPT
FT                   TEFYHADYAGLLSEDVKTFIRSVNLNYEALEEKPQVVVATVPDMGGLDIETYAVELFEK
FT                   WKIGDSKLDNGVLIVLALEERKIRIEVGYGLEGAITDGTVGQILDRATPFLSEGDYNKG
FT                   LLQIFYDVTDRVNLEYGYDSEKIYTNIVERPIAEPMSDDDDSSFLSTGIILFILFLIIV
FT                   GNGGGRGGRRRSYRNSSPFGGGGFGGFPGGFGGGGSGGGFGGGSFGGGGSSGGGGGSRG
FT                   F"
FT   gene            complement(263290..263865)
FT                   /locus_tag="CLOST_0223"
FT   CDS             complement(263290..263865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0223"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20353"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20353.1"
FT                   /translation="MKKGILGVIIALVVIAGLLVMPLIGSYNNLVTLSENADQQWANVE
FT                   TVLQRRYDLIPNLVESVKGAMAQEQEVFGQIADARAAMAGASTVDEQVEASNQLEGALG
FT                   RLLVVMENYPELRSNENVTRLMDELAGTENRISVERGRYNETVADYNRKIKRFPTVIIA
FT                   GMMGFDERAYFEAADGAETAPKVDLTNP"
FT   gene            264214..267570
FT                   /gene="addB"
FT                   /locus_tag="CLOST_0224"
FT   CDS             264214..267570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="CLOST_0224"
FT                   /product="ATP-dependent deoxyribonuclease (subunit B)"
FT                   /function="16.6 : Maintain"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11544244, 16385024, 16780573, 7746142, 8387145, 8510642,
FT                   8752323; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20354"
FT                   /db_xref="GOA:E3PU93"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20354.1"
FT                   /translation="MIKIITSRAGYGKTSSLYKEILEKDKNAEVAYLMVPEQFTLQSEL
FT                   ALMDKVDSKGLIYAQVMSFERLSRLVLSRVGGLKRPYIDEIGKHMALRLIFDKHEDSLP
FT                   MYKTAYKKEGFLSELSHTLSELKKMAVPPSLLLDKSNQIENNALLKQKLFEIGFIYNEF
FT                   LNYMQDQYIDNEDRISLLAEKINLYKEISNASFYFDSFTGFTALELSVIEQLAQMGTSL
FT                   CFALTYDETSADKDVFSPTSLTINQLKAIAKATGSEFEIEALVNESTKSKEIRYIEKAL
FT                   YDYKAPSYKEKIKDVKLFEALDMEKEAEHCALEVLSLVRDFGYRFKDILIITPMPHLYA
FT                   GPISRVFTRLEIPHFIDVKRDIMSSPLITLIFSYLDMHIKNLRYEDVFSFLKSGFTQLD
FT                   ESQYMPLENFVLKWGIKGRMWLDENRFSEERFFDQYDSSEYKEKIKTAKDYLVSLFELN
FT                   KKSFKGSGTGPSYAKALFGFLTEIKAQDQLEIFVNRLREENAFDYANENAQIWNIILDT
FT                   LDQLVEIMGEKPMSLEEFRNILYEGIKQHEIGIIPPALDQVIVATLDRSRSTAIKALFF
FT                   MGLNDTYVPHVGKDSPILLDDDKKKLKDLGVNLPSELDNAMSDETLSIYSALSKPNDKL
FT                   FLSYSLSGGEDNKALRPSTIINRLKTLFPNLHERSSLSDTSVFSYISTPDYSFGKLAGE
FT                   LRDLVEEKHLDKDWLSLYSWYIDNDGWEARRQRLLDNLFYKNQQEYITPTQAKQIYEAP
FT                   FKASVSRLERFAKCPFDHFVQYGLKPEPRKVHEIGPPELGTIFHSAIEDFAKLANNKAS
FT                   LPLLLDKKTCDEQIDKLIENCVSDHIKILMDNSKRNAYMMKKIKKVGRRAAWTMVNQMS
FT                   KGRFEPYDFEMKLPPIVLDLGEYGTIELTGQIDRVDILDENEKTYVKIIDYKSREKKFS
FT                   LSDAYNGLDIQLIVYLESVLEHLPSLKKTKAYPAGAFYFPIVDKLIESDLTDVEEIEKQ
FT                   IAGKLKMQGIVLKDINIIKAIDADIENEGSVIDVRVKDEDIKSENALSEEEFTALLDHV
FT                   MELVKDMSKEILAGNISIHPYSDKQKAQCSYCEYSSMCKFDTLFEGNTHKTVKALKDKE
FT                   VKELLMKKEGI"
FT   gene            267571..271125
FT                   /gene="addA"
FT                   /locus_tag="CLOST_0225"
FT   CDS             267571..271125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="CLOST_0225"
FT                   /product="ATP-dependent nuclease, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20355"
FT                   /db_xref="GOA:E3PU94"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20355.1"
FT                   /translation="MAWTDAQQSAIDSRGENLLVSAAAGSGKTAVLVQRIIDIVLNEKV
FT                   DVQNLLIVTFTNAAAAEMKDRIQKMLMQRMLDNPQESHYLTKQIQNLPRASISTMHSFC
FT                   IDILRRNFHMLDLDPSFKIANNALVSIMKTQAMESLFDEAYDSDDVLFLSLVDSYGGTK
FT                   DDKKLSDLIDKVYNFIQSQPYPLKWLESEAESFNISSFDELSTSKWMQVIKDDIRIKLD
FT                   AAYDAGKKAIELCKLEGGPLPYLAAIEDDLLLIDDLKSKLEQSFADFIQAIAEVKHSRF
FT                   AAISKKMKEELDVALVDEVKAIRDTDIKASGIKAIQKSIKNISQGFQLEDIKNLYPLMK
FT                   ALYKTVARYDELYSEIKLANSVLDFSDLEHYALRLLENEAVREDLRAKYTYIFFDEYQD
FT                   SNIVQETIISAIKREDNLFLVGDVKQSIYRFRLADPTLFIDKYHSYAKADDRPNKRIDL
FT                   SNNFRSRPAILEFINDIFSAIMNEDLGEVAYDDSAKLIPGMDFPVEKNKVELVVLENHK
FT                   LEEDDELAEDADMDNPELEAMYVSSRIKELLGKEHYNPKAKEFQKITYRDIVILMRSPK
FT                   SSIAAFEKVLKDDRIPCYVDYSASYYDVLEVKLFIDLLKIIDNIEQDEALLAVMNSSIG
FT                   GFSLDEIIEIRVAYKKGAIYQALLSYMADNDNELSIKINTFLDRIKTYRFKEKLQRLDE
FT                   FLWYLMNDTGYYSDLAAMPGGQMRQENLKALLDKASEFQSNTTNGLFNFLHYIDKLLKD
FT                   KGDTQEAKALSESEDRVRIMSIHKSKGLEFPVVFVCGLSKGFNKADFKQDIMLHNSLGI
FT                   GPKYVDLDKNVYRESLPKTAIKIQSNKEMLSEELRILYVALTRAVDTLIMVGSVKDIEK
FT                   LATRASKSTSTSYLLSQSNYLSWMLIALYKHRDASALRDYAVREVIEDDTSYKSSFKLS
FT                   LVAKYDLLKLSQREREDIDNMEAILRDYKADSSETLNPEVISVINSRFSYEYPYKEQTM
FT                   QVSKTSATMLAKSVLDASKISVVIQSMPRFMQKVKTFSASQRGTLMHFAMQNINLNQVA
FT                   SPSEIEDQLDMMHVNELLTSEERASLDSEMLYEFFCSELGKRMRRSKNVIRENSFMLKK
FT                   DEVLVSGVIDSYFEEDGEWVLVDYKTDYLGTDSKKDKAEMYRPQLELYKEALESSTDKP
FT                   VKEAYIYLFDIQEAVRVI"
FT   gene            271273..272157
FT                   /locus_tag="CLOST_0226"
FT   CDS             271273..272157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0226"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20356"
FT                   /db_xref="GOA:E3PU95"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20356.1"
FT                   /translation="MEKIAIITDSTSDLTQDIIDKYDIKVMPLQIIYQSKIYRDKVDIT
FT                   PEQIYSGMEREVPKTSLPLTADVVKTFEQLKQEGYTHILGAFISSGLSGTYNMVRNMAN
FT                   DYKDDFVIELIDSKNISWGSGFGIVDAAKAREAGASFEDVVAAAKKAIKNTRCVFVLPT
FT                   LYYLKKGGRMGRVEGTVGDLLNIKPIVGVDEAGDGQYFTIKKVRGRKKSLTELFNVIHN
FT                   LVKDKEAFEVIVLSGNAPEESTEIAEKFKAMPNCKYVLETSVSPVIGVHTGPGLLALSV
FT                   KCDSGMDNIKEDK"
FT   gene            272245..272661
FT                   /locus_tag="CLOST_0227"
FT   CDS             272245..272661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0227"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20357"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20357.1"
FT                   /translation="MEPFAVILMRKDSETGFFESEVGSYNIPSMGEYLESIFVIDKEEE
FT                   DMVHLRITTATPVKDWEYSAIYDYYDEDRVSALDFVIKVEPIEDDYDPLWEVTFKLLDN
FT                   IEETEEQIQKILETHHIELQEVMQEIKDKEEEYK"
FT   gene            272881..274041
FT                   /locus_tag="CLOST_0228"
FT   CDS             272881..274041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0228"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20358"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20358.1"
FT                   /translation="MITNGFTFVAFLVLLAGIIVIVEKKSNSKIFNYIPGVVMLYFFAM
FT                   LLATFGLWEKTDSVNTYYKGVKDNLLPAMIFLMLLRCDLRKIFKLGPKMLIGFFSASIS
FT                   IGVGFVVSYAIFKGFFPADTWKSFAALAGSWMGGTGNMAAIQGALNVPDSAMGYTLLID
FT                   SIDYSIWVMILLALVPFGHLFNKWTKADTKVIDEIGRELEKDKENMRTTIEFSDMIILL
FT                   GSSLMVSSLSQALSVHLPQSDFLTVGTWTVIIATVIGVLCALTPFGKLPGSSQISNVML
FT                   YIIIGLIASRANFAELTQAPIYIVAGFVILIVHAVVLAIIAKIFKLDLFTCGVASLANI
FT                   GGVASAPILAASYSEALIPIGVLMAMLGYVVGTGGGLFVGKILSML"
FT   gene            274069..274398
FT                   /locus_tag="CLOST_0229"
FT   CDS             274069..274398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0229"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20359"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20359.1"
FT                   /translation="MYPDTTVYIIGHARTQADNAITEHFKGFFIGVVVDYITDEIVDIS
FT                   CSSTIPTTEKFIQSLFINKKLDKYYGEIDRQIEQRYFGTSQKALSTAYKDAVKRYAEVK
FT                   EKYYK"
FT   gene            274401..275504
FT                   /gene="ykfB"
FT                   /locus_tag="CLOST_0230"
FT   CDS             274401..275504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfB"
FT                   /locus_tag="CLOST_0230"
FT                   /product="putative muconate cycloisomerase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20360"
FT                   /db_xref="GOA:E3PU99"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:E3PU99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20360.1"
FT                   /translation="MEASMKITDIELYSISVPLRTPFKTALRTVNAVEDIIVKINTDEG
FT                   VCGYGEAPPTGVITGDTSGSIIAAIRNHIEKAIVGMDIEDFEEIMEKLHKSVIGNYSAK
FT                   AAVDMALYDLFGQKWEIPLYKHLGGSKKEIITDITVSVNEPEEMAADALDAVNKGYKTL
FT                   KIKVGKDSKKDLQRMQAIRDAVGYEVDLRIDANQGWQAKEAVKVLRQMEDKGLMIEFVE
FT                   QPVAAHDFEGLKYVTDNVSIPVLADESVFSPMDAVKIMQLRAADYVNIKLMKCAGIHNA
FT                   LKITALGELYGVECMIGCMLEANVSVTAAVHLAMAKNIITKIDLDGPVLCSENPVVGGA
FT                   IFDNYRINMSDGTGLAIKGIQNLQKIN"
FT   gene            275789..277420
FT                   /gene="hcp"
FT                   /locus_tag="CLOST_0231"
FT   CDS             275789..277420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcp"
FT                   /locus_tag="CLOST_0231"
FT                   /product="hybrid-cluster [4Fe-2S-2O] protein in anaerobic
FT                   terminal reductases"
FT                   /function="6.3 : Anaerobic"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10651802, 12374823, 99310594; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20361"
FT                   /db_xref="GOA:E3PUA0"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20361.1"
FT                   /translation="MYCNQCQEAAKGYACTSVGVCGKKNDLANMMDLLIYSTEGISLYA
FT                   QELRAKGQKIDPKVDLFIMESLFATITNANFDDEVIIKRVKDALVIREELKKQLGAEIN
FT                   HPTATFTAATLDEMNSLAQKVGFLSIENEDVRALKSLILFGLKGLAAYYHHAHNLGHND
FT                   EKLDNFMEEALVVMTREDMSADELTAYVLKTGEFGVTAMALLDAANTSTYGNPEITTVN
FT                   LGTRNNPGILISGHDLKDMEELLKQTEGTGVDVYTHGEMLPANYYPAFKKYEHFVGNYG
FT                   GSWWSQNPEFESFNGPILFTTNCIVPLKSNNTYLNRMYTTGASGYPGAVHIPDREDGKA
FT                   KDFSAIIEQAKKCAPPVQIEEGEIVGGFAHNQVIALADKVVDAVKTGAIKKFFVMAGCD
FT                   GRFKERSYYTEFAEALPKDTVILTAGCAKYRYNKLNLGDIGGIPRVLDAGQCNDSYSLA
FT                   VIALKLKEVFGLEDINELPIAYNIAWYEQKAVIVLLALLYLGVKNIHLGPTLPAFLSPN
FT                   VANVLVNNFGIAGIGTVEDDMKVFLG"
FT   gene            277583..279142
FT                   /locus_tag="CLOST_0232"
FT   CDS             277583..279142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0232"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20362"
FT                   /db_xref="GOA:E3PUA1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20362.1"
FT                   /translation="MADMDLSKFEKKIVLRNIEEKDIDEIIELSLICFPDMKPWTKEQL
FT                   RSHLRYFPEGQFCIEYEDKIIGSCSSLIVNFDEYDVQHTWDEITDKGYIRNHDSKGYNL
FT                   YGIEVMVHPEYRRMKIGRRLYDARKDLAVRLNLKSIVIGGRIPNYHKYSEDMTPREYVE
FT                   EVMAQNIYDPVLTFQLMNGFVLKRINNNYLKDDFNSMKYATLMEWSNIDYRPMTKRTYK
FT                   TSFPVRVFVVQYMMKQINSFHDFAHQCEYYVDISSDYKSDFIVFPEIFTTQLLSFIEEK
FT                   TPSLAIRRLTRYTEDYIKLFTELAVKYNVNIIGGSHFVEEDGDIYNIAYLFRRDGTIDK
FT                   QYKLHITPNEERWWGIQPGHEIKIFDTDCGKISILICYDMEFPELSRIVAEKGANIIFS
FT                   PFCTDDRQGYLRVRYCAQARAVENQVYTVIAGTVGNLTEAENMDIQYAQSAIFTPSDFG
FT                   FPRDGIVAECTPNIEMVIVGDLDLEILRRSRSTGSVMQFNNRRTDLYEITVKEGKNPRI
FT                   SK"
FT   gene            279379..279864
FT                   /locus_tag="CLOST_0233"
FT   CDS             279379..279864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0233"
FT                   /product="Citrulline cluster-linked gene"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20363"
FT                   /db_xref="GOA:E3PUA2"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20363.1"
FT                   /translation="MQKLNSKKMAMIGATAAIYAVLTVAMAPISYGAVQLRLSEVMTLL
FT                   AFVDPVFIPGLVLGNFIANLFSPFGLPDVVFGTLATFIAVFMMSKMKSMLIASFWPTIA
FT                   NGLIIGLELAIFTGAPFVSTALYVALGEFLVVTVLGYPVFKVVMKNKTIQNLTQVTD"
FT   gene            280336..282339
FT                   /locus_tag="CLOST_0234"
FT   CDS             280336..282339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0234"
FT                   /product="Methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20364"
FT                   /db_xref="GOA:E3PUA3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20364.1"
FT                   /translation="MKMNLKSKIVIMLIILITLPMFVMGLRSTRLAEEKMLEQYLASMQ
FT                   EINNATTTSLENVLEGNAKSLQLHAGNFNLRNILVDPTTEAYLVDAIAAYRDVNPNVLN
FT                   SFVGTREKKMYISPYIELPADYDPTTRGWYQAADATDEVIWTDPYVDAGTGETVITAAI
FT                   KIPPSTDGTSPGITGIDLLLSYFSELVGQVKIGETGEAYIIAKDGMIFAHPNPEMIGKN
FT                   IKDIGFTDETLNTYFETGSGTLDYTDEATKDERFIVYQKFTTADWILVNSVSYKEITAV
FT                   TDQMTMNIITIGIISLIVAILIGVFATGFVTKAVKEIEQKMKLVADGDFTVTMDVKSND
FT                   EIGSLGKSFNIMIAEVKDLMTATIGVSEEVLKASENLAAFAEQTSAASTDVANTVDEIA
FT                   RGASDQAEETETGVQIANSLSEKFEGLADNSKEMNMNAQSTLEVNEDGIKTLEELKQAS
FT                   KVSLESNDRVEKAIVDLDKSATSINAILETITSIASQTNLLALNASIEAARAGEAGRGF
FT                   AVVADEIRKLAEGSDNAAQEIKIILDKIQNESKHTVNIMQEVKGIYVEQEMSVEKVNSA
FT                   FGEISASIGKVAQRIEEMTSQVEGLMTEKEKIVSTMENISAVSEETAAASEEVTASMQQ
FT                   QSDAVEQVAQSASGLSSLAAELMEKLSHFKIQ"
FT   gene            282656..283627
FT                   /locus_tag="CLOST_0235"
FT   CDS             282656..283627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0235"
FT                   /product="Cell envelope-related transcriptional attenuator
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20365"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20365.1"
FT                   /translation="MKKILKYLIIILTILIVIAAAGFFAFQQYYHNTSYEEFEAVDTTE
FT                   QSEEEKEQSELDEKYGKLKRVNILVAGIEGERTDTLMVFSYDKEANIIDIISVPRDTYV
FT                   DYGYEDAGRRKINAVYGYPGAKGGIKATANVVSKVLSVPIHEYITVDYDGVEDVVDAIG
FT                   GVEVDIPFNMRYDDPYAEPPLHINLKKGEQLLDGEKAIQFLRWRKNNSGTLGAEGDIGR
FT                   IKRQQEFVISAIKKGIQPSNLTKAITIGLKNTKTSMDLKEAMYFGTKLAGLKDENINAY
FT                   SVLGEDEIIDGIWYFKHDAKATKELIRNLYLGIKPITDDQQD"
FT   gene            283667..283966
FT                   /locus_tag="CLOST_0236"
FT   CDS             283667..283966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0236"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20366"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20366.1"
FT                   /translation="MNENVKIFIIATLVIAFVLFLPSLIESAKLLSPEAGFADEKAAEE
FT                   ILDDKSNNENQPILEDDEKEEDKEEDEILPEEEVPQEVMPADEFDMKILPDDDN"
FT   gene            284005..285222
FT                   /locus_tag="CLOST_0237"
FT   CDS             284005..285222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0237"
FT                   /product="putative permease (Major facilitator
FT                   superfamily)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20367"
FT                   /db_xref="GOA:E3PUA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20367.1"
FT                   /translation="MKEKLSSNIKSYLTANFLLSFSAGVFSMYVGIFLKESGYAEDFVG
FT                   NMLSVHTLSTALFSLVGAFLIGQIGSKKSFMLGSLAVFLGFALMGNTVNPYLLIFSGIL
FT                   SGLGFSMKSTGEAMFLSENSSASQRVLVFSLNFTVMNAGFTSANFLGGLLANYLSIKIP
FT                   YIEAILAVIALGGAFAIVSFIPILTIKQNQITKRRNLGQYLVGYKNILANRSALDFLIF
FT                   NAVIGMGAGMVVPFFSIYLKYALDIQDAVVGGILSFSQFGCVLGGMLIPLMAKKLGEHK
FT                   SVVVCQLFSIPFLISIAFPQGIMFVAISFFMRSSLMNMGTPIIQNLGMNLVHPLDRANL
FT                   SSLMSLSSNLTRAIGIAIGGYIMHRYDYNTPYYFTVALYLVATVLFIKLYQSEFIKKSP
FT                   CPDKVT"
FT   gene            285269..285607
FT                   /locus_tag="CLOST_0238"
FT   CDS             285269..285607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0238"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20368"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20368.1"
FT                   /translation="MKLANPLWFKIVLCIMFIMYTVTLIPYITAWNSIAYHLGIYGTVF
FT                   FICYLMILISIGMMLRGFRTGYYIFLGASALIPVIYLLQGTNFSLEQAILRPVIFCGLV
FT                   ALGVNSKK"
FT   gene            285722..287056
FT                   /locus_tag="CLOST_0239"
FT   CDS             285722..287056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0239"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20369"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20369.1"
FT                   /translation="MKKIKPVLLAMAVALVFTGCTNIATPEELIEPPELNLEKQSMKEA
FT                   LEKFLPEDSTTTALPNLDGVDKEMAFSPIDLNDDGQLEMIAFYKDKNTKLMGMLILSNK
FT                   RDKWEKISDIKLNSFDILQFKVLDLDNDKNKEIVLGTYSDESISYGKKLTILSFKDNKV
FT                   TPILEMPYAGMALGDLDKDDSYEIAILYQNEEMIENRLRMMRVAGNKVSRIDEKIFPQG
FT                   VDPYSIAIGNIYDDEEVIFVDSFSGIYEGRTDIFFFKDKKIKDIEDYKGFKLSDKSFPV
FT                   QTKDVDSDGIMEVGIPFSPPDNDQLYDPLKPWVKSYYKINKDSTMSLVKQIYEDYKMSF
FT                   LFEIPDSFENNYSITGNETSDKIEINFIASDKKAYKLAEIKMINKTKWQETDEVLQIIS
FT                   ETNDDITGGKVEDLSNQLTGKDKEQYIKMRSDILNLSNVTKPSGI"
FT   gene            287079..287765
FT                   /locus_tag="CLOST_0240"
FT   CDS             287079..287765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0240"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20370"
FT                   /db_xref="GOA:E3PUA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20370.1"
FT                   /translation="MVLEDEYAIRSFVTLNLKREGYEVIEAESGEQAIELYNANPDIKV
FT                   AILDVMLPGIDGFEVLKYLREKNPQMGVIMLTARTHEQDKVLGLEYGADDYISKPFSPT
FT                   ELVARIRSLIRRLTSNHIEEKQDVLKSGPFTLNLSDRKFYKGDEEIELTPKEFEILELF
FT                   LKNAKKSLSRDQILNEIWGKNYFGDLKVVDVNMRRIRKKIEDDPAEPRFLKTVWGYGYR
FT                   WEEDGI"
FT   gene            287734..289158
FT                   /locus_tag="CLOST_0241"
FT   CDS             287734..289158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0241"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20371"
FT                   /db_xref="GOA:E3PUB0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20371.1"
FT                   /translation="MDIGGKRMGFKSSIRSRIIINFGAIVIATVVVLEVLFVAFVQNYY
FT                   YGGVEQILKDRVNISAEFLNRYFTYSSVEEKAKFLFENNISSYDNKFLVQILNKEKIVV
FT                   MDSNGLSEFSVLETDDINDAFNNKITIYESYSEMTGERMLSASRPLLKYNQIDGVIRYT
FT                   VSMEKVDREVKNYILGGLALGATVIIFFMLLALIISKSIVNPIMKLNVVAKSMAEGNFD
FT                   QKAKKIYDDEIGQLTETMNYMAEEILKTDKIKKDFISSISHELRTPLTSIKGWSETLMM
FT                   EESVSQNEALGMGLGIISGEADRLKDMVEELLDFSRLESSRMKVVKRKINPKHVLEQVY
FT                   RQLQPRAAHITLSCNKIGKDTMIMGDENRLRQVFINLLANAIKFTPAGGSVQIEAEGQD
FT                   EQIIIRFIDTGLGISKEDLPNVTQKFYKGNQTMAGSGLGLSIVDEILKLHDAKFYIDSK
FT                   LGEGTTVTVIIPAVTE"
FT   gene            289369..289713
FT                   /gene="ypfE"
FT                   /locus_tag="CLOST_0242"
FT   CDS             289369..289713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypfE"
FT                   /locus_tag="CLOST_0242"
FT                   /product="putative carboxysome-like ethanolaminosome
FT                   structural protein with role in ethanol utilization"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20372"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20372.1"
FT                   /translation="MQDKARIIQEYVPGKQITIAHVIANPKPEVYKKLGLDEHQKGAIG
FT                   ILTITPAEGTIIAADIASKAASIDIGFIDRFSGALLITGDVASVESALSEIINGLFNIL
FT                   SFAPTTITRT"
FT   gene            289739..290170
FT                   /gene="eutP"
FT                   /locus_tag="CLOST_0243"
FT   CDS             289739..290170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutP"
FT                   /locus_tag="CLOST_0243"
FT                   /product="Ethanolamine utilization protein eutP"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20373"
FT                   /db_xref="GOA:E3PUB2"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20373.1"
FT                   /translation="MKKVMIIGRSGSGKTTLIHNILYGKSNAKKTQSIERLHNLIDTPG
FT                   EYIENPRLYRAILLTSYDVDSVVLVIDSEEDSSIFPPEFASAFNREVIGVVTKIDKKKD
FT                   FCRAVEFLEKAGVKKIYYTSSKNLTTIEELKNYLLEEGV"
FT   gene            290174..290776
FT                   /locus_tag="CLOST_0244"
FT   CDS             290174..290776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0244"
FT                   /product="Ethanolamine utilization response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20374"
FT                   /db_xref="GOA:E3PUB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20374.1"
FT                   /translation="MKESSEMISKNILIAEDELITRMDIAEIIKEAQHNVVGEASDGFD
FT                   CIELCRKHRPDLVIMDIKMPILDGIKASKIIMEENIAGCIVLLTAYNDKEYVEEAKKVG
FT                   VMNYLIKPIDEKSIIPAIEVALSRNEEMRAMKSEVEKLEKKLEDRKIIEKAKGIIMHRE
FT                   KISEEEAYCMLRNMSMKKRCSLRTLAEIIVKTETVAV"
FT   gene            290820..292238
FT                   /locus_tag="CLOST_0245"
FT   CDS             290820..292238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0245"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20375"
FT                   /db_xref="GOA:E3PUB4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20375.1"
FT                   /translation="MIRKLCEKFTTLNESDIQLLYNVNEFLPLISQVTNGDVFIDCMTR
FT                   EPDTAIVVAEAKKKKSLYKKNVVGEFALRENEPAVLRTMDTGLTTRELKGISQENIPIE
FT                   QSVTAIKNGDKVVGTLIVEKDATKDFAERRNIEILSETAQQLTQALMFHNRGEEHKIDY
FT                   ITNYVTDGIMIFDKEGVVIYANPMAISIYKKIGYKDDIIGMHFDNVALDEKTFKDVTET
FT                   TYMEVPEIHIGKLNLNVQYSVLKNKDDDQRLVVLIRDMTELRNREKELILKSVAIREIH
FT                   HRVKNNLQTIASLLRMQSRRITDDQAKKAFSESINRVLSIAVTHELLAQNGVDDVDIKD
FT                   ILTNLVQNTIYYNSKPSTNIKVEITGDNFSIDSDKATSIALAVNELVQNCMEYAFPNRK
FT                   EGNIRIHIEKDELYSKIIVADDGVGFDKTERPAGSLGLNIVEGLVVEKLDGSFEISSSP
FT                   FGTQVEIEIINKCR"
FT   gene            292257..293702
FT                   /gene="eutA"
FT                   /locus_tag="CLOST_0246"
FT   CDS             292257..293702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutA"
FT                   /locus_tag="CLOST_0246"
FT                   /product="reactivating factor for ethanolamine ammonia
FT                   lyase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="12.3 : Protein interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10464203, 15466038; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20376"
FT                   /db_xref="GOA:E3PUB5"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20376.1"
FT                   /translation="MKETLISVGIDVGTTTTQVIFSNITIENMSSGARVPEFKIVGKEI
FT                   FYKGKIHFTPLRSNTEIDETALKEIIEREYKNAGINPDDIDSGAVIITGETARKENAQN
FT                   ISKVLSGYAGEFVVATAGPDLEGIIAGKGSGAAKLSYENNDIVANFDIGGGTTNIAVFS
FT                   QGEPIDTTCLDLGGRLLRFDKSGLVEYISPKLADICKEVNINIEKGKKYPDEVIRKICR
FT                   YMAEILLEVSGVRPRSRLLELTLSPKSTALRLDYKIDRVSFTGGVADYIYNNQAETDLY
FT                   KFGDIGILLGYEIKAILNEFASKVIMPEETIMATVVGAGTQTMDISGSTISYSQSAALP
FT                   LKNIPIIEITEKEERVNEEELEKAIMAKLQWYCLETQKQKVALFLKGERNVSFEKVTSI
FT                   SKVIAKVWEEFYPHGEEVIVVIENDMAKVLGQSISRKLSNKQREVVCIDGIKVSSGDYI
FT                   DIGKPIGNGSVLPVVIKTLVFNY"
FT   gene            293718..295085
FT                   /gene="eutB"
FT                   /locus_tag="CLOST_0247"
FT   CDS             293718..295085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="CLOST_0247"
FT                   /product="ethanolamine ammonia-lyase, large subunit, heavy
FT                   chain"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.3.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10464203, 3905806; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20377"
FT                   /db_xref="GOA:E3PUB6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20377.1"
FT                   /translation="MRLKTKLFGSVYQFASIKEVLAKANEEKSGDVLAGVAAADHLERV
FT                   AAKEVLSNLLVSDIRNNPVVPYEEDEVTRIIQDDVNESIYKEIQNWTISELREWILDNN
FT                   TTGEQIKRISKGLTSEVVAAVAKLMSNMDLVLGAKKIRVSAHCNTTIGLPGTLSIRLQP
FT                   NHTTDNLDGIAISTYEGLSYGAGDAVIGLNPVDDTVDNVSRILNLFNDIKNKWEIPTQI
FT                   CVLAHVTTVMESVKKGAPTDLIFQSIAGSQKGNEAFGITADMLQEARELALKYGTASGE
FT                   NVMYFETGQGSELSSEAHHGADQVTMEARCYGLAKRFKPFLVNTVVGFIGPEYLYDSKQ
FT                   VTRAGLEDHFMGKLTGISMGVDACYTNHMKADQNDIESLSVLLTAAGCNYFMGIPAGDD
FT                   IMLNYQCTGYHEAPSLRELFDLSPTKEFAAWMEKMGITENGKLSSRAGDASIFLKK"
FT   gene            295097..295981
FT                   /gene="eutC"
FT                   /locus_tag="CLOST_0248"
FT   CDS             295097..295981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="CLOST_0248"
FT                   /product="Ethanolamine ammonia-lyase light chain
FT                   (Ethanolamine ammonia-lyase small subunit)"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20378"
FT                   /db_xref="GOA:E3PUB7"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20378.1"
FT                   /translation="MISEKDLKCLIEKVMTEYAKENSNLNDMSSASPKIEDNIDDSDIK
FT                   DITAKPIQEIFYVPNPENKEEYMKLKAKTPARVGVWRAGCRYTTETMLRFRADHAVAMD
FT                   AVFNDVPEDFPAELGLFSVKTKCKDKDEYLTRPDLGRVFDEENINIIKEKCKKNPKVQV
FT                   YVSDGLSSTAIEANVKNTLPAIMAGLKDYGIDVGTPFFVKYGRVGAMDAISEAVGAELT
FT                   CVLIGERPGLATGESMSCYMTYKAYPGIPEAKRTVVSNIHKSGTPSSEAGAHIADILKK
FT                   ILENKASGVDLKL"
FT   gene            295997..296650
FT                   /gene="eutL"
FT                   /locus_tag="CLOST_0249"
FT   CDS             295997..296650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutL"
FT                   /locus_tag="CLOST_0249"
FT                   /product="putative carboxysome-related structural protein
FT                   with role in ethanolamine utilization"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20379"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20379.1"
FT                   /translation="MKNDALKTTILSMKVISNVDESMVREFTLPQGHKSIGMFTADCDD
FT                   VSYTALDEATKKADVKVVYAKSFYGGAANANTKLAGEVIGIISGPNPAEVKSGLNAIVD
FT                   FIESGVSFTSANDDDSIAYYAYCISRTGSYLSEVAGIQEGEAIAYLIAPPLEAMYALDA
FT                   ALKAADVRMAAFYGPPSETNFGGGLLTGSQSACKAACDAFAEAVKFVAENPTKF"
FT   gene            296676..297182
FT                   /locus_tag="CLOST_0250"
FT   CDS             296676..297182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0250"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20380"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20380.1"
FT                   /translation="MKNKALGLIETYGYIGAIEAADTAVKAAYVELSAVEKVKGGLVTV
FT                   QLLGDVGAVKAAVDAGVQKCKALGVYVSSHVIARPDSELYKIVPKLNSDEAIETIKEAD
FT                   KLETSEPEFKLPKHFYTMKVVLLRNYVRKLDNFPIPNKKIKFANKQQLIDGLIEYYKTK
FT                   PMTKE"
FT   gene            297211..298695
FT                   /locus_tag="CLOST_0251"
FT   CDS             297211..298695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0251"
FT                   /product="Acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20381"
FT                   /db_xref="GOA:E3PUC0"
FT                   /db_xref="InterPro:IPR013357"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20381.1"
FT                   /translation="MEYEMDKDLRSLQIVRDLVKKAKIAQKMFREYDQIHVDFIVDELA
FT                   KSAEKNSVKLAEMAVSETGYGNVKDKTTKNVFASRILHEYIKNMKTIGVIHEDEQHGIV
FT                   EIGVPFGVIAGLVPSTNPTSTAIYKALISLKAGNAIIFSPHPAALCCIMEVVDILRETL
FT                   KKNGFPEDLISCISVPTMEATDALMKHQDVSLILATGGSAMVRAAYSSGTPALGVGPGN
FT                   VPAFIEKTADIKMAVSRIIAGKIFDNGVICASEQAVVVEREIYKEVKKEFINQGCYFVN
FT                   EEEKLKMEKIIDTPYGSLNAKIVGKTASQLADMAKIEVPENTKIIIAEETGVGKGYPFS
FT                   REKLSPILAFYVEDDWKKGCDKCIELLDYGGMGHTLGIHSNDKDIIMEFALRKPASRII
FT                   VNSPTTHGAIGATTNLAPALTLGCGAVGGSATSDNVSPMNLINIRRLAYGKSEAEDLKP
FT                   RELVNSSCQTPNISQINDTEKLVKTVVDLLMKQLSH"
FT   gene            298729..299022
FT                   /gene="cchA"
FT                   /locus_tag="CLOST_0252"
FT   CDS             298729..299022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cchA"
FT                   /locus_tag="CLOST_0252"
FT                   /product="putative carboxysome-like ethanolaminosome
FT                   structural protein, ethanolamine utilization protein"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20382"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20382.1"
FT                   /translation="MANANALGMIETKGLIGAIEAADAMVKAANVTLVGKELVGGGLVT
FT                   VMVRGDVGAVKAATDAGAAAADRVGELLSVHVIPRPHMEVESILPQTKPQAE"
FT   gene            299060..299824
FT                   /gene="eutT"
FT                   /locus_tag="CLOST_0253"
FT   CDS             299060..299824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutT"
FT                   /locus_tag="CLOST_0253"
FT                   /product="putative cobalamin adenosyltransferase in
FT                   ethanolamine utilization"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20383"
FT                   /db_xref="GOA:E3PUQ3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20383.1"
FT                   /translation="MAVITESALRTQLKSKTATVYAVNKGDKLTPSASEYLKTKGIELI
FT                   YSDDEKAVNDKVASKWDEAPVKSADENKISKKYVCYYTGAWFSEKPEFMTQIEGNKLVY
FT                   KDHQRIAFRGKLDSTEAQALYTLSLIDDSKKQIKAGLKEIYLHLRKMMRAEVLGEHLEE
FT                   FSMLSMDQAQLRELSHNPKKYFGNGHFILTGEEDKDVLLLNILRTRLRELEIEGLRAFR
FT                   KENTVDRKDIMMNLNRLSSAVYVLMLKATYEK"
FT   gene            299842..300744
FT                   /locus_tag="CLOST_0254"
FT   CDS             299842..300744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0254"
FT                   /product="Propanediol utilization protein (modular
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20384"
FT                   /db_xref="GOA:E3PUQ4"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20384.1"
FT                   /translation="MNEEMMKELILKIMKELDFNKDSSILEASPDEKVQTGAFDDSFQV
FT                   EVSARHIHLSKEHLEALFKDQEIGIKKELSQPGQYQADIRVTLIGPKGVLQNIAVLGPS
FT                   RNNTQIELSLTDARVLGINPPVRDSGDTKGSAGVIISANGRAIELTEGVIIAKRHIHMT
FT                   PKDAVLRGVKDKDLVKVRVEGDRPLIFDDVLVRVSDKYSLAMHIDFDEANAVGHRPDSR
FT                   GRIVFYSERIKLENKPLVKEETSSELKECFIEKKLISEEMIKELVKSESKIVNIPKASI
FT                   LTPLAVDFIKEKRIELKRV"
FT   gene            300780..301049
FT                   /locus_tag="CLOST_0255"
FT   CDS             300780..301049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0255"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20385"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20385.1"
FT                   /translation="MKKILITKKNINEYLDAKTCSLVMGPDMILTPGAKDEVRERNYAI
FT                   VYKEISESSDEISLEDRIKCILKNDYNVEDEALLKLLVKKIGAK"
FT   gene            301095..302222
FT                   /gene="eutH"
FT                   /locus_tag="CLOST_0256"
FT   CDS             301095..302222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutH"
FT                   /locus_tag="CLOST_0256"
FT                   /product="putative ethanolamine transporter"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20386"
FT                   /db_xref="GOA:E3PUQ6"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20386.1"
FT                   /translation="MPSINEIILYIMIVFMVVGAVDKIFGNKFGYGEKFDEGFMAMGSL
FT                   AIAMVGVVSLAPVLANVLRPIVEPVYVFLGADPAMFATTLLANDMGGYPLAMQLAKTEE
FT                   AGLFAGLILGAMMGPTIVFTIPVALGIIKKEDHKYLAKGVLAGMITIPIGCFVGGLVAG
FT                   FDLTMILKNLVPIIIVSALLAVGLWFIPEKMIKGFTVFGQGVVVVITIGTAAIIVETLT
FT                   GGKLVLIPGMAPIQDGILIVGSIAITLAGAFPLVHFITKVFNKPLMQVGKLLGMGDVAA
FT                   AGMVATLANNIPMFGLMKDMDERGKVLNVAFAVSAAFVFGDHLGFTAGVNKDMIFPMVA
FT                   GKLVAGITAVILASFITPKNKIEEPAIEQPNVISE"
FT   gene            302242..302691
FT                   /locus_tag="CLOST_0257"
FT   CDS             302242..302691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0257"
FT                   /product="Ethanolamine utilization protein (Transcriptional
FT                   regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20387"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20387.1"
FT                   /translation="MNLDEKVLESLVRKVVGELMAAKMPELEKDIDPKTGIMSIKAEKV
FT                   VCEKFDTGHINDKVYLKDVLSLDESPRLGCGMMEMDNSAFEWTLKYDEIDYVIDGVLEI
FT                   RLKDKTIRGEKGDIIFIPKDSEIVFATPSTVRFMYVTYPANWSEQ"
FT   gene            302792..303637
FT                   /gene="eutJ"
FT                   /locus_tag="CLOST_0258"
FT   CDS             302792..303637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutJ"
FT                   /locus_tag="CLOST_0258"
FT                   /product="putative chaperonin, ethanolamine utilization
FT                   protein"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20388"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20388.1"
FT                   /translation="MSSCLEIFSYCDELVDEFEKVISCPKKEKSSVYYTGVDLGTAYVV
FT                   LAVLDENKKPVAGAYRRASVVKDGMVVDYMGAIKIVRELKNEIEEKLDAKLVYAAAALP
FT                   PGTTSLDSGAIKHVVQGAGFELTALLDEPTAANAVLKISDGAIVDVGGGTTGISILKDS
FT                   KVIYVADEPTGGTHFSLVIAGAYKMPFEEADTYKRDEKNHKELTPVIKPVVDKVSSIIN
FT                   THIKNHDVSEVYLVGGTCCFNNIEEMIENYIKIPTIKPKNPLFVTPLGIALNCTQEIME
FT                   "
FT   gene            303652..303912
FT                   /gene="cchB"
FT                   /locus_tag="CLOST_0259"
FT   CDS             303652..303912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cchB"
FT                   /locus_tag="CLOST_0259"
FT                   /product="putative carboxysome-like ethanolaminosome
FT                   structural protein, ethanolamine utilization protein"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ps : putative structure"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20389"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR023414"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20389.1"
FT                   /translation="MIAGKVIDNIWATRKSDSLKGLKFMLIEAIGGKESGKYIIAADTI
FT                   GAGIGERVLICGGSSARKMLGKDDVPVDAVIVGIIDEDCIF"
FT   gene            303940..305277
FT                   /locus_tag="CLOST_0260"
FT   CDS             303940..305277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0260"
FT                   /product="Respiratory-chain NADH dehydrogenase domain, 51
FT                   kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20390"
FT                   /db_xref="GOA:E3PUR0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20390.1"
FT                   /translation="MDLQQIVKDAGIVGAGGAGFPTHAKLTEKAEYILLNAAECEPLLR
FT                   VDQQLMEIYPKEIILGFEAAGKQVGASQAIIGIKNKHKKVIKILNEAIEALNLTEYVKV
FT                   TPLEDVYPAGDEHVLVYEFTKKIVPELGIPLRVGCVVINSETALNIYNAINQLPVTDTY
FT                   LTIAGDIENPVTLKVPVGTPIRALFEKAGIKDIDSYAVIDGGPMMGPVMENIDGFVNKK
FT                   SKGYILLKKDHFLIKRKTVSLERASVVSRTACEQCRMCTDLCPRYLLGHNMQPHKMMRT
FT                   LGYQLKDISEQDISQLCCECNVCELFACPVNIHPRAVNVIYKKKLQEQGIRYEPIKTEF
FT                   TPRVARDFRLIPTKRLIFKLGLHDYDRPAPLDFDEYKSSYVEIPMSQHIGRPSQPIVSA
FT                   GEQVKKGQLIAVIPENSLGAAIHASIDGVVVKVDEKSIAIKVGDYE"
FT   gene            305288..305818
FT                   /locus_tag="CLOST_0261"
FT   CDS             305288..305818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0261"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20391"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20391.1"
FT                   /translation="MIELTSIAKGIYATDMMIKAANIEVVSATPVCPGKYIAIIQGDVA
FT                   AVESSINAGVRASEEYLVDSFILANVHPAVFPAITATTLPDGSGALGVMESFSMASMIM
FT                   AADAALKTAEIQALELRLGSGLGGKAYFTFTGDVAAVNEAVEAGKVMAMEKGLLVDVAI
FT                   MPSPAKKLWQALF"
FT   gene            complement(306018..307244)
FT                   /gene="tyrS"
FT                   /locus_tag="CLOST_0262"
FT   CDS             complement(306018..307244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="CLOST_0262"
FT                   /product="Tyrosyl-tRNA synthetase 1 (Tyrosine--tRNA ligase
FT                   1) (TyrRS 1)"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20392"
FT                   /db_xref="GOA:E3PUR2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20392.1"
FT                   /translation="MENVFDVLKERGFIAQATHEDEIRELLGKEKVVFYTGYDPTADSL
FT                   HVGHFLQAVAMRHLQLAGHTPIVLIGGGTTMIGDPSGRTDMRQMITPETIKENGERFKA
FT                   QLGRFIDFTADNAIMANNADWLMNLEYIPFLREIGMHFSVNRMLTAECFKSRMEKGLSF
FT                   LEFNYMIMQAYDFLELNRRHGCVMQLGGDDQWSNIIAGTDLIRRKEGKQAYGMTFNLLT
FT                   TSDGKKMGKTMAGAVWLDREKTTPYEFFQYWRNIEDASVEKCLALLTFLPMDEVRRLGT
FT                   LEGSEINHAKEVLAYEVTKLVHSKEDADAAMEAARALFTNNNASANAPTTGFELARLES
FT                   GIAILDVLKETGLVPSSSEARRLISQGGISVNDIKVEAIDFNVTADMLNDGVLMIKKGK
FT                   KTYHQVKAI"
FT   gene            307495..308415
FT                   /locus_tag="CLOST_0263"
FT   CDS             307495..308415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0263"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20393"
FT                   /db_xref="GOA:E3PUR3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20393.1"
FT                   /translation="MEDGVGSTLRNLLKSPLGIISGGRGFKGIFSKNEQSEETEEALKE
FT                   ELITILDEEEGKGAVNLFEKEMIKRVLKLYETKAKEIMIPRTSVFAVNIEDDVCDIIDE
FT                   IIEERYSRVPVYEKDIDNIIGVVHIKDLFAQMRKGNIDCINLRGIMKQPYFVHEYKSID
FT                   EIFLEMQKNRTHMALVIDEYGGFSGIITIEDLVEEIVGDISDEDDEYEVDEPIFRISEN
FT                   TYKVDGLTSISDVNELLEIELPTDVNDTIGGLLLGTLGKIPNLEEENEETNAFFDDVEL
FT                   KAIKVSDKRIETLLVKLKSKSFLDI"
FT   gene            complement(308574..308750)
FT                   /locus_tag="CLOST_0264"
FT   CDS             complement(308574..308750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0264"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20394"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20394.1"
FT                   /translation="MIISYLIGAVIVCLGIFLLVRSVKREATDGCYACSSKGSCSKASC
FT                   NVIRDIKTDEKSK"
FT   gene            complement(308847..310718)
FT                   /gene="feoB"
FT                   /locus_tag="CLOST_0265"
FT   CDS             complement(308847..310718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="CLOST_0265"
FT                   /product="fused ferrous iron transporter, protein B:
FT                   GTP-binding protein ; membrane protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12446835, 12781516, 8407793; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20395"
FT                   /db_xref="GOA:E3PUR5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20395.1"
FT                   /translation="MTISHITMALAGNPNSGKTTLFNALTGARQYVGNWPGVTVEKKEG
FT                   KLKFEDKNLILVDLPGTYSLSPYSMEEIIAKNYVINEKPDVVVNIVDASNIERNLFLTM
FT                   QLLELGRPTVIALNMMDVAKAKGYEIDVTKLSMELGVPVVPIIASKSEGINELISRAIT
FT                   EADVQNQTMPQKMQDFVNKLEEKISGITDPELAEETKTDYTYEYIEGIIKSAVKKPSSH
FT                   KITTSDKVDSVLTHKYLGLPIFALVMFFTFFFTYDLAGNVLNGMLDEFITGIVAPTAEA
FT                   GLMAIGAQDWLISLVVDGIIGGVGGVIIFVPNVACLFLMISLMEDTGYMARVAFIMDRA
FT                   MRGIGLSGKAFIPMVLGLGCSVPAIMSTRTLESQKDRLTTTLITPFVSCSARLPVYTLF
FT                   AAAFFPGNEKYIVFSLYVLGVVVAILVGLIFKKTIFKADETPFIMELPPYRFPSIKNLA
FT                   LHVWDRVKGYIAKAGTLIFGASVVLWFLLGFNMSGPSEINQSFGASIGKFFAPMLSTAG
FT                   FGNWQAALSLFTGVIAKEIVISNMAIIYGIGESAGDFASALSGTFSTLSAYAFMVFVLL
FT                   YTPCIAVIGVVKRETNSYKWTAFSILYQLFVAWLVATIVYQVGSFFI"
FT   gene            complement(310731..310952)
FT                   /locus_tag="CLOST_0266"
FT   CDS             complement(310731..310952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0266"
FT                   /product="Ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20396"
FT                   /db_xref="GOA:E3PUR6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20396.1"
FT                   /translation="MKTLSDLKVGETAIIDSINVTGILKRRMIDMGITKGCEIKVEKFA
FT                   PLGDPIDIRVKDYHIAIRKSDAKNIIVK"
FT   gene            complement(310967..311182)
FT                   /locus_tag="CLOST_0267"
FT   CDS             complement(310967..311182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0267"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20397"
FT                   /db_xref="GOA:E3PUR7"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20397.1"
FT                   /translation="MPLSMVSSNQEVTISDVIASAELKQKLMNMGFTKGCKLYVLQGLT
FT                   KGSIMVKVRDSKVVLNASTAHKIQCS"
FT   gene            311454..312230
FT                   /gene="cbiK"
FT                   /locus_tag="CLOST_0268"
FT   CDS             311454..312230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiK"
FT                   /locus_tag="CLOST_0268"
FT                   /product="Sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20398"
FT                   /db_xref="GOA:E3PUR8"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20398.1"
FT                   /translation="MKKGILVASFGTTYISTREKTIGAIEEKMAKAFPDFEVRRAFTSS
FT                   MVRKRILKNEGIHVDDVDEALSKMKEDGFEEIYVASLHIIAGHEYKKVSHSINRFKDDF
FT                   KVIKGAKPLLYSKVHYDEAVDAIAKLMPELSENEALVLMGHGSDHAANAAYVMLYHMLE
FT                   RNPLTSHVYLGTVEGYPEAEDILEELEGQGYEKLYLLPFMIVAGDHAINDMASDEDDSW
FT                   KSFFESNGYQAEPILKGLGEFEPISEMFIKRLKDSM"
FT   gene            312287..312982
FT                   /gene="cbiQ"
FT                   /locus_tag="CLOST_0269"
FT   CDS             312287..312982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="CLOST_0269"
FT                   /product="Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20399"
FT                   /db_xref="GOA:E3PUR9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20399.1"
FT                   /translation="MLIIDKFAYTNNLKDLSPKKKFGYSMGLLLASLINKEPLIFIAII
FT                   AFAFAGTVFWAKIPLGKYLKMLTVPFTFLFTSILAIVFSFSQDQAVFIWSVNLKVFYVG
FT                   VTELGLNNALILFLRAMSALGCLYFLTLTTPMDQQLYIMRKLHLPAYFLDLYALTYRFI
FT                   FILLDESIEIYRAQELRFGYNNLKNSYSSLSILIRVLFERVMNRYQDMEIALDSKLYTG
FT                   DFHMEKQEE"
FT   gene            312984..313790
FT                   /locus_tag="CLOST_0270"
FT   CDS             312984..313790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0270"
FT                   /product="putative enzyme"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20400"
FT                   /db_xref="GOA:E3PUS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20400.1"
FT                   /translation="MLEMKNVTYVYEDQTVALKDISMDLSKGSCIGIIGSNGAGKSTLF
FT                   LNFTGVLKPRQGQIFYDEKPMKYDKASLRELRKQVSIVFQDPDKQIFFSKVYDDVAFAL
FT                   RNLGVDEKEINHRVNIALASVGAKDFADKPVHFLSHGQKKRVAIAGVIAMDSEIIFMDE
FT                   PSAGLDPVATTQVEEIIKSLSDQDHKKVVISSHDMDLIYKVCDYVYVMDEGSIIAHGDV
FT                   SEVFMMDEILNKAGLIQPWLVKLHARMGYPLFKTEEELYKFKGCAK"
FT   gene            complement(313862..314227)
FT                   /locus_tag="CLOST_0271"
FT   CDS             complement(313862..314227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0271"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20401"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20401.1"
FT                   /translation="MQAKFIFSLILAVLVAIFAIQNSAAVPVNFIVYHLEISQALIILI
FT                   SAIIGAIIAFSLGLMKQFNMNKTIKEKDKQIRNLEMSVAKLEIENGELHTKNAMSLDSE
FT                   ESRLNTSTISDDKNLTH"
FT   gene            314369..314800
FT                   /locus_tag="CLOST_0272"
FT   CDS             314369..314800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0272"
FT                   /product="putative universal stress protein family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20402"
FT                   /db_xref="GOA:E3PUS2"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20402.1"
FT                   /translation="MKVDTILVPVDGSEGSLLAIDTAKAIAQKFDSKIVLIHVVDVGTR
FT                   GTMHEFYSYDPVVEEALIKRGEKLLDKEALKFEGMKVEKISLKGQAGDGIVTYVDENPV
FT                   DLIVMATRGMTRVRRFFVGSVTNYVVHHSKVPVLAIPVE"
FT   gene            314977..316050
FT                   /gene="pyrB"
FT                   /locus_tag="CLOST_0273"
FT   CDS             314977..316050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="CLOST_0273"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number="2.1.3.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10318893, 1598232, 1699940, 2271528, 2271529, 2459698,
FT                   3928602, 6300835, 6302686, 6341995, 6364131, 6377306,
FT                   91110549, 91159438, 91332909, 9298646, 9629924; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20403"
FT                   /db_xref="GOA:E3PUS3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20403.1"
FT                   /translation="MKHFIEVSDFSKEEIISLIEVGQDIMQNPAKYGDAMKGRLLATLF
FT                   YEPSTRTRFSFEAAMLRLGGQVIGFSEAQNSSVAKGESVKDTIRTVACYADIAVMRHYL
FT                   EGAPKLASIYSDIPVVNAGDGGHQHPTQTITDLLTIQMEKGRLTNLNVVLCGDLKNGRT
FT                   VHSLVKALSKFENNTFYFVSPKELKIPDYIKNHIKDSLFFEMETLEEGLPMADVLYMTR
FT                   IQRERFADPEQYEKLKDSCVLTKHKMILAKSDMIVMHPLPRVNEISEDVDSDPRAVYFP
FT                   QAKYGMFVRMALILKLVSEKENSAENHEEHRHELYSSCSNPKCVSNHEKLEKVGFGLLD
FT                   KENHIYACEYCDTYYAV"
FT   gene            316050..317276
FT                   /gene="pyrC"
FT                   /locus_tag="CLOST_0274"
FT   CDS             316050..317276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="CLOST_0274"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20404"
FT                   /db_xref="GOA:E3PUS4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20404.1"
FT                   /translation="MKEATMLYLKNCHIIDEVSDYIDDILIDSGKIKLIGKAKITNYIT
FT                   EKNQEALLPDLHVQTKLDILELDLCNRLVMPAFVDLHFHMRNPGQEHKETLLSANKAAI
FT                   KGGYTDLLGMANTNPVIDNKTLITEIIEKNNSLGMTRLLQVSAVTKGLNGKDLVDFEEN
FT                   RKATRFFSDDGKNIDDEQIMREALLASKQHDFIILDHSEEETEMVIRNLDLVRQTGGNL
FT                   HFCHISKKASMEAIIKAKEEGIPVTVEVAPHHIYASNVSYRVNPPFASEEDRMFLIESI
FT                   KNGYVDAIATDHAPHTPEDKANNAPGISGIETSFSLCHKVFTDNEISLKLLSKLLSASP
FT                   ARFLGFSPRVIRAGIQANLVVIEEKKSQIDRSLFESKGKNTPFDKEMVYAVIDKTIRKG
FT                   DILYDNGQN"
FT   gene            317263..318099
FT                   /gene="pyrF"
FT                   /locus_tag="CLOST_0275"
FT   CDS             317263..318099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="CLOST_0275"
FT                   /product="Orotidine 5'-phosphate decarboxylase (OMP
FT                   decarboxylase) (OMPDCase) (OMPdecase)"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20405"
FT                   /db_xref="GOA:E3PUS5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20405.1"
FT                   /translation="MDKIKERAISRSPFCVGIDLRMDHVPAELQNSFTKTSDKLVAYAK
FT                   EAIDASKEYAACYKVQIACYEAEGLDGMVAYQQIVSYIRSIGEIVIADVKRGDIGSTAG
FT                   LYAKGHLSGDFEADVVTLSPYMGKDAISPYFDFFAKDKGAFVLAKTSNEGSKDFQDLII
FT                   DGQPLYMSVFQKLKEWSKEIPGDYKFSPLGAVVGVNELKDIKALKENSKDTYLLIPGYG
FT                   AQGANIEDIRALIQENKNGVINVSRGYTAGIKESDFRKVLSQRAQQLAKELSECIK"
FT   gene            318135..318806
FT                   /gene="pyrK"
FT                   /locus_tag="CLOST_0276"
FT   CDS             318135..318806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrK"
FT                   /locus_tag="CLOST_0276"
FT                   /product="dihydroorotate dehydrogenase (electron transfer
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20406"
FT                   /db_xref="GOA:E3PUS6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20406.1"
FT                   /translation="MTIEGSFEAKPGQFYMLRGIGSFMTLSRPISVFDVEADKIAFMYR
FT                   VVGEGTKYFSKLKEGDEITLYGPYGNGYPVSDYKDKKVALIGGGMGIAPLFYLAKQLDN
FT                   AEIHLGLNSRDLTAEQKQYLGQLYATHAPTTIHIDTDMSEKLDFSKYDAVMTCGPEIMM
FT                   YKLTKKHENVYVSLEKYMGCAVGACLSCTCDVAGKRVKVCKDGPVFKGSEVSYDDAIKL
FT                   L"
FT   gene            318787..319722
FT                   /gene="pyrD"
FT                   /locus_tag="CLOST_0277"
FT   CDS             318787..319722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="CLOST_0277"
FT                   /product="PyrD"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20407"
FT                   /db_xref="GOA:E3PUS7"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20407.1"
FT                   /translation="MQSNYFNLSFKNPVIAASGTFGFGQEYKAYYNPSILGGISAKGIT
FT                   LEARRGNSGIRITETAGGIMNSIGLENPGVESFLADELQQMSNIDTVKIANLGGSTLET
FT                   YIEGAKLIEEHNKKVKANASTLLHTAVDLVELNISCPNVKEGGIAFGITCEGAEKVVRE
FT                   VRKVLSVPMAVKLSPNAENIVNVAKTCEYEGADGISLINTFSALKIDIKKRRPVFDNVY
FT                   AGLSGPAIKPIALKMVREVSKAVKVPVIGMGGITTAEDAIEFIMAGAHLIQFGTASFIN
FT                   PYAGKDIVEGIEAFMKEENIKSLDEIRGII"
FT   gene            319723..320277
FT                   /gene="pyrE"
FT                   /locus_tag="CLOST_0278"
FT   CDS             319723..320277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CLOST_0278"
FT                   /product="Orotate phosphoribosyltransferase (OPRT)
FT                   (OPRTase)"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20408"
FT                   /db_xref="GOA:E3PUS8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20408.1"
FT                   /translation="MIELLKQTDALLEGHFLLSSGKHSNRYVQCARILRYPDKAEAILK
FT                   PVAEKLKEMKIDLLVGPAMGGILVAYELGRQLGIEAIFTERVDNIMALRRGFEVSEGMN
FT                   IVICEDVVTTGKSSMEVKALLESMGAKVIAIASIIDRTNEELELPLISSLRVEIDTFDA
FT                   DDCPLCKQGTPVVKPGSRKMD"
FT   gene            complement(320466..321767)
FT                   /locus_tag="CLOST_0279"
FT   CDS             complement(320466..321767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0279"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20409"
FT                   /db_xref="GOA:E3PUS9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20409.1"
FT                   /translation="MSNYYHLPVVGIDIAANFSIVSALKPDGDIYQKNLRIEHTLCGFN
FT                   KLLTFLQKIEEELGDSPKVFCESTGIYHLTLLHFLVNNQVDIRVINPLITNSNKNSNIR
FT                   KVKNDKLDSLSIAKICKFDNVKTSSFTCEEFLHLKFLVREYYKVVDLKANLKKTFSNNI
FT                   YIHYPGLQDAFADLTGKTPLMFITKYPTPQHLLDACENEVINMLVTSSKRGVKWATKKF
FT                   KQLMDIAKSAAVIGINSLLFQSKVNRFYESFTFYSHQLQSITKEIFEYLDGCSFANIFK
FT                   YNLELLKTFKGIGDISAITLLVEIGNIDKFCKPQQLVAFFGIDPGINQSGNFSSDCNKM
FT                   SKRGTKVGRRALYAIALASIRTNKNKVPINQVIYEYYHISLGKKKKKVKLVAVMNKLLR
FT                   YIFSVLKNQKPYEIRNPKIHKRMFLESKPSLQSA"
FT   gene            322108..322317
FT                   /locus_tag="CLOST_0280"
FT   CDS             322108..322317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0280"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20410"
FT                   /db_xref="GOA:E3PUT0"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20410.1"
FT                   /translation="MKKTLSVFGMTCHKCVAHVKMALEELEQVKSAEVSLQEQSAVVEL
FT                   NEDVADEVLKNAVEEFGYEVREIK"
FT   gene            complement(322374..324152)
FT                   /locus_tag="CLOST_0281"
FT   CDS             complement(322374..324152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0281"
FT                   /product="5'-Nucleotidase domain protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20411"
FT                   /db_xref="GOA:E3PUT1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20411.1"
FT                   /translation="MRNKRFMSLALSITMVLSLVLFNPISAFADDAKELVILHFNDTHA
FT                   RVKSVEKDGVVTGVGFDRIAQYKQDLLKENPNVLMLDAGDTLHGQPIATLSQGESIVKI
FT                   LNLMGIDAFTPGNHDFNYGFARLQELEKMMNFPIVSANVMDKSGKEVFKPYVIKEMDGF
FT                   KVGIFGLSTPETSYKTNPKNVETIDFTDTIAAAKKSVEALEKENVDVIIALTHLGLDQG
FT                   DDTSDKVAEAVDGIDLVIDGHSHTTLEEGRMVKNTLIASTGEYDKAFGIVTLKIANGEV
FT                   TEKSAKLMAAADTKDIVPHPDVVALLADIDKGLNEILSEKIGTSTVMLDGARENVRTKE
FT                   TNFGQLVADAMLDATGAEVALTNGGGIRASIEAGDITKNHIVTSFPFGNYLVTKEVKGK
FT                   DIKAALEHGLSKYPEQNGGFPHVAGITFTFNTANPAGSRVSDLMIGGSPVDMEKAYLFV
FT                   TNDFMAAGGDDYTMLKPYATVNEYAAFDEILVNYIKKMGTISTTLVPRMTVNETAPVTP
FT                   APEPMPEPVPVPQDGKVIVPEPMETMNYTVTSEMHMMELAMNHGFAWQHILVLNPEISN
FT                   PMLKLKAGQVIKLPVH"
FT   gene            complement(324279..325325)
FT                   /gene="cobT"
FT                   /locus_tag="CLOST_0282"
FT   CDS             complement(324279..325325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="CLOST_0282"
FT                   /product="nicotinate-nucleotide dimethylbenzimidazole-P
FT                   phophoribosyl transferase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.4.2.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 96062218; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20412"
FT                   /db_xref="GOA:E3PUT2"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20412.1"
FT                   /translation="MELFKSTIASITNLDEEMMKKAQERQDLLIKPKGSLGKLEEISIQ
FT                   LAGIYGQEFYDTTKKAVIAFAGDHGVYEEGVAPNAQEITKIQIPNYVRKITGVGALARF
FT                   ANADVYGVDVGVNCDEILPGVINRKIRKGTSNMAKGPAMSYDEAIFSIEIGIEETNKLI
FT                   DAGYRVIGVGEMGIANTTPTSAIISVYGNYEPIEVTGIGAGLNSEGVIHKANVIKKSIE
FT                   LNAPDKNDPIDVLAKVGGFEIGAMTGAILACASRNIPVVLDGVISYASAILAIKLNPLS
FT                   KLYMIPSHFSAEPASKKAFDLLELSPMLQMDMRLGEGSGAALCFNIIEAANFTYKNMYT
FT                   FEEAGFTV"
FT   gene            325441..326322
FT                   /locus_tag="CLOST_0283"
FT   CDS             325441..326322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0283"
FT                   /product="putative DNA glycosylase (DNA repair protein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20413"
FT                   /db_xref="GOA:E3PUT3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20413.1"
FT                   /translation="MKLYQENNKVIIDKIKDFEPKHIFECGQCFRWDKEEDGSYTGVAN
FT                   GKVLNVKLEGDTLILDNTNLDDYHRIWHNYFDMGRDYSAIKAELAQMDEHLYNATIFGQ
FT                   GMRILNQDTFEIVISFIISARNAIPMIKRSVAFLSKALGEEIGEYRGKKYYAFPTPKAL
FT                   SSCDEQVLIDSKVAFRKGYIRDASYIQHSLQMDMYKLRNLPTDMARKELMTIPGVGPKV
FT                   SDCILLFGLSKYDVFPVDVWVQRVMHEFYIEKEMKDLKKIREFGIDMFKDKSGIAQQYL
FT                   FYYAREKGIGRK"
FT   gene            326325..327788
FT                   /gene="ywnE"
FT                   /locus_tag="CLOST_0284"
FT   CDS             326325..327788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywnE"
FT                   /locus_tag="CLOST_0284"
FT                   /product="YwnE"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20414"
FT                   /db_xref="GOA:E3PUT4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20414.1"
FT                   /translation="MTFTIFFAILAIFVSLLIFFENRDPAKTISWLLVMIFLPGIGFVL
FT                   YLLFGENLRSSKVKKTKVAVAKFLNSQDIKGMISLQILSATQKQALKDNVMFHDLESEG
FT                   KKKVMQLILNSERSPFTLNNKVDIYTDGLDKFEQMLKDIENARSYIHLEYFIVKNSEIG
FT                   KKLKDALIKKAKQGVKVRFIYDEIGSFRLIFHPDFAREMKSAGIEFRPFIHIHFPYIHR
FT                   KFNYRNHRKICVIDGEIGYIGGLNIGDEYVHENKKFGFWRDTHLRIEGESVYMLQTIFL
FT                   VDYYIGSGQKLNQQELFPSMAYKGDSLIQIVSSGPDNQYESIYNAYFSSIAHAKNTIYI
FT                   ETPYFIPDDALLTALRTAVLSSVDVRIIFPSFPDHNVVYYASLSYLEELLELGCKVYLY
FT                   EKGFIHSKMILVDEEIASVGTANMDIRSFMINFEVNAFIYDEPTISRLYEIFEADIKDS
FT                   KELLYSDFKARPIVQKIAESAARLFSPIL"
FT   gene            327970..328254
FT                   /gene="groS"
FT                   /locus_tag="CLOST_0285"
FT   CDS             327970..328254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="CLOST_0285"
FT                   /product="Cpn10 chaperonin GroES, small subunit of GroESL"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12475168, 2897629, 2901493, 8506346, 8538739, 8876186,
FT                   91260437, 9285585, 9298646, 9600841; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20415"
FT                   /db_xref="GOA:E3PUT5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20415.1"
FT                   /translation="MKIRPLADRVVIKMVEAEEKTKSGIVLPGSAKEQPQMAEVVEVGP
FT                   GGVVDGKEIKMELKVGDKVLFSKYAGTEVKLDGQEFTILRQSDILAVVE"
FT   gene            328335..329960
FT                   /gene="groL"
FT                   /locus_tag="CLOST_0286"
FT   CDS             328335..329960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="CLOST_0286"
FT                   /product="Cpn60 chaperonin GroEL, large subunit of GroESL"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10619429, 12475168, 12653476, 1349729, 2578448, 2897629,
FT                   2901493, 7935790, 7935796, 8564544, 8846220, 8986757,
FT                   91129229, 91338746, 9285585, 9298646, 94171713; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20416"
FT                   /db_xref="GOA:E3PUT6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20416.1"
FT                   /translation="MAKEIRFSEEARKALEIGVNKLADTVKVTIGPKGRNVILDKKFGS
FT                   PLITNDGVTIAKEIELEDPYENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGLK
FT                   NVAAGSNPILLRKGIQKAVDTAVATLKANSRTIENKESIAQVAAISAGDDEIGKLIAEA
FT                   MEKVGNDGVITVEESKSMGTTLEVVEGMQFDRGYVSAYMVTDVEKMEATLSEPYILITD
FT                   KKISNIQEILPILEQIVQQGRRLLIIAEDVEGEALSTLVVNKLRGTFEVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGRVISEEIGLDLKEATLDMLGKATTVKISKENTTIVNGAGEEKAI
FT                   KDRIAQIKRQIEETTSEFDKEKLQERLAKLSGGVAVIEVGAATETELKERKLRMEDALN
FT                   ATRAAVEEGIVPGGGTALVAVMDEVEALIKDEQTAETKTGIQIVLKALQEPLKQIAINA
FT                   GLEGAVIVENVRKSDKDHGFDALNEQYVNMIDAGIIDPTKVTRSALQNAASVAATLLTT
FT                   EAAVVEIKSDEPAMPMGGGMPGMM"
FT   gene            330199..330948
FT                   /locus_tag="CLOST_0287"
FT   CDS             330199..330948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0287"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20417"
FT                   /db_xref="GOA:E3PUT7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20417.1"
FT                   /translation="MDKKFLIDMLNKVKTDEIDIDTAAEKLSSISYEDIGYAKVDHHRS
FT                   LRNGYPEVIYCEGKTKEQIAGIMEKLLEKNSNILGTRLDQQSYEYLKERFKDLEYHSMS
FT                   RVMTLKVKEIEIKGKGEIAVVTAGTSDMYVAEEAAITAEFLGNKVIRIYDAGVAGIHRL
FT                   LSKQDELRRCRVVIAVAGMEGALPSVLGGLVEVPVIAVPTSVGYGANFGGLSALLTMLN
FT                   SCASGLSVVNIDNGFGAGYLASTINRL"
FT   gene            331042..332187
FT                   /locus_tag="CLOST_0288"
FT   CDS             331042..332187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0288"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20418"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20418.1"
FT                   /translation="MNLYLDIVGGISGDMMLSSLLGLGVNYDRFIEVMSTLSISDEFEI
FT                   SLSQASKGAIGGNKVDVILKEDSSFVHRNLSDIINIIDNSGISSRAKYMARKIFTVLAE
FT                   AEAKVHLAKVEDVHFHEVGAVDSIVDIIGTAVLIDMLDIETIYCSEIPLGSGFTWSQHG
FT                   KIPLPAPATLNLLEDMKVRLTNLQAETVTPTGAAILKGLNAKQASNLSMMIKKTSIGCG
FT                   TKNFDIPNILRAILFQPNDYYIREKLAVLSCNLDDMTGELMGNAMEELFDAGALDVWFS
FT                   PIMMKKSRPAYKLEVLTTMHQKEAISKAIFEQTTTLGIREQIIDRKSLKRKIRSQKTEL
FT                   GSIRIKEAYLGDKKINQKPEFEDLKALAKKKGVTVRSLNIK"
FT   gene            332347..333477
FT                   /locus_tag="CLOST_0289"
FT   CDS             332347..333477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0289"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20419"
FT                   /db_xref="GOA:E3PUT9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20419.1"
FT                   /translation="MLVIYSDKIVQNDAVISGYIHIADGKIQKIDEKSSLKDYIDMTGK
FT                   YILPGLINIKSEHISRENQIKLNSRFPFAKIFREVEIKYASAGITTLFHSIPLVNGRYR
FT                   EDFTTGPKMAKDIKELSKRSNLIDHRIHMAFQLGFIQSMDKIKEMLESNLLDYISYSGY
FT                   CRSEEERYREIYYEDYIQRVMGLSEATCKRMVERVRELRSESNLEELAYMLKYAHYKGV
FT                   KVGTSELSVIKKLEFLEQQGINIIENPSLEEALNLDSGSDKMIMMDILSLSKQLNKTYQ
FT                   DQVVSAIRTGHIDILSSDMRAHDILAFVFQLAQDLGLEKAVSLVTSNPATALKLKDRGQ
FT                   IKESLRADLIVVDILDEVPVVEMTISNGKIVYRANY"
FT   gene            complement(333560..335353)
FT                   /gene="mdlB"
FT                   /locus_tag="CLOST_0290"
FT   CDS             complement(333560..335353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="CLOST_0290"
FT                   /product="putative fused ATPase and permease component of
FT                   metabolite ABC transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20420"
FT                   /db_xref="GOA:E3PUU0"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20420.1"
FT                   /translation="MGHFEESEIQDKGFDVALMKRLMSYAKPFTGLLVLSFLMILLATV
FT                   VDLARPWMIKIAVDEYISPVGSIPKDEAVKGVQQIVFFLFLLITGGFFFNYLQVYLLSY
FT                   VGQRVIHNMRTTLYDKVMHLPLSFFDKNPTGRLVTRLTNDMENLNELYTSVLVSFFKDV
FT                   FLLGGIIIMMIRLDLKVSLMVFITIPIIVWVSIVFRKKSRKAYRLVRTRLAVINSSLSE
FT                   NISGMRIIQIFAQEERKKEEFSKYNEAHLDASLKELFIFAIFRPSMDLIYSFGLALLIW
FT                   FAGGAVLKGQMPFGVLFAFINYLEQFFHPIYDLSEKFNIMQSAMASSERIFQLMDEPIS
FT                   SDVEDEETKDYPEITGKIEFENVWFSYTGDEDWVLRDVSFVINPGETVAFVGSTGSGKT
FT                   TIISLIARLYEIQKGRILIDSVDIKDIPVSHLRNQISAVLQDVFLFTGDIKSNIRLDND
FT                   EISDEKIEAVAKFVNADRFINKLPKAYDANVEENGATFSSGERQLLAFARALAYEPKIL
FT                   ILDEATSNIDTQTELLIQDAITRVIQNRTTIVVAHRLSTIQHADNIIVLHKGKIREMGR
FT                   HDELLSQKGIYHNLYLLQYKN"
FT   gene            complement(335355..335546)
FT                   /locus_tag="CLOST_0291"
FT   CDS             complement(335355..335546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0291"
FT                   /product="Lipid A export ATP-binding/permease protein msbA
FT                   (fragment)"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20421"
FT                   /db_xref="GOA:E3PUU1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20421.1"
FT                   /translation="MKDRTSIIISHRISAIKDADEILYLEDGVITERGTHSELLVQKGA
FT                   YEDLYRKQLLEEKLDKEV"
FT   gene            complement(335847..337106)
FT                   /locus_tag="CLOST_0292"
FT   CDS             complement(335847..337106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0292"
FT                   /product="ABC transporter, ATP-binding/permease protein
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20422"
FT                   /db_xref="GOA:E3PUU2"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20422.1"
FT                   /translation="MYLLRHLKDFLITYKRQYLLGVTALIIVDLLQLIPPKIIGSITDS
FT                   IKSGTIDASGITLYGFIIIGIACLVAIFRYFWRMNIIGSARKLECWLRNKLFIHLEDMT
FT                   PEFFNYRKTGDLMAHATNDIQAIRMSFGPGVIMTTDAIVISITTMVIMFSTINPKLTIW
FT                   ALLPLPFMAALVTFLGKKIQKLYKQVQEAFSGLSDHTQESISGIRVIKSFVREKSSLSN
FT                   FENTSEVYVNKNMKLAAIYGFMFPMIGFISSISFLIALLQGGKMVIDGSLSLGDLVAFI
FT                   TYLGMLIWPMMAIGWVINSMQRGIASIKRINEILDTAPALIDKETAIWPEEFTPRISFE
FT                   NVSFKYPQSENFALRNLDFHINKGKTLAIVGKTGSGKSSVSSLLLRFYSHSDGIIKVSD
FT                   TNIEDLKHKKLREKIGYVPQ"
FT   gene            337500..338849
FT                   /locus_tag="CLOST_0293"
FT   CDS             337500..338849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0293"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20423"
FT                   /db_xref="GOA:E3PUU3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20423.1"
FT                   /translation="MKTDIALKDKSILKNFTKYSLSNVLGMVGLSCYILADTFFIANGV
FT                   GADGLAALNLAIPIYSFIHGCGLMLGIGGVTKYSIYKSQKSEHKANSIFTNTIYLALLI
FT                   SLIFMLLGYFYSEGLAHILGADSKIFAMTNTYLKVMLLFTPLFIVNEILICFVRNDSKP
FT                   RLSMTAMLVGSLSNIILDYIFIFEFKMGMLGAVLATGVSPIISMIVISVHFIKKNNSFY
FT                   LVKIKLKLSKIKTIFSLGLPSLITELSAGVVMIVFNLIILRLEGNTGVAAYGVIANIAL
FT                   VVNAMFVGIAQGIQPLITKAYGKSEKEVINKTLKYALITMLGLAIVIYITTATFADSIT
FT                   LLFNSDGNPKLQEIAITGLRLYFTSGIFAGFNIIISMYFTSTDNPAPAQLISLIRGFFL
FT                   IIPLAFILSRAFGIIGVWITFPLTEAMVAITVALFLTKNCKRLIQNAKKN"
FT   gene            338927..339622
FT                   /locus_tag="CLOST_0294"
FT   CDS             338927..339622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0294"
FT                   /product="Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20424"
FT                   /db_xref="GOA:E3PUU4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20424.1"
FT                   /translation="MSFFTYKDVYFEDGVKVLEVNLLPEKYCNFDCIFCPIGRSQNKID
FT                   EKVSFEDQEQDIKELLERIDKNEIELVFINSKGEAFVNEKLSEIIDLIKSKNVKVRLLS
FT                   NGYVLGKDECRKIANKCDEVIGELKVLEEEDFQKVQRPIAGYTIEEYISNMIEFNKQYK
FT                   GKFIFEITIIKGYNDDQESIAKLKTIIKQLQPEEIQVVRLEEEHFQKKLGISDERFEQI
FT                   KKGIDVILY"
FT   gene            339649..340356
FT                   /locus_tag="CLOST_0295"
FT   CDS             339649..340356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0295"
FT                   /product="B3/4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20425"
FT                   /db_xref="GOA:E3PUU5"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20425.1"
FT                   /translation="MKKFVIENEFWELFPTAKIGIIVANDIDNTIKDEAKYAPMLAAAE
FT                   KETDKFFTEGDFSKNPVIKVWREAFTKFKTKKGARSSIEALLKRVYNENHIGTINPLVD
FT                   IYNSISLKYGMPCGGEDIETFVGDVRLTKAIGNEDFITLGSEESAPPYEGEIVYKDDKG
FT                   AICRCWNWRESVRTMLTENTKHAFLCIELVDETRTEDFEAALNELSGLVTENLGGTAKI
FT                   SILDINHKELVIV"
FT   gene            340619..340719
FT                   /locus_tag="CLOST_misc_RNA_1"
FT   misc_RNA        340619..340719
FT                   /locus_tag="CLOST_misc_RNA_1"
FT                   /product="Purine"
FT                   /inference="profile:Rfam:8.1"
FT   gene            340833..342296
FT                   /gene="guaB"
FT                   /locus_tag="CLOST_0296"
FT   CDS             340833..342296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="CLOST_0296"
FT                   /product="IMP dehydrogenase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="1.1.1.205"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2860637, 2998937, 2904262, 9298646, 9600841, 9629924;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20426"
FT                   /db_xref="GOA:E3PUU6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20426.1"
FT                   /translation="MAKILKEALTFDDVLLVPQKSNVLPYQVDTSTYLAKTVKLNIPIV
FT                   SAGMDTVTEHGMAIAVAREGGIGIIHKNMTIAEQALEVDKVKRSEHGVIVDPFFLTKDK
FT                   TLGEADSLMGRYRISGVPIVDEQDKLIGILTNRDIRFETDFTKKIEEAMTSENLITALE
FT                   GVSLEEAQHILAKHKIEKLPIVDKDGYLKGLITIKDIEKKIKFPNSATDSQGRLLCGAA
FT                   VGVTEDMMERIDALVNAKVDIIVIDTAHGHSQGVIQAVKKSKEKYPELPIIAGNVATGP
FT                   ATRELIEAGADCVKVGIGPGSICTTRVVAGVGVPQISAVMDCYEEASKHNIPIIADGGI
FT                   KYSGDVVKAIAAGGSAVMLGSLLAGTKESPGETVIYKGRSFKSYRGMGSLAAMEKGSKD
FT                   RYFQKDAKKLVPEGVEGMVPYKGEASELIFQMVGGLRSGMGYCGTPTIKDLIENSEFVR
FT                   ITAAGLRESHPHDITVTKEAPNYSANMEV"
FT   gene            342302..343831
FT                   /gene="guaA"
FT                   /locus_tag="CLOST_0297"
FT   CDS             342302..343831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="CLOST_0297"
FT                   /product="GMP synthetase (glutamine aminotransferase)"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.5.2"
FT                   /EC_number="6.3.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2982857, 3894345, 85261223, 8548458; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20427"
FT                   /db_xref="GOA:E3PUU7"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20427.1"
FT                   /translation="MKHETVLIIDFGGQYNQLIARRVREAKVYCEIVPYKKAMEKIKEV
FT                   KPEGIIFTGGPSSVNDPGAPDIQAEIFDLGIPILGICYGAQLTAKTLGGSVAKPEKREY
FT                   GKTEINYTGGKLFKDVDKSNICWMSHTDQIDKLPEGFTITAATHDCPVAAMENVDKKLY
FT                   ALQFHPEVEHTVQGYKIIRNFLFEVCALSGDFTSDSFIDDKVRLIRQQVGDKKTLCALS
FT                   GGVDSSVAAVLVHKAIGDNLTCIFVDHGLLRKNEGDDVERIFRDEFSMNLIRVNAQERF
FT                   LSKLAGVTDPERKRKIIGEEFIRVFEEESKKLGDVEFLVQGTIYPDVIESGTDEAAVIK
FT                   SHHNVGGLPEDMKLSLVEPLRELFKDEVRNVGLELGIPEYLIFRHPFPGPGLGIRVLGE
FT                   VTEEKCDILREADAIYREELEKAGLGRKIWQAFATLPDVKTVGVMGDERTYSYMVGLRA
FT                   ITSTDGMTGEFYPIPYEVLGTISTRIVNEVKGVNRVVYDVTGKPPATIEWE"
FT   gene            complement(344010..344444)
FT                   /locus_tag="CLOST_0298"
FT   CDS             complement(344010..344444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0298"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20428"
FT                   /db_xref="GOA:E3PUU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20428.1"
FT                   /translation="MISGKKLKELRLIRNLTQKELAIKSGISDAAIRNYELGNRSPTKQ
FT                   QLDKIASALNCDPGAITDHNLYTNIDFYQIIFDLETNFTLRPYRDESGMSFLMSNSPEF
FT                   NDFLKEWDDMRKKHYNNEISDEEFRDWKISYPKKSALLKK"
FT   gene            344705..344917
FT                   /locus_tag="CLOST_0299"
FT   CDS             344705..344917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0299"
FT                   /product="transcriptional regulator (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20429"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20429.1"
FT                   /translation="MNKIFMNAKEVQDFLGVSRTTAYQLINEMNEELIKMGYRTQRGKV
FT                   NRQYFMEKYCYSTNYVEKGVCFGSL"
FT   gene            344904..346034
FT                   /locus_tag="CLOST_0300"
FT   CDS             344904..346034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0300"
FT                   /product="Phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20430"
FT                   /db_xref="GOA:E3PUV0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20430.1"
FT                   /translation="MGAYKDESKNGTWFCKFTYTNWKGEKINKKKRGFATKKLAQEWEQ
FT                   EFLNEQSGTLEMTFKEFFEVYKRDKKPRIREHTWKTKEYIVNTKILPYFGKIKMNEIKS
FT                   ITIIHWQNELMEKRDDKGQKYSPTYLRTIHAQLSSLLNHACKYYNLKTNAARDVGSMGE
FT                   KEANEMLFWTQEEYEKFISAIKDKPQSFYAFEILYWCGLRIGELFALTKEKFDFENNIV
FT                   KVDQSVQKLNGEIVITPPKTKKSIRTIVMPEFLSREIQEYLSGFYKLKDKDLIFPISKS
FT                   YLHHEMDRGCKKASVKRIRVHDLRHSHVSLLIELGYSAIAIADRVGHESIDITYRYAHL
FT                   FPSKQSDMAKSLMQLRDNSNKPSWDELLNDEEEIDV"
FT   gene            346027..346398
FT                   /locus_tag="CLOST_0301"
FT   CDS             346027..346398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0301"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20431"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20431.1"
FT                   /translation="MFRSESVSKKMKDKKYMKNKIKTKNRKRDKVVCFRLTQTESDMLD
FT                   RKITITGISKQEYIIQSILNHEVNIKSDYRLAESISMEIFQLAKVIKKFGKLNDEEQLL
FT                   LMYILEIYEEIKNEKAFSN"
FT   gene            346498..347454
FT                   /locus_tag="CLOST_0302"
FT   CDS             346498..347454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0302"
FT                   /product="putative phage DNA-polymerase or DNA-primase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20432"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20432.1"
FT                   /translation="MINTEKYANNIPYKMRKYKQWILFKTYIRTDRNGNKKTSKIPISP
FT                   VTFKAKGWNERKSWIDFDNALISLKNSNCDGVAFVLTNHDPFICIDLDNCITYENTFSN
FT                   KLAEECVKLFENTYMEISHSGSGIHIFLEGEIPKNINNQTKGIEIYKENHCISMTGEIS
FT                   NTLIYPSRNIINRQSDLDKIYKKMSLNERYKAKSNSKSITITEEVPDADSIIEIMCKYN
FT                   NTAKELFEGALVSGDWSKDDFHLLLLLNSYTHGNEYLMEDIFLKSNLSRAEEKSKRTDR
FT                   ESYLKYLRKSIKKAVEIGNSNYWQYKKYHNKGDFYVK"
FT   gene            347444..348808
FT                   /locus_tag="CLOST_0303"
FT   CDS             347444..348808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0303"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20433"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20433.1"
FT                   /translation="MSNSWIKFSDNCLKQYINRNLDYTKKGEIKDTKANLITVLINPKF
FT                   CKRKGIVAGEIFFDTCSMTIKFLGYVKGEEDYNKNSLRNWTDQLTNIVGIEIEMEYGIK
FT                   YSKNKMEDAISFIANKRSVNLPKMYLKSLEYDGNEYISMLLPKYLGAEDTPLNSWIIRH
FT                   VLIGMVKRVFNPGCKFDELLVLTGEQGVGKTSFIEKLALLPEWYCSLSSIKGKDAVSNL
FT                   LGKIVVELEEFVALRNAKSADEAKQFISSRTSTVRLPYARFSEDIKRTCILIATTNDIT
FT                   FLGDFTGERRYLPVQVNQKNIKIPVMYDTEKFPQLKTITKKQHEEIVRKYFHGAIAQAV
FT                   YLYEQNCFESVLPKELKSDLELVIQIHKKDNRSVQNFHEFMDWKINFSDTPDILCSAEY
FT                   TSKYPDTNEKIFSEIMAIEMSDEWEVEVSSKSKKYKIDGVYRVSKKFYKRRLEKS"
FT   gene            348860..349057
FT                   /locus_tag="CLOST_0304"
FT   CDS             348860..349057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0304"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20434"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20434.1"
FT                   /translation="MVAQILKLCKPKIYLKILNYLRTFLVLVISKATHESCMNVDIASI
FT                   YFLTTAQKVSLKFDKLNLFF"
FT   gene            349102..349482
FT                   /locus_tag="CLOST_0305"
FT   CDS             349102..349482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0305"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20435"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20435.1"
FT                   /translation="MKNKVNRKNDCTVHFMVNQQEMDEINRRFNQTSYRTKREFYRDSI
FT                   LKNKIISIDLDGKIGNELRKLSSMISRNSNNINQITKIANNMNHVDREALKFFERCIKE
FT                   EAQLILNIREMITNHIINEAFL"
FT   gene            349482..350891
FT                   /locus_tag="CLOST_0306"
FT   CDS             349482..350891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0306"
FT                   /product="putative conjugative transposon mobilization
FT                   protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20436"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20436.1"
FT                   /translation="MAITKIHPIKSNLKKSIDYICNSEKTLEEIYVKTNLCSRENAHKE
FT                   FEITKKQFHSKTKTLAHHLIQSFLPGEVSYEEAHKVGKELCESIFGQDYEYILATHVDK
FT                   NNIHNHVIFNSVDVNQGKVYQSYYGSYMKIRNKSDRICKEHNLSIITPEIQKDIDYLKT
FT                   RTFTNWFDWKQDKLGKSAKSSLKEALSSAIDLADNWREFLDLMIKYDYEIKQGKHIAFK
FT                   HKSQDRFIRAKTLGEAFTEDNIRQAIRTNFAKRKDEKLTSGFIEWLNNEKARIEKIEAT
FT                   KANIASRIGKIVKVVKNYRIRFQNLCREEVAIKKVTPYIETCVNKRAHYEGHIKNPNDK
FT                   IYNLINKKDIQAYQNSFIKVEEFLKRYPKYKELVLKGIKDKTVFQKLKQQYSSIDKEKG
FT                   IIYKEIIKLENEFDILVLERERIEKLEQKNIPKENNKEETYEEKVERALAKKREMAVDK
FT                   PKKKKSRDMEL"
FT   gene            351199..352371
FT                   /locus_tag="CLOST_0307"
FT   CDS             351199..352371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0307"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20437"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20437.1"
FT                   /translation="MRINSKIETAASFNPTKKTHQMDIATMCEKISSNKMTLPLYQRDL
FT                   SWNLQKAVDLFNFQLFGKAPVAPISINEISDLSDKDVPQISFITRELISWENIKGDHQS
FT                   VVDGQQRLSTNFKAFTNDESFRNVILDFARGSFRIVEGSIAKSQIPVGILLNKEEDILI
FT                   DYLKEKDNFNSLFAIALRVRTKLRSYNYTINIAENLTEEEQIQWFEVLNNAGSRVTALQ
FT                   MSFSKLKIHDLDIYSDYTEPFKEKAIEYGFGELFLPFTTNVSYPIAALNPAYEVIEKEG
FT                   VHNSNYAPIPSDTKESILTKLSVSKLERIISLTLLSLEKALEFIVENNLKDITDRMDYI
FT                   LYLSGFYAYNENRMVDSNLELKLIDWVKNVDFTNQSNSERRKIFTELLKL"
FT   gene            353053..354087
FT                   /locus_tag="CLOST_0308"
FT   CDS             353053..354087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0308"
FT                   /product="Cytosine-specific methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20438"
FT                   /db_xref="GOA:E3PUV8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20438.1"
FT                   /translation="MNLIDLFCGCGGLSYGFEQAGFNVLLGIDNDKAALETFKLNHKNS
FT                   KTICGDIREITFDEINNVIGNKKIDLIVGGPPCQGMSLSGPRKFEDPRNELYLSFIRLV
FT                   KEIQPKAFVIENVPGLVSLFKGKIKDSIIEKFSEMGYKVRFEIMCASDYGVPQSRKRVI
FT                   FVGHQDKEFEFPEKMNTYVTCEMALSDLPPLEDCLGNEESPYYKDPQNDYQQIMRQHSS
FT                   ILRNHIAAKHSEQVKHIISLVPDGGNYKDLPIEYKNTRKFNVAWTRFNSKKPAPTIDTG
FT                   HRHHFHYKYNRVPTVRESARLQSFPDDFVFLGNKTQQFRQVGNAVPPIMAQILGEKIKN
FT                   LLKN"
FT   gene            354097..355509
FT                   /locus_tag="CLOST_0309"
FT   CDS             354097..355509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0309"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20439"
FT                   /db_xref="InterPro:IPR021108"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20439.1"
FT                   /translation="MYLVPNEYYVRLHHVRPRFKGDIENVLLYVAEEISKIPELPCNEF
FT                   ADELNNAIKCYPGNVNRKIKTINNWRTEISALFGFIESDGVTSRAGRRAIELSEKQDLV
FT                   ESFKMFLFSFQYPGAHIKSHEILKLIQQGVHFKPAQYILKVIQSGEKIMGKKNYITKAE
FT                   ACHCIFNDLRCVRDNENTDLTWKRIEKNREDEIEYDMTGDIIRYAGDIIDYMEIANLLV
FT                   SYDGKQYYLNSLENEAILKFVKSTEWFNDYDQFISNKTASLQEINNCKKNWFAFVNRGM
FT                   GETDFSTDILAFISSDSKEYEELKRSSFDLFVKKLASDTSVSTKDIGDIGESLVHGHEC
FT                   QRVKIGGRNDLIHLIKRIPNQFAVGYDIQSVELDEQKRYIEVKTTISSKPLHFNKFHLT
FT                   SNEWNTASSTKDRYFVYRLMISKHERRLFIIQDPVHQYKNDLIEMVPKNGAEIIFDTTK
FT                   SGYFEELLAWEN"
FT   gene            355512..356492
FT                   /locus_tag="CLOST_0310"
FT   CDS             355512..356492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0310"
FT                   /product="Cytosine-specific methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20440"
FT                   /db_xref="GOA:E3PUW0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20440.1"
FT                   /translation="MASLFCGCGGTDVGLLGGFKFLDNSYAKNDMEIVYANDIDINACR
FT                   IFEENFDIMPDNRDIREVASNELPEFDILTGGFPCQSFSIVAQNPKRLGVKDDRGKLFF
FT                   EMCRILKDRQPMCFVAENVKGILSANDKEAFPLIIKEFEDSGYNVSYKLMNSVNFGVPQ
FT                   KRERVIIIGFRKDLELEFNFPEEIIANEWEFLNLSMVIESEVSEKYFFSEKAVQGMLKK
FT                   RATMNKGRAQDINKPCNTVGAHLAKVSLNSTDPVLLIGSRYRRFTPREVARIQSFPEEF
FT                   VLVGSESAQYRALGNAIPPVMIWYVGRAVVETLEKFLNSQFRKIG"
FT   gene            complement(356746..358044)
FT                   /locus_tag="CLOST_0311"
FT   CDS             complement(356746..358044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0311"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20441"
FT                   /db_xref="GOA:E3PUW1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20441.1"
FT                   /translation="MFKESIHLELKKEYVKDILKTVIAFANTSGGKIYIGIDDDGKVLG
FT                   VQRLDTDILKLSNSIRDSIKPDITLFASILVEKIDGKDVIVVDVQKGASSPYYLTDKGI
FT                   RPSGVYVRQGASSVPATDAAILKMIRDTDGDNFEELRSLNQNLDFDFLKKEFEDANIKF
FT                   EHSQMRTFNIIDEYGLYTNLGLLLSEQCPHTIKAAVFEGSTKEIFKDRFEFSGSLLKQM
FT                   KDVYSFLNRYNRTNSEITGLKRTDTREYPEIALREALLNSIVHKEYSYSSSTLISVFDD
FT                   KIEIVTIGGLTKGLSEDDIMLGVSILRNRNLANIFYRLKLIEAYGTGIPKIIESYNEYN
FT                   VKPKIEISSNAFKITLPNTLKEKSISKLEKNLSDKEYLIVNMLKENEYIKRTDIEKNLS
FT                   ISSSMAIKLLRNMVENSIIEKLGKGKNVIYRLK"
FT   gene            358162..358320
FT                   /locus_tag="CLOST_0312"
FT   CDS             358162..358320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0312"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20442"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20442.1"
FT                   /translation="MYYFYFSALSIFNFYISEFKLCKRLSNLRMFIKVKGRVKGEIMLG
FT                   ILEQKNL"
FT   gene            complement(358336..358599)
FT                   /locus_tag="CLOST_0313"
FT   CDS             complement(358336..358599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0313"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20443"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20443.1"
FT                   /translation="MKIYLKKFLYLQKGIPLLELLGLFLIAITLYGNFDLSNYATILGV
FT                   IGFFISIYNKRISFIVLNVFLMFNRLIIFFLIVVLGSYLRLN"
FT   gene            complement(358840..358956)
FT                   /locus_tag="CLOST_0314"
FT   CDS             complement(358840..358956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0314"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20444"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20444.1"
FT                   /translation="MTTTRKNSNSIFDCSIEKPPISGISNNKNRGTRANDIR"
FT   gene            359009..359251
FT                   /locus_tag="CLOST_0315"
FT   CDS             359009..359251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0315"
FT                   /product="Abortive infection protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20445"
FT                   /db_xref="GOA:E3PUW5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20445.1"
FT                   /translation="MKIKFFQKKVILIIILSAVVFGICHGYSSIYIVYGFLGGLVFAYS
FT                   YYVYINKDYSSFWVVTSIHSIRNLIVFIYSIILMN"
FT   gene            359532..362177
FT                   /locus_tag="CLOST_0316"
FT   CDS             359532..362177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0316"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20446"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20446.1"
FT                   /translation="MFCRYCGTKIPDTAKFCKNCGKATSKQEKSNEQFANQDFENKENQ
FT                   NNVKISESKAPYETLNQREDLNEKEKLNEMKKQKTYEKINDYKPKINDSKEISPKKTGG
FT                   FFKIFAPIMSLALIGLLLNYLIGPFNIPKIDDFSFAKKTIENNEKPQVLPKVEYSASEL
FT                   KAESMKAVVSPENPMANLEGVIVDFGEFNLSEEKSLEIVSLPSKIDEVAGVEFQAYDFN
FT                   LEDMKEFNTLVDITLNYNPEGLTEEEQAKTITIAWFDESIEQWIPILSSVDTENKTVTF
FT                   STEHFSMFAILKNTTNKGKSVFYYPNNEYKGVTTPVLVDSGALIDVLDKVDTKPFELLL
FT                   RDRSVPTNDVVSTGANYLNIITGSADQLEALSNALLPSIMRVGESVSNRFAGLGIAAVS
FT                   LKISNQLSRGVPLNTVLRDNAFNILEIALIVAVSVKASPFIAAAATAVWIGGIVDELTY
FT                   DPEDITSYLDDVERVYDYFSMEQVTYNFDTKSCGYIIPVPGKKVKLRENEYMLSTQADW
FT                   ARVLSKIRKDNLESPHLIKEEVNKVVESYSSAFWRAYAKDMAGVFYWIDGRALLRSNQL
FT                   ADTLEWPKTNEKLQKYAQRTIVRTHDRLQTVYNEMAKVENHQLGVQYTLAAMDLAESLN
FT                   QTIYFEAIDPNLEKPGFAKSVHASKYFELESNGFHQEDFVASERHEDSNIVFRCNLYHY
FT                   ILAGSPNQLATYPFAPSEAAIPVRDGYIGFSFTSPNTKIEFPSEIQQGEILGHWSIYSN
FT                   YSNNGVFIPPGLSKEGEENFKKEHGIVGEPESRGFKVVFYPDGTFYAEVRSAGNIIDSS
FT                   FSGTYKTMEYEGANKGTYYYLADIDESTIINKGQMVYRNVGEGPDLKFYFSEKDGKKLL
FT                   FEETTQTYLE"
FT   gene            362329..363696
FT                   /locus_tag="CLOST_0317"
FT   CDS             362329..363696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0317"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20447"
FT                   /db_xref="GOA:E3PUW7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20447.1"
FT                   /translation="MKTNNLTQGSILSALFKLAIPIMGTSFVQMAYNMTDMIWVGRVGS
FT                   RAVAAVGTAGFFTWLAMAFILIPKIGAEVGVAQSIGKNDMKEAKVYIKHTLQMIVVIAL
FT                   IYALSLITFRKPLIGFFNLGEPDIIQNAINYLVIISFGLVFYFINPVFTAIFNGYGESR
FT                   TPFIINSIGLLVNMVLDPLLILGLGPIPRLEVAGAAIATVIAQAVVTIIFVLNVRMRPE
FT                   LFSGLNLFKAPDMAHINKIFKLGLPVALQSGLFTVFAMVIARIIAQWGPIPIAVQKVGS
FT                   QIEAVSWMTAGGFQTAMSTFVGQNYGAKNWDRISKGYMVGLAIMTVIGIFTTGLLYFGA
FT                   RPIFSIFIPEPESISYGVVYLKILALSQFFMCIELTTAGAFNGLGNTVPPSIIGIIFNA
FT                   LRIPGALILSATSLGLNGVWWAISISSIFKGVILATWYMILLKKSNKAIGEVVLEP"
FT   gene            363754..365388
FT                   /locus_tag="CLOST_0318"
FT   CDS             363754..365388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0318"
FT                   /product="putative Manganese-dependent inorganic
FT                   pyrophosphatase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20448"
FT                   /db_xref="GOA:E3PUW8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20448.1"
FT                   /translation="MNREIYITGHKNPDTDSIVSAIAYAKLKQKRNGLNAIPVRLGEIN
FT                   SETQFVLDYFKVEKPRYMDTIKPRVGDLDMDPAFYASPEISLAKAIRLIQSNHNNNIAV
FT                   VDDSNNLVGVVSLSNITACYLDVWDDAIIKNSNTPLENIVETLSGELLYTPEDIRSFGF
FT                   MHVYAMTPQKAEEFISEGDIVIVGDRSDAQLDAINRNVSVLILTGGCEIEPSILSEAEK
FT                   RNIVVLRTNFNSFMAARLLPQSVPISYVMTTENIVTFDLDDFVEDVQKIMGETRYRSYP
FT                   VIDETGHVAGNISRFHLISNPQKELILVDHNEKNQSIPGIDYARITEIIDHHRIANITT
FT                   GHPVFFRNETVGSTSTIISKMYIEQGIRPEQSIAGILSAAIISDTLMLRSPTATELDRQ
FT                   MLERMSKIAGIDIETFAKDMFRAGTSLEEKEPVDLLRGDVKEFIISGKRVRIAQVMTMD
FT                   LDSLEGIRLALIEKMTELRLAGGEDDFVLVLTDILKETSKFIVVGPDAESIARSFDAEL
FT                   VDSTFLAPGVLSRKKQVVPKITQALEK"
FT   gene            365407..366435
FT                   /locus_tag="CLOST_0319"
FT   CDS             365407..366435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0319"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20449"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20449.1"
FT                   /translation="MGDSKFCMNCGAKTQPEDVFCESCGQKLEADDYENKPEVREERSP
FT                   YPKQEDSIVPPARQAAREPFREPFPERPKKKRNSGVIAVVALLVIVIFGGGYWFFSQKG
FT                   ENDNIADQPNQNADSSNQNSEASNEGTGETQQTELTSSQLDLTKARTYLSTPGYKSTFF
FT                   VNYPDGMAGVVERFSGRGPNANEGVIVSEVEVVRENGEDYGYGFHYVTRQDGSYYILDS
FT                   TPFEIYSHLKDDLSIGKTWSYEDEVFGDIVWTVMDMGVDLDLGFEKFSNCLVVKEDNQA
FT                   AGFVTIAYYAPGSGMIYSTDASGNNDYYKMTAKEQIGTEQAESQIVKWCPNYLEIKDDR
FT                   TQ"
FT   gene            366485..367042
FT                   /locus_tag="CLOST_0320"
FT   CDS             366485..367042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0320"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20450"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20450.1"
FT                   /translation="MVGMIVLGLIVFGVVGFVIQIYNNLVQLRQRVKNAWSQVDVQLKR
FT                   RYDLIPNLVNTVKGYAEHEKTTLENVTKARTMAMNAGTVQEQTQAENMLTGALRSLFAV
FT                   AEAYPELKANTNFLQLQAELSDTESKIAFSRQFYNDTVQKFNTSIEVFPNSLIAGNMGF
FT                   TPADYFTLQDEPEARETVKVEF"
FT   gene            367058..368953
FT                   /locus_tag="CLOST_0321"
FT   CDS             367058..368953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0321"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20451"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20451.1"
FT                   /translation="MDKSFSSYSLKLNKVIIILTIVLMTLIPNQAFADRSLSMRSLYID
FT                   AQLLPDASMMVTEKITVEFNEQWNGFYVKIPEGTTPIVDVSVSESGQPYTYNPGTEYGP
FT                   PGTFLTKKEGSDILIDWSIDAYDQTRTFELSYTVVNAVKIHNDVAELYRKFVGDANGNK
FT                   INDVQVNLSLPSGAESYVQGQDIRIWGHGPLDGVVEFTQNNGVIWKTQNLSPYTFVEGR
FT                   VVMPTALFSDAPREAYTNQMALGSILSEEQANADKANKERQRARFELGGAAGILAATIG
FT                   ALIYLWRRFGRKYKSNFEGDYYRDLPADYSPAELSILWNYKKMKPEDITATILDLARRK
FT                   FLYLEEDKVEVKKLIGTKEVTTYKLTFMPDPEPGSFRNPEDAVLKRHEKRLLDYLKNDI
FT                   GGRQPFIHLTEIEDYAKKYGEEFYKFWQSWTEDIEITTAKYSFFDENKALYKYSAIGGI
FT                   LIIALGIFTTFKMLAIGIALVISGLMILLVPQLFRRRSPNGQDDYVKWKAFKKFLEHFS
FT                   EMQRHEIPSLIIWEHYLVYAVTLGVAKEVIKQLELVFPNMTDGDYRFGYGWMNYSSYGS
FT                   FRAFNDSFDMVGNSIDKAFSSAQKAVSKSSTGGGSGGGFSGGGGGGGGGGSYGGR"
FT   gene            368970..369452
FT                   /locus_tag="CLOST_0322"
FT   CDS             368970..369452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0322"
FT                   /product="putative acetyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20452"
FT                   /db_xref="GOA:E3PUX2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20452.1"
FT                   /translation="MDIEIKLGYDSPKEVLALFSEYMEMLIAGDSTFKKYLEIQNYDDE
FT                   IKDLEKKYGLPRARLYLAYVDGKVAGCIALKELDGENCEVKRLYVRPEFRGLKLGNLLI
FT                   QKIIDEAKEIGYKAMLLDTLPFLKSAIVLYKNFGFYEIPSYNNNPMDTLIYMKLDL"
FT   gene            369557..370384
FT                   /locus_tag="CLOST_0323"
FT   CDS             369557..370384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0323"
FT                   /product="putative Chromosome partitioning ATPase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20453"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20453.1"
FT                   /translation="MAKTIAFINMKGGVGKTTLAVNMAYALAKIHGKKVLLIDIDPQMN
FT                   STQYCLSQEALTQLVEEPNRTIFGFMNQQYQVKATLKKYTQDEPLENLTINVDGVFDIV
FT                   ASHMKLMEINLDQRPYKLRQYINNHFASKYDVIILDCPPTISEYTKMGLLAADSYVVPM
FT                   KADAFSMFGLPMLQNYIDSHIYGEFGHEINFIGIILNMVIPSRLIYKKVKDKLKNDWKD
FT                   YIFMNEIPYREVIVKGLDDELNKNKYIVDMTVETELRKNIEELSLELIQRGRL"
FT   gene            370386..370859
FT                   /locus_tag="CLOST_0324"
FT   CDS             370386..370859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0324"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20454"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20454.1"
FT                   /translation="MKDETKNDIYDLLDLLNKLYSLSFLSDKDRLNEVRNEIMSTMSIS
FT                   TNSLEQKVREADESLYSMENIVNILEEMKKIRRKDKMMSFLMELDIKPYDKKLSLDDMR
FT                   GRAIVELIERGLVKNDEKTLKTNSKNKSSAKTDKKDFMDMWLDFYKQNKANKK"
FT   gene            370906..371682
FT                   /locus_tag="CLOST_0325"
FT   CDS             370906..371682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0325"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20455"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20455.1"
FT                   /translation="MNLREEAEFNNIRDFLNENYSIDVDLENENPGSLMDMAVKLFLSL
FT                   NTWENYIYNAEIMDDSMKSMFKECISNTLHIIVFSALKMRLPLLMMINRTLELMALFFF
FT                   DSKVNHELLELGLVFENINYRNILIDKYEFERKYDIDLEKAVVFCDDMTHRCNAQYREL
FT                   SNHLSFKNSQYYSNEKCLDIMNWTNLDVIYISNQISLMSSIINSLMILLHFEIYIETIP
FT                   ELEKLFIRNAINNNLKINDDKKYDFKNKIIDIFGEI"
FT   gene            371717..372526
FT                   /locus_tag="CLOST_0326"
FT   CDS             371717..372526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0326"
FT                   /product="Metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20456"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20456.1"
FT                   /translation="MKLTVLVDNNTFIDQYYLGEPAVSYYIEDEEIRLLFDTGYSDIFI
FT                   SNAKLLNIDLEKLTHIALSHGHNDHTRGLVYLKDKYDLSQVEVIAHPDCFYPKYYDEES
FT                   IGSEISLEQIEKISKLKLSKEPYEISERLIFLGEIPQYLAFEPRIPIGKTIINGNFEID
FT                   TLLDDTAIVYKAKSGLFIITGCSHSGICNIIEHAKKVCSSDKILGVIGGFHMFDCDERL
FT                   AATVDYLKNENIPMLYPGHCISFQAKAKMNNALKVHDVGVGLTIELE"
FT   gene            372798..374150
FT                   /locus_tag="CLOST_0327"
FT   CDS             372798..374150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0327"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20457"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20457.1"
FT                   /translation="MKKTWQYLFLVALIVITLPNLSFAQNMATVEINGIKLVMDEPPTL
FT                   VNGRTLVPLRAIFEALNVTPMWDPSTKTVTAKTDKVDMKLKIGSTNAVVNGQSVSLDVP
FT                   GTLVNGRTMVPARFIAETLGAQVDWDANTKTVKIVSADAQTSVSDTQNKPDAKTIQANS
FT                   YAHMKNFMNQFENSRFNEVIKLGNIETYRMELSDTTLVVDMTFKEDAQYDPKTNTITLK
FT                   KDPSAIAPSDDMDMGQLIWHEISHKIEDENGDIGYFDSKLYGERNIEYMKNIIQVALPK
FT                   LEQLERYNGDDAEHIKKLWSNFEKAYEDALKLPETQAYPPDKEMLKKWFGFSVDKESIL
FT                   EFYKSGKGGENIKKALNPQIASVWSGAWDTEFGVLVMTQSGNNVSGSYSHDVGSLAGTV
FT                   SGNTLSGTWIENDDEGTFTFIMNEDEKSFSGSWQETSPDPNQGGGWDGTKQ"
FT   gene            374329..375174
FT                   /locus_tag="CLOST_0328"
FT   CDS             374329..375174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0328"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20458"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20458.1"
FT                   /translation="MKWKGRAKSSNVEDRRGRGVGGAAIGGLGGFGIIIMIIYALLGGN
FT                   PGDIMQSIDPGQTQSVPYEATQEEEELAEFVSVVLADTEVVWNDIFADLGKEYNEPKLV
FT                   LFTGSVQSACGVAGASTGPFYCPGDKNVYIDLSFYNELKTQFKAPGDFAMAYVIAHEVG
FT                   HHIQNELGIIAQMDEIRGKVSKEEYNKYNVRLELQADYLAGVWANHVQGQNLLEEGDLE
FT                   EALTAASAVGDDRIQMQSQGYVVPDSFTHGTSEQRKRWFFKGYEAGDLSQWDTFGANEL
FT                   "
FT   gene            375197..375697
FT                   /gene="pfpI"
FT                   /locus_tag="CLOST_0329"
FT   CDS             375197..375697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfpI"
FT                   /locus_tag="CLOST_0329"
FT                   /product="Intracellular protease 1 (Intracellular protease
FT                   I)"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20459"
FT                   /db_xref="GOA:E3PUX9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20459.1"
FT                   /translation="MKKVMILIENLFDEQELIYPYHRLREDFEVVLVGSKKDEAYKSKA
FT                   GFSLKSDLASEEINPEEYEALFIPGGFSPDYMRRTEATVNLVKMFIKTGKPVAAICHGP
FT                   WMLASADAIKDKEVTSFFSIKNDMIHAGGIWIDKEVVVSDNILTSRNPGDLPALMKKIV
FT                   EMI"
FT   gene            complement(375807..376379)
FT                   /locus_tag="CLOST_0330"
FT   CDS             complement(375807..376379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0330"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20460"
FT                   /db_xref="GOA:E3PUY0"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20460.1"
FT                   /translation="MIYRNATIDDIEAVARLQQKYHVSTIDEQDKKDGFVTTLFTHEQF
FT                   KEIIEKENGLAIACDSLGVIGYAMAASWEFWSKWPLFQFMIEDLPSTTYLGEVLSTKNS
FT                   YQYGPICIDKAYRGTEVLANLFEFSRQQMEKRYPIMITFINHINPRSYEAHTRKLGLDV
FT                   IKNFDFNNNHYYELGYDMKKKTLGSTI"
FT   gene            376642..378474
FT                   /locus_tag="CLOST_0331"
FT   CDS             376642..378474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0331"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20461"
FT                   /db_xref="GOA:E3PUY1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20461.1"
FT                   /translation="MKEKFIKTKGVKQEETTRNLEELKKGKGSKFKNDKKIRNSISVKA
FT                   RILIIIVALGLITIASGIYSVYNLNNVQKGSTKINEVGIRNMIDFDEIAGGTHRIQKLV
FT                   YHIGNSKSDKEIKEYEEELSGAYEDMMYYAEEALGNAEKDKKEIVNRMTENIKALYENA
FT                   QKSVNAVKSDNLEGFYSNIEANKEVSKKIEEDVYELIVANDDVIKEVLKNQLDMLKQSQ
FT                   MIALGLAVATLILIAFGILNIRSYIVIPLRNLETKLTEIISGVEAKKGDLSSRVNIKVN
FT                   DEIGRVGININKFIETLEQIISKLTVNTQDMYNVIENVIGKIEKADTSVSDISALMEQL
FT                   AASTQEVSATVESVSSETDEAHSEVVEMNNETINLLEYSKIMKSRAEEMKKAALETKEG
FT                   TGSVVVEIVEKLDSAIENSKSIAQINNLTQDILAISEQTNLLSLNASIEAARAGEAGRG
FT                   FAVVAGQIRELADSSKDAASNIQQLNSEIVGTVEQLIDNSKNMIKYINETILEDYDSFV
FT                   DMGLKYDQDASHINEIMNDFNLKNQKLTGVMEMIAQKMTGISDTMEESSRGVMSAATNV
FT                   TELVEGINDIHVNMDKNESIAKSLKNETDGFVLK"
FT   gene            378698..378796
FT                   /locus_tag="CLOST_misc_RNA_2"
FT   misc_RNA        378698..378796
FT                   /locus_tag="CLOST_misc_RNA_2"
FT                   /product="Purine"
FT                   /inference="profile:Rfam:8.1"
FT   gene            378848..380179
FT                   /locus_tag="CLOST_0332"
FT   CDS             378848..380179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0332"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20462"
FT                   /db_xref="GOA:E3PUY2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20462.1"
FT                   /translation="MDIANQAPKGFLERTFKLSEHNTDVKTEVLAGITTFMTMAYILVV
FT                   NPMILADAGMDKGAVFVATALAAAIATFVMGFLANYPFALAPGMGLNAFFAYTVVLGMG
FT                   YTWQFALMAVFIEGIIFIILTFFNVREKIIDAIPLGLKNAVSAGIGLFIAFIGLANVGI
FT                   VQAGGAILSVGNLREPLIVLSLFGLLVTAGLLARNIKGAFLIGMLVTTAVGMVTGIVAL
FT                   PSGFASAPPSLSPIFGAFLQADKAQIFGPEMAIIVFTFLFVDLFDTVGCLVGLAAKTDM
FT                   LDENGKLPKAKQALFADAIGTTAGAILGTSTVTTFVESASGISEGGRTGLTAVVTGMLF
FT                   IASLLFSPIFIAIPSQATAPVLILVGVMMASSMLKIDFHDMTEAIPAFLTIVMMPLAYS
FT                   IAEGILFGVVSFAIIKLLAGKGKTVTPALYVLAVLFIAKVILAG"
FT   gene            380280..380768
FT                   /gene="purE"
FT                   /locus_tag="CLOST_0333"
FT   CDS             380280..380768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="CLOST_0333"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="4.1.1.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10074353, 10574791, 8117684, 89123018, 89123019,
FT                   92287929; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20463"
FT                   /db_xref="GOA:E3PUY3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20463.1"
FT                   /translation="MKVSVVMGSVSDFDSLKEMLDFFKEMDIEVSLRALSAHRTPGELI
FT                   EYLTEMENEVEVFIAAAGKAAHLPGVVASKTLKPVIGIPVKASTLDGLDALLSIVQMPK
FT                   GVPVATVAIDGSLNAGILAAQIIALKDEKTATKLKEYKNKMRLEVLSKEQDLLKSKGY"
FT   gene            380849..381544
FT                   /gene="purC"
FT                   /locus_tag="CLOST_0334"
FT   CDS             380849..381544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="CLOST_0334"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthetase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1534690, 1885529, 2120198, 91008982, 9298646; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20464"
FT                   /db_xref="GOA:E3PUY4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20464.1"
FT                   /translation="MKMLYEGKAKQVFLTENPNEYIVHYKDDATAFNGEKKDQLAGKGQ
FT                   LNNAISSHIFTMLNEKGIKTHFIKQIDERDMLVKKVTILPLEVIIRNISAGSMAKRLDL
FT                   KEGIAFETPIFEFCYKRDDLGDPLINDDHAIALGIVTREEVEFIKQETFKINEILKDFF
FT                   MKANLKLVDFKIEYGKTEDGEIILADEISPDTCRLWDKDTDKKLDKDRFRRDLGSVIEG
FT                   YQEVLERIK"
FT   gene            381547..382890
FT                   /gene="purF"
FT                   /locus_tag="CLOST_0335"
FT   CDS             381547..382890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="CLOST_0335"
FT                   /product="amidophosphoribosyltransferase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="2.4.2.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3040734, 3047685, 6277938, 6443594, 7037784, 88335626,
FT                   90264358, 9333323, 9514258; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20465"
FT                   /db_xref="GOA:E3PUY5"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20465.1"
FT                   /translation="MCGIVGVYSNEPVVRDLFYALNTLQHRGQESCGIAVSDDKDISCH
FT                   KGMGLVQEVFREENIQNMNGNIGIGHVRYSTAGGSYEYNTQPLLGFSKGKRIAIAHNGN
FT                   LINNQLLKTRLEEDGMMFQTTIDSEVILYLISRYYNGNMLDAVKKTMDLIKGAYSLVVM
FT                   LKDKMVAVRDPYGFRPLVMGRRGDDYIFASETGVIDVLGGEYIRDLEPGEIVIVKDNKM
FT                   ESHMYEHKAPMSTCIFEHIYFARPDATIDGLNAYSFRVKTGEILAKESPVDADVIVPVP
FT                   DSGWPGAIGFSSKSGIPIMEGLVKNRYMGRTFIKPTQREREIAVKLKLNPIVDVVKGKK
FT                   VVLVDDSIVRGTTSKRLIESLRAAGAKEVHMRITSPPVTHSCYFGIDTPRRKNLIAAHS
FT                   TVQEICDNIGADSLGFISIDALREAAGPEFKFCKACFDGKYPLDPCVL"
FT   gene            382918..383976
FT                   /gene="purM"
FT                   /locus_tag="CLOST_0336"
FT   CDS             382918..383976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="CLOST_0336"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.3.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10508786, 3015935, 3530323, 86278135, 9298646; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20466"
FT                   /db_xref="GOA:E3PUY6"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20466.1"
FT                   /translation="MEDMMEKLTYAASGVDIDEGNRAVQLMKSKVASTYTSAVVGDLGA
FT                   FSGGFSLKDFKHMEEPVLLAATDGVGTKLIIAQMMDKHHSVGQDLVAMCVNDLICQGAK
FT                   PLFFLDYVATGKVNAEKIANIVGGIADGCKMADCSLIGGETAEMPDMYTEDEYDLAGFA
FT                   VGIADKAKILDGSRVKEGDVVIGLASSGLHSNGYSLARKLFFDHLGLGINDKINTSIRT
FT                   IGDLLLVPTKIYVKTIMDILEKYDIKAIAHITGGGLLENVPRVLPDDLDVYINKGSWNM
FT                   PEIYKEILALDKIEEKELYKSFNMGIGMVVVVNKEEAKTILDHINENSWDDAFIIGTVE
FT                   KGSKKVILNGNI"
FT   gene            383984..384550
FT                   /gene="purN"
FT                   /locus_tag="CLOST_0337"
FT   CDS             383984..384550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="CLOST_0337"
FT                   /product="phosphoribosylglycinamide formyltransferase 1"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number="2.1.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10606510, 10954745, 1522592, 1631098, 21287279, 2204419,
FT                   3301838, 90241938, 90373777, 9698564; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20467"
FT                   /db_xref="GOA:E3PUY7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20467.1"
FT                   /translation="MQKLKLAVLVSGSGTNLQSLIDAQKEGYFNSEIALVVSNKASAYG
FT                   LTRAENAGIKALVIKSDKELLDALLENEIDLIVLAGYLKVISSELINAYENKIINIHPS
FT                   LLPEYGGHGMYGLYVHEKVFADKKDQTGATVHYVTAEVDEGPIIIQKKLIVDYDVIKSP
FT                   EELQKAVLVIEHQILKEAIKIIEEQ"
FT   gene            384657..386171
FT                   /gene="purH"
FT                   /locus_tag="CLOST_0338"
FT   CDS             384657..386171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CLOST_0338"
FT                   /product="fused IMP cyclohydrolase ;
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2192230, 2687276, 90078227, 90286915, 9298646; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20468"
FT                   /db_xref="GOA:E3PUY8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20468.1"
FT                   /translation="MKALISVTDKTGIADFALGLEKFGYEIVSTGGTLKVLLDAGVKAI
FT                   SIDELTGFPEMLDGRVKTLHPKVHGGILHIRANETHVATVKEHGIDPIDMVVVNLYDFE
FT                   GTLKSGKPHDEIVENIDIGGPSMIRSAAKNYKDVAVVTDPKDYQEILERLSNKTLDEAY
FT                   KRKLAYKAFSLTGYYDAMIGRYFAGLENETFPERTAIGLLKESSLRYGENPHQNAAVYE
FT                   DAMTTSLMTGMIQLHGKELSFNNLNDLNTALELASEFEEPAVAVIKHATPCAAAIGSTI
FT                   YEAFVRAYEADKMSIFGGIVAMNKEMDAETATAMDEIFLEIVAAPSYSEQALEILKKKK
FT                   NLRILVINYNNKKSGLDVKFASGKVLIQETDNLNCEKLETVTTTAPTKAQLDDMKFAMI
FT                   VCKHVKSNAIVIAKGGATVAISGGQTSRIWALQNAIRNNPDKDFAGCSLASDAFFPFDD
FT                   CVTLSAEHGIAAIMQPGGAGRDQDSIDACNKSGIAMVFTGTRHFKH"
FT   gene            386257..391266
FT                   /locus_tag="CLOST_0339"
FT   CDS             386257..391266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0339"
FT                   /product="phosphoribosylamine--glycine ligase (modular
FT                   protein)"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20469"
FT                   /db_xref="GOA:E3PUY9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20469.1"
FT                   /translation="MNILVIGGGAREHAIIYKLSQSSRAEKIYAAPGNAGIAELAKCID
FT                   ISATDVEGLVEFAKNNSIDLVIVGPEDPLCMGVVDILTAEGIKVFGPEKASAQLEGSKA
FT                   FAKEFMLRNEIPTARYIKTSDINQAMQAFEMMFTSSPYGKAVIKADGLCAGKGVVVAES
FT                   LEQGFEFITEVLTNKIFGETELVLEEYIEGIEASLLCFVDHNTIVAMPTAKDHKRIYEA
FT                   ERGPNTGGMGTYSPNPIALAYHDEMIKEVAQAYHKGLQKEGLSYRGIIFFGFMITPEGI
FT                   KVLEFNTRFGDPETQSILVRLETDLLEIFDMATQDKLNELDIKWSDDQAVTLVLASKGY
FT                   PGAYEKGKPITIKDKAMIDSLGVVFHAGTKLDGNTAVTNGGRVLSLTAKAPTLDEAMEK
FT                   AYKMAELIDFEGKTYRKDIGPMVKRIYVQKKAEFDIEGASLAAQIKESLGIHLESVSPY
FT                   QRYDMQNITIDEINKISKTILSEPPVDDIYIQEEAFEVEKSMTSPIVVELHRGQYDQRE
FT                   DGLLQSLAVVLGKEDVKIRCARVYDIKGKVTAKELEKIKAYLINPVDQQEGSMKLPNLL
FT                   EDEQPIIQTKAVIDGFIAMDESALSDFHAKNGLAMKLEDLKYFQDYFKTKENRDPSEVE
FT                   LAMVDTYWSDHCRHTTFNTVLENVSFISSANKAIQLAVLQAYKDYLDLREKAHNNEKPL
FT                   TLMDMATIMARYMRKNGQLDDLEVSDEINACSVKIKVKVNGEDQDYLLMFKNETHNHPT
FT                   EIEPFGGASTCLGGAIRDPLSGRSYVYQAMRVTGSADPREAISETLEGKLPQRKITQEA
FT                   ARGYSAYGNQIGLCTGFVDEVYHPGFKAKRMEVGAVIGAAPAENVIRKQPESGDIIVLI
FT                   GGRTGRDGVGGATGSSKEQTEKSIELSSAEVQKGNAPSERKLQRLFRNPKAASLIKKCN
FT                   DFGAGGVSVAIGELADGLDIKLDKVPLKYAGLTPKEIAISESQERMACVISPADLDAFM
FT                   KLCHEENIEATVVATVTDTNRLVMTYNNEVMVDIDRTFLDSAGVTSSQEVEVEIPYTLD
FT                   MFAETEIKDIEAELKSRLADLNVCSKKGLIQRFDNTIGAASVLIPLGGDYQLTPAQGMA
FT                   CNIPSLDGDTSTASVMTYGYNPYLSEQSPFHGAYYAVIESVSKIAALGAPVEKTRLSLQ
FT                   EYFEKLGEDKRKWGKPLSALIGALKVQRELNLPAIGGKDSMSGTYKDLNVPPTLISFAV
FT                   SYQDSEKIISQELKEAGNTIGLLFTPATEDNLLDMEMYKDNLNTLKALALENKIKSAYA
FT                   VTHEGILAGLTKMAFGNNLGVNLNADLKADMLFKPLYGSFVVELAEEDARVMTLGKVEK
FT                   TPVLKVGASVAIELKDLQAAYEEPLESVFGTKNPAQETVKTVFEAQSKLEAKPSKAKTS
FT                   IAQPKVVIPVFPGTNCEYDSAFAFEKAGAKATIQVLRNLTLKDIDESLKELEKTIRESQ
FT                   ILMIPGGFSLGDEPDGSGKFIAAVLSSPRISDAIAQLLEKNDGLILGVCNGFQALIKTG
FT                   LLPYGEIKTLDSDAPTLTHNAIGRHMAQFIKTKVVATNSPWTSLLTEGDIHQIPVSHGE
FT                   GRLIGSEAVIKQLYDNHQVAFQYVDDSGNPTMKLPYNPNGSYGAIEGLVSPCGRILGKM
FT                   GHTERVQKGLFNNYKITSKQLLFEGGTTYYK"
FT   gene            391572..393035
FT                   /locus_tag="CLOST_0340"
FT   CDS             391572..393035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0340"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20470"
FT                   /db_xref="GOA:E3PUZ0"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20470.1"
FT                   /translation="MGFFGGSKITDEHIRASREIKKRNLTQMIPSELGEFAQNINSFII
FT                   DIRTNLGQFYALSQKMSEESEVLSSSLEEANETFAMVDKRVDDFAEQMNQRSERISELK
FT                   ESLEQFVESSKESETGAKEVTDALSQMHDAIIHGKEDFLKVVKLLNTTKDTGLDLAGNM
FT                   TSLAGEIKNINKIIEEVQSIANKTNLLSLNASIEAARAGESGRGFAVVAQEIGKLAMQS
FT                   QEAVEKIDSTLTDLAARIINITENVTTEMNHVEQEAKVADNSIASMQIIDEEAKKAASK
FT                   MKNLEKNTQIQKKLGEKVELVSADFIQLMEDVTSLSEDMRAGSQNYYAKSQNITAMLLE
FT                   TEKRTQEIFGFIRSYTESLPLTDKMKTCIANAKSALANKQTDTSLLKRENNKVAREELK
FT                   KLAKAYPSFEVICILDASGLSLVSSIDEEDYKLNFSHAEYFKSAIAGNTYESKPYISTD
FT                   TGNYCVAVSLPIKENGNIVGVIMADVSLA"
FT   gene            393060..394148
FT                   /locus_tag="CLOST_0341"
FT   CDS             393060..394148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0341"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20471"
FT                   /db_xref="GOA:E3PUZ1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20471.1"
FT                   /translation="MKINIVGLGPGSLDNISYKVYEIVTASNLPLYIRTKKHPVIDTLE
FT                   QRGMKAEYLDRFYETGEVFEQVYEAIVDYLIDEVKTQNEIIYAVPGHPYVAEQTVAILH
FT                   EKCKEQNIEIVTYPSMSFIDALFAAVKRDPSDGFELKDAFNIDTLSLDTEHDLVITQVY
FT                   DNLIASETKLKLLEAYPDEHEAYIVKNAGITGTEEITVCKIYELDQMGICYDYLTSLYI
FT                   PRVIHKTYSNLSDLINIVRKLRGPDGCPWDAKQTHESLKDHIVEEATEVKEAIENDDLD
FT                   NLIEELGDVLLHIVFHSELGRESGYFNLLDITDGICKKLTFRHPHVFSDLEIDEKDLPE
FT                   MWERLKQIEKNNKNTDKQRIRG"
FT   gene            394283..394591
FT                   /gene="hupB"
FT                   /locus_tag="CLOST_0342"
FT   CDS             394283..394591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="CLOST_0342"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 21150454, 21175605, 215461, 2187099, 2265752, 3003540,
FT                   6987059, 91210175, 92380498, 9298646, 93013008, 9367749,
FT                   9683467, 97338083, 9868784; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20472"
FT                   /db_xref="GOA:E3PUZ2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20472.1"
FT                   /translation="MNKAELVAKMAEKSGMTKKDTEVALNSFMASVEEALVAGEKVQLV
FT                   GFGTFETRERAAREGRNPRDPEKKIKIPASKAPVFKAGKGLKEKVNATKAAKSSKKK"
FT   gene            394652..394894
FT                   /gene="yabO"
FT                   /locus_tag="CLOST_0343"
FT   CDS             394652..394894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="CLOST_0343"
FT                   /product="YabO"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20473"
FT                   /db_xref="GOA:E3PUZ3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20473.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVAKDASDAGVVFINGKEAKASTKVKIGD
FT                   ILELHFGEKILRVKVLDLKEHVGKDEAASLYEVIE"
FT   gene            394894..395274
FT                   /locus_tag="CLOST_0344"
FT   CDS             394894..395274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0344"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20474"
FT                   /db_xref="GOA:E3PUZ4"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20474.1"
FT                   /translation="MKGKNQDETKSSKVVELDFKSDKSKKTKKKLDSFDVASAVVIGLL
FT                   IWAGISLSFTFIEQQMEISVLKERKLALETQIKQEEKELKKTKKILNQMDTLEFIEKQA
FT                   REKLGMIKPGETVYIDLTKKKN"
FT   gene            395287..396201
FT                   /locus_tag="CLOST_0345"
FT   CDS             395287..396201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0345"
FT                   /product="putative exopolyphosphatase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20475"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20475.1"
FT                   /translation="MKLASIDIGTNSMRLLITDYENGFSKRKKYTNITRIGRGVDEFGY
FT                   ISKEAIDRNIHALKEFVEIAKHEDCEEIYVMGTSALRDSKNKEEFIERAKNEAGVNVDI
FT                   ISGNDEASLGFYGVTADLKEEGQVLILDIGGGSTEFILGDKTGGIVFSKSENIGSVRLT
FT                   EKFIKSDPVDEIELENMDAYIKAVTENTISILKTYPITKLIGIGGTATTISAMVQQLDV
FT                   YDMEKVHQSLVMYEEVEAIFKDLKYKTLDERRMIKGLQPQRADVITAGVNILKNLMSYL
FT                   EMKDILISEYDNLEGLVYTKNKN"
FT   gene            complement(396279..396410)
FT                   /locus_tag="CLOST_0346"
FT   CDS             complement(396279..396410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0346"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20476"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20476.1"
FT                   /translation="MLLSIYMMIEKEIDRLKFIALIMTEDYEILLKMLDKLKIVADG"
FT   gene            complement(396304..397143)
FT                   /locus_tag="CLOST_0347"
FT   CDS             complement(396304..397143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0347"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20477"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20477.1"
FT                   /translation="MKLFSSKKKIAIIGTMLTTMLAGTIAYAATPIKQDAYYDTFKLVV
FT                   NGTEQFISDTALKPFIANSRVYVPISTLQNLGIANVQWTPAATGQAASLSVTPKGGTAS
FT                   GEVALYQQQLAALNTQLQAKESEITTLKADKTKLEAEVDKLKSSSSSSSGDLSTRDLQD
FT                   LEDILNDDRDFEEFYVDSTIRDIGFTYEVDEYRGDVEINMYPDIEITSSILSTLKTDSV
FT                   ARAFDSFIEDIGEEAERKFKDSDVIINLYDDRERNRPSEIHSFDYDGRLRDTIKDAR"
FT   gene            397697..403564
FT                   /locus_tag="CLOST_0348"
FT   CDS             397697..403564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0348"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20478"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20478.1"
FT                   /translation="MNTKNLRTLPEAKIDAGDSYFSVEFSTVSGDNTASANLPILANNI
FT                   LNTSNVIGSQEYEIKFGTDYPTLSVSDRKGYLGKPYKLSGQNLKDKGDYINEKDSFFIV
FT                   GNRQNDDYSVDGNQVTINNLKGDPGLGRDITIRIDFQDSGNLYRPTNTSPEQTVQVKSY
FT                   YEFTLEKVIDIKKPFDGLDYMSVVPKKGTYKGGTTLNITAMANADPDDPDPAIAATSVP
FT                   ILDKDIFKDTMRVRLVKKDDPTKIVQTINPLVVKNPAGQGIGLTVDTLPVSINDVNEDF
FT                   HMEIYNVFDNNEESIKQNAFRYMEGGSSLDLASILPPKGPDGGNTLVQIKGINLLNIDE
FT                   VEDIVVPDGTVPNGEILFKPSSTTIGPDPNDKEWLLISYIVPSGTTYGGKPVDTIYRKV
FT                   RVYIGRNALPQQLNILDTEPTPIDSAHFMSKNPKLDGVVFKTQGLDASVQQTYDVNVET
FT                   KTYIKLVGMQEYPPIVERDILEGKYTFDRTTVNPTVESVEPLYGYYNNLGALGLDQSAS
FT                   ADKDNVKPLMLRLKGKNFEVRRELNPVTNQYEPIYPKIEIRNNEALAEEFKTPLGEPVF
FT                   RDAADIENKTKVIKVLKADGTVVDGQGQNRFGEIMVIEVAPQIDVTQFSSFILQQGTEG
FT                   NGFKDLKARFAIIQKSGNNNGSIASEPTFDFRYPTNSDKQKQPHIENVYYAGSPTRVIN
FT                   SDLENEITVRFISYPVTNLDKVVVTIDGMDMKDRIIKRDYDEDGSGYAYIILKTPKGIS
FT                   GKTRLEVISLEGLMDSYNLDFQPVNGPFLKELIPNNGQAGTWVVVKRNDDINNIGFIMP
FT                   QNNDPNTASKILIDGQPISGAIVKDSNTMVFQIPENTTLGNHNIQVENPDKSRSQGLPF
FT                   LVRDVHGDVVEIQSIDPDHGDLKGGIPSTITAKPGTNFSGGVDVYFGSQKAKIIGTNLD
FT                   FTEVYVDVPPLVDIKLKAGEQYTVPVTLQKKESGATATVKEGFTYFNPTYSDLMKITSV
FT                   YKKDVQPKTNKGNAGDLFWVEGDNLLGVTTGSALSLELQYPDIYFGYSKVEIVDKEEPG
FT                   TLGQIHRFPRILVKIPPKPLNIAQDGSLNVMVINPDGGTAILEKGFIYNQGKPEIIEND
FT                   SMLKASKFFDEVKISAKGVYKNDLIVAFGDKSNFMDLTSTEDYFSLFKPKGDDSDVVNN
FT                   DVEKIVIKYLPKATDGKNFEIYYDDQNGNLVLMNDAINTDNGKIALNKVGEKVIVGVNW
FT                   KNPAYHKNSTLNSNPDLISKLNTEYISLEIVQDGRVNKVVGRRGLGKILNYSVNNSTNV
FT                   ASLVVATPYHSISGKTTITVINQDGTFDTAPFEFHGGTDAPVITDLEGSKERTVEIDGV
FT                   QKKVQVKTQDYTVDGTVKIIGKNFKDVQSVKFGTKDVKIESVSPDYTYMIVSVPKATQG
FT                   EVGKPLEVIVVTKEGNGFSSKTVPPVYFMYIAADSKPVIETVSPVVGPRTGGTLVTIKG
FT                   KGFREKDEFGVISDKVEERITITVNGSMPAGLKSTVKNEQGEIVELKVIMPPSVTGKAK
FT                   LQVVNADGGTSEPKDFTYVSQPKISKTEGSIFFNDTTTEVRLFGEDFLSGAKVVIGAEQ
FT                   TKGKKPADASVTGMLGVTTDGINQEAHLVGGVEAANVTVTGTNQITFKMPDGIESLENT
FT                   SIIIVNPDTGMSEPGQGNIKPPVPDVPDIEAIPGFERTMLLRWKVDKDVLNAAEKFEIY
FT                   VRERRSGDYTFVGDTKQDTTEQSYVIKGLKYDTTYDILVRVLNKYGEAEDFASVRETTL
FT                   RQSQDYKEKEKVDAVDDAVYEIETQGKQEVIGDTLYYTVGTRESTINLSNTTAKNKTKY
FT                   VQIPVKDIKSGNKTITITDKDLSLTVSYSSLNTPELRNAPDDAVFRFKISAAEKQVEEG
FT                   LTRAIPRVYKKASNVYGIYFELAQPKLVTPIAMLSGSATININAPAYPKYHAVYIESAD
FT                   TFSILQSNIITQGGNYVLLTNK"
FT   gene            403542..406010
FT                   /locus_tag="CLOST_0349"
FT   CDS             403542..406010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0349"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20479"
FT                   /db_xref="UniProtKB/TrEMBL:E3PUZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20479.1"
FT                   /translation="MYFLQTNKKEKTRILGLFLSLIMILSSAVTSWAAYDDVSPYPVYR
FT                   GLINPQENMLKMTVTDASGSTLPYFALGTGVMSVTNTRFNPFAPMTEMDVLAAVVNASG
FT                   MSEQIEPNPTNWRTGYIDMATQMGIITDVDLAEYSDTPDTPFTKLATAEKFNKWLSTGL
FT                   QKETKYKLLPNATVRRIDAAELFHNNQELVAPAKGFTLLKGEIVDQKTITEDGVNKIAT
FT                   SVKQDTGGYITILSNQDIPVVKNGQISLNMTNLSKGEVASFYYKNNQVQFAISEVTTAQ
FT                   TINGTFQSLNGDTLTILDFNNQIRTYKTHPNMVILEVEGELDNQGKSRTIAAKDLIFNQ
FT                   DMQLAVKNGLVHELKTFVPRDSDLDGYIPAESKLIAGVVLDVTANYVTLTDNKQYYINP
FT                   DTFILRNGELTDYRDIKEGDRVKLFFDDIYAPMVTRAEVEGPQRQVDTIIKGTIDSYAL
FT                   GRGELALKSVTKLNGDRWVAADTSYTKLKLSGDIYDGSKKLTAAKLKDYKGQEIYAVLA
FT                   KNQNNPTIEKANIRRGSALSFSDEISQVDYPGSYLNIETNLINYTEGTLIVKDGRIVAP
FT                   GNLQADVGAYVESGTNKNASLIVMNNTQYSSDNREYPYKIYRGTIEDIFDYSIELGNDK
FT                   DDRYYYEMRGSVWASFRARSEGPRISYNDSTTIYDSDYNRGKGKEIPVRDFRDYKYEGS
FT                   KYDDEDPVYYDRQVYVVTKDDVAISINFLSESGYDEVNTQNVMTGKVKAVDITAKTLTL
FT                   SEISKYNSLREIFVPQQTEELIDISKASIISGNKELPKLSAEQLIGKKIRAVYKQNTTR
FT                   KNNGIVIIVD"
FT   gene            406244..407665
FT                   /locus_tag="CLOST_0350"
FT   CDS             406244..407665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0350"
FT                   /product="S-layer domain protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20480"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20480.1"
FT                   /translation="MKKFFSTILAGLMISSLSVSSAYAEPLGGFDPGIENLQGYQEVVF
FT                   LTGRPILMKGTVKTSVKEKDDERTEKYTYKLEDASGEFTLSRSLSLTATLQDNYGQTVE
FT                   VAEVDSFKETIKLGDATYSADDKTSEFTQSIIYDNKPAVSYYAGNMAYRKVYKGDDETP
FT                   DITVDMEGSSVGYDQAWGNTETRTMNYYISSSDSKGIQGSYTVKNSNNVTKDIVYAQNQ
FT                   PTQISFRGGYMISEKDESVMEYSYDINSRVGSNSLTLANNPKFTRLNVPELRDTSGHWA
FT                   EEPIKILASLNAISPNAKNFAPSLAISREEFAKAVAVVSDIVEEETTVRRSKKNQEQPL
FT                   FTDTAMDSEKYKYVKAVATKGIMGGVGEDRFEPKGELSKAQAATILINALGVEALAPNG
FT                   AYSTGFKDDYSIPYWAKDSVYMARNLRLIDGTENGFFQPNKSLTRAEAASILNNYIHYL
FT                   SYDLREDFRERIVNY"
FT   gene            407681..408799
FT                   /locus_tag="CLOST_0351"
FT   CDS             407681..408799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0351"
FT                   /product="carboxy-terminal processing protease (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20481"
FT                   /db_xref="GOA:E3PV01"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20481.1"
FT                   /translation="MKKLRQTLTLLFTIVILSTNLAYADPITKDKEFFDAVKEYIMQNY
FT                   ALEVTEDQLYDSAIKGMFDALDPYSTYMDEEEYKAFMEEATGEFAGIGAVVGKRDDGFY
FT                   LVSINEGSPASKVGLKPMDILISVNDKAIDLKQDTESLVKQIRGQSGTSVKLTVKRGNE
FT                   VLTVNIVRAQIQVNPIEYKTLEKDLGYIRITEFNNNTYNNMTTAIQDLKKQGIKKIILD
FT                   LRGNPGGSLDQVLKVSNYFVPKGKLLEIQYKEDKPDAFYSTGNLQFEKVAVLIDGNTAS
FT                   ASEILAGAIQDTKSGTLIGTTTYGKGVVQDLYPLKNGEAIKLTIAKYVLPTGRSINLKG
FT                   LNPDKKVEYIMPINNSNTDNQLITAIEFIKQK"
FT   gene            409083..411203
FT                   /locus_tag="CLOST_0352"
FT   CDS             409083..411203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0352"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20482"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20482.1"
FT                   /translation="MKRKLSLLMVLMMMLTLVPANMAFAASDAVVNTVVTSADGTVDFD
FT                   LDIEIKGAGVTSGGIFELTLGDDAEWATAPNATGGATLRNAATVVGEQRAEYVINADAT
FT                   TGNIKISGEVTLDGAKDGDQKVTIENITNSGVSRQVLTYAVVSGSGTIVSRRLGDVTTV
FT                   TRGTKDASDFELRETTKDAMSNGTFVLRLPKDVEWAAGTTVTLNGNGLAVSAFGDRELT
FT                   VTVAGALDTVIDRIIVSPEVTLTKDAKFGDITVEVLDKTADVDAEDVKIAEYKDFGIEL
FT                   IVDKVESIVAGKSDTSKDYVVEVKLETAGNSFIAGRPIDFTVAGGDVKLKGSAPSNTSF
FT                   DNIVGDYDDEFEVNLTNAYTTDNDLKFELYLKADWDAAGELKITAKGAGVEEQTIKLAD
FT                   VLAAAKITTKVDDKKTVADVVVGLQNQATPEITITETEAGSLQEGYYVFDLNQARYTGV
FT                   EFIDSTVKFETTGDISVDDVYTIENGEKVVVYIDGESNKEASSIVIKGLTATLDRAVPF
FT                   GQLDLRFGAVVADGDQTTPTATDGEFGLDPEEKGFDYDVETIVEKVPFLNVVTEVQTAR
FT                   QQKTVFTIDSATYTVGSETKMLDAAPYISNNRTMLPIGTVAQLAGATLNYSPSTRTAVF
FT                   TKDNLVVSMNLDTNILLVNGSPVPMDAKPEIVNGRAFVSVVYVAQAFGIQNGTDIVYDA
FT                   ASRTVTLFPNAQ"
FT   gene            411408..412163
FT                   /locus_tag="CLOST_0353"
FT   CDS             411408..412163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0353"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20483"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20483.1"
FT                   /translation="MKKILAIALGLFVGLSTFSYATPKVVEAYLQNDFLIKVNGEFKYH
FT                   PEGLKPLVYQNRTYLPASYIAQLLGANTTFDSDTKTVSINSNPDVGIEQEKIKEYEEKI
FT                   KILEEKIEKLESSTSANSDYTKLPARIAQNGYKLTLEGLSIREEGNDGRLYFTLENEDA
FT                   DTGVKIDAMSTIIETSTDKYEASFQFQENLDRDLFKWIRRNEELKTYIPFSKLPEDDKE
FT                   IREMTVTVVLEVNETYPKKETLTFKVLND"
FT   gene            412185..413330
FT                   /locus_tag="CLOST_0354"
FT   CDS             412185..413330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0354"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20484"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20484.1"
FT                   /translation="MNKNITKIGISLVLIFSIVNPNFIYANKAEMPIAENLEILSYDEA
FT                   IKLAFKENNDIKNLKLEKDSNTIKIDDALDNFGTSLYDPQVLALMKLQKNDKLNTEKVE
FT                   RTENYIKQGLAFKIKSIFNNINLIKNDIELKKLQLDNSIKKRNTMALKLEYGMESKTNI
FT                   TTKDIEISQSKKDIEALEKDLDDHYIELNKLLGFDRFTRYEIEKLDFEYSPVNDTQEDI
FT                   DFKVTRAISSDINIWGKEQQLDIQRIDVDFYSLNYISGAPSNQQSSPEPYESLELDARI
FT                   SSNDLEQAKEDLKDSVIGKYNSIKKLENTYENTLLKLKDLEEKKRVLEVAIKAGTAINQ
FT                   DYLDLTLGLIEIQNGIEKIQSQHALLVEMYNNPLLVGGNIG"
FT   gene            413504..415432
FT                   /locus_tag="CLOST_0355"
FT   CDS             413504..415432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0355"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20485"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20485.1"
FT                   /translation="MRKLSNSKDTNIKKDSIKKSKVLSYGHNGDFYYEIYKIIPLLFIV
FT                   GLLPFVIRLKIIPLEGPFYEFWNGEKINADFFTYYKQIFIYIVTCWAMLNTFLFTKKIK
FT                   FTKAYYFMGTYAILIILSTVFSKYPQITLNGFVERREGMWIVLCYLLLMFSTINLVETE
FT                   KQIKAIIYTLGISGVIISIISIFQYFGMDIFATEFAKDYMISKEIQAQIKEFNIQFGEK
FT                   YSYGVFYNPNYLGGYISFYAPLMLSFAIISKNIKEKIIFSIFFILSILALYGSRSEAGV
FT                   LGTIGTVLLLILVVIARYIIKDKPQEEYKKIMFAKFVPILGVLIILPVSLSYIPISQNP
FT                   LTRIRTEAVALFKPSDLKSKDYKEIGPINDIKHIDDKMIEIVINQSSTYIKIDDSSNIN
FT                   ILEEDKVVWNKNIDDLIDGEIYILDSHESYQAQLLLNKTEYSDVYGIKYSANPYGVDLY
FT                   FIFDKGKLNIADSFYKKLDINRDLQPSKHIGFTGKGMIASGRGYIWSRSFPIMIENLLI
FT                   GTGQDSFVIEFPRNDIYGRQVDDHLTRLWIITDKPHSFYIQVGVQSGVLSLIVILIGIF
FT                   LLLYRNIQDTFFSDVKYNWNIMSLGIVGYLISSVFNDSILAISPIIYIFIGICISLTIK
FT                   NSKERIL"
FT   gene            415432..416460
FT                   /locus_tag="CLOST_0356"
FT   CDS             415432..416460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0356"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20486"
FT                   /db_xref="GOA:E3PV06"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20486.1"
FT                   /translation="MEKQEEISFADLTHILFKKRIIGFKVFALVAILTFIYAFSPLFEN
FT                   NYKYEASSSISIIYNYKTPTNPEEISEGYVYYQDRMQNNMIPTIKGYIESYTLLRNVIS
FT                   ELDIKNKKGEYLRVKKLKENIEIVNPNGSNLIMISVKDSNNKIAEDIANEIPRKLVEMA
FT                   KANENLKDYEIVIIDKAMSYKLNSNTLPIFLIFGLAFGLVLGIIASFISTYYSKRIQLP
FT                   SYLTENGFEVDLILNKQLSKTEIDKILYFVMLANFESVLIGLDDNIEKYNIEYIKEMFD
FT                   ENEIKINILNYTDNNFLVQSKLYDKTFIIVEENFTNKDHINQISNLNSKYNLGINAIYI
FT                   EK"
FT   gene            complement(417433..417555)
FT                   /locus_tag="CLOST_0357"
FT   CDS             complement(417433..417555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0357"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20487"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20487.1"
FT                   /translation="MPFDLTLVYIHPKFDNKNIVPMKTNMLKINILETKILPAP"
FT   gene            417682..418509
FT                   /locus_tag="CLOST_0358"
FT   CDS             417682..418509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0358"
FT                   /product="HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20488"
FT                   /db_xref="GOA:E3PV08"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20488.1"
FT                   /translation="MELMFITNKVEEAVSAEQAGIDIIFVDLEINGKKERQGHLDTHIA
FT                   DHKIEDIKLIKSKITKSLILVRVNPLYNKTHEEVNIAINYGADIIMLPMFKTENEVKEF
FT                   IKIVDKRAEVCLLLETPQALSRIKNIIEVKGIDRIHIGLNDLHLGMGLDFMFELLSGGI
FT                   VEYLSDTIKYKDIKFGFGGIAKIGQGDVPAEIIIGEHYRLNSQSVILSREFREKVIHQD
FT                   FTNNLIKEIKKIRDIERKIKTWSEIDFARNREEVIERVNEVVSKKQRIYNEKK"
FT   gene            418463..419077
FT                   /locus_tag="CLOST_0359"
FT   CDS             418463..419077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0359"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20489"
FT                   /db_xref="GOA:E3PV09"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20489.1"
FT                   /translation="MKLFQKNNEFITKKNNFYIKFGKRAIDLIIVFPSIIILSPIFIVI
FT                   MLLISIDSEGSPLYKQERVGQFGKAFYIYKFRTMLKDADKLGPKRTSQDDNRITKTGKF
FT                   LRRTSLDELPQLFNVLKGDMSLVGYRPGVYEDYPQEYIQTEIFKFKPGISGYAQINGRS
FT                   NLTQDLKLYWEKEYTKDISFKTDLMIIIKTILNVLNKKDVN"
FT   gene            419102..420919
FT                   /gene="asnB"
FT                   /locus_tag="CLOST_0360"
FT   CDS             419102..420919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="CLOST_0360"
FT                   /product="Asparagine synthase (Glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20490"
FT                   /db_xref="GOA:E3PV10"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20490.1"
FT                   /translation="MCGIVGQFSIDEKTNLLSKTEELSKMLESMIHRGPDGEGKYESKN
FT                   LIMGMRRLSILDLDNGFQPIFNEDKSIVVVFNGEIYNYIEIKDELLKKGHKFYTSSDTE
FT                   VLVHLYEEYGEDFSSYLNGMFSYTLFDIKNNVLIVSRDRVGEKPLYYSIMNDIFYFSSE
FT                   IKSLLLCSDIKCEANKDSINDMLTFNYVPYPNTAFKNIYRLEPGKSIIIKNNKISKKTY
FT                   WEIPKKSIYNNNFENFETLDSLISNSVEIRMRSDVEVGAFLSGGIDSTIVTKYMREKTE
FT                   DSFKTFSIGFTEEIYNELDYAKKVSETYNTNHIYKIVNQDDFLEQLVNSIWFCENPHGD
FT                   VSFAPTFILSELASKYLKVVLTGDGGDEIFGGYDKYLDFIYNQELDINENFKNYFNKIS
FT                   VFNILEKESILSNEFKSDLIEIDSFKKIEEKYIGIHNSDFINKIMYFDSDYLLEGNNLV
FT                   KPDRMGMANSIEGRYPLLDYRIIEMMFNIDSSKKIYNGEKKYLLKNILSKDFDDDFIKR
FT                   KKQMFTVPIGEWFKDKEFIDKINPIICSEKFKNRGVFNYDRVLKMIQSHQNSQENYTRQ
FT                   LRAILVVELWYRIYIDNKFTKKPSFNDLI"
FT   gene            420932..422119
FT                   /locus_tag="CLOST_0361"
FT   CDS             420932..422119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0361"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20491"
FT                   /db_xref="GOA:E3PV11"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20491.1"
FT                   /translation="MKKKIFIPVYGGGHCKLIISLYDSLIRKFDVTILALTLAEEYLSN
FT                   HEIPYKTLKDYLEYIDLGDNIVQLGDQFIKENNIDYERIGLYNSSIYYGCNIRDYILKY
FT                   GEDDIVDSYGKQNRLIFLPINTMEAILKIENPDAVLTTNSPRFERASILAAKNLGITNY
FT                   SIEDLLGNSRVFSLKDTNTDYYGDYIFVLNNFVRENLINQGVKAKKIVVSGLPTFDNLK
FT                   NHYTDIFNFKQRYGIDLNKKIITWASHVSEDEIYIFEELLKVFTLNNEYLLIIKPHPNE
FT                   DYSYMEKMLAKIHTNSIRLIENCDIRDLINISELLLTQYSTCGLEALFMQTPVIVLNPF
FT                   DKKYDTDYSSLNIASKCQDLSKILINIEEKKQYHLNFEVINNSINNMINFIDNTI"
FT   gene            422147..423127
FT                   /locus_tag="CLOST_0362"
FT   CDS             422147..423127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0362"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20492"
FT                   /db_xref="GOA:E3PV12"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20492.1"
FT                   /translation="MKKLLITGADGFIGSHLTEELIRQGHKVKAFAYYNSFNTWGWLDT
FT                   LPADIMKEVEVFTGDIRDSNGVREAMKGMEEVYHLAALIAIPFSYHSPDTYVDTNIKGT
FT                   LNVLQAARDIDISRLLITSTSEVYGTAQYVPIDELHPFQGQSPYSATKIGADRLAESFY
FT                   RSFNMPITIVRPFNTYGPRQSARAVIPTIITQLLAGKEEIELGSLTPTRDFNFVKDTAN
FT                   GFIEIAKSDKTIGEEINIATQQEISIGELAQELIRQINPNAKIICDNQRLRPEKSEVNR
FT                   LLGSNEKIKKLTNWKPNYTFEQGIAETVEFFKGNLDKYKTDIYNI"
FT   gene            423129..424262
FT                   /locus_tag="CLOST_0363"
FT   CDS             423129..424262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0363"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20493"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20493.1"
FT                   /translation="MEEKFMKYCKKCVMPDTRPGIKFNEEGICSACQSYERRKGIDWGK
FT                   RYKELEALCDKYRGMNGDSFDCAIAVSGGKDSHYQVYLMKEVMKMNPILFSVEDNFKMT
FT                   EAGKHNLKNISEEFGCPIISLKPDIKAQKKLMRYTFEKYGKPTWFIDRLIYTYPMHMAL
FT                   KFNTPLLVYGENVSFEYGGSDYEETYSARNQLNNGVASDIDANELLEIDGITKQVLDLT
FT                   KAPSIDELNKLDPMYVSYFIPWNSYSNYIFAKTRGFHDLTHEWNRTHHIENFDQIDSRA
FT                   YLVHSWLKYPKFGHASATDYAARFVRYGLLSREEAIELVKKHDHALDVNSVRDFINFAG
FT                   YTESEFWEIINKVYNKDIFEKNIFGEWKLKTPIWNEK"
FT   gene            424272..425435
FT                   /locus_tag="CLOST_0364"
FT   CDS             424272..425435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0364"
FT                   /product="aminotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20494"
FT                   /db_xref="GOA:E3PV14"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20494.1"
FT                   /translation="MSDKFIPLSVPNLKGNELKYVTHAVETEWVSTGGPYINEFEEKIA
FT                   EYAKCKGAVSCQNGTAGLHTALIVCDVTKDDEVIVPTLTFIAAVNPVRYVGAEPIFMDC
FT                   DDSLTMDVDKLRTFCENECVFQNNKLMNKTTKKHIKAVLVVHVFGNSADMESIMEIAHT
FT                   FNLKVIEDATEAIGTYYISGKYKGKHAGTIGDIGVYSFNGNKIMTTGGGGMIVSNNEDL
FT                   LSRAKHLTTQAKSDELYYTHDEIGFNYRMTNLQAALGLAQLEQLEDFIKTKKRNYEYYK
FT                   KELNNLDGLKILNFNEDIRPNYWFYGLYIKDSFKLNRDELISYLASHKIQTRPIWGLIN
FT                   EQKPYLDVQVYQINKAKDYLNHIINIPCSSNLSIEDVTMVINCLKGI"
FT   gene            425470..426516
FT                   /locus_tag="CLOST_0365"
FT   CDS             425470..426516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0365"
FT                   /product="Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20495"
FT                   /db_xref="GOA:E3PV15"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20495.1"
FT                   /translation="MNIKDFLIDEDKSMIDAMSQLDLVAKKILFVTKDDKFVAAITDGD
FT                   IRRWILKKGNLDANVRDIANYSPKTMLIEDKNKAKDYMKINEIEALPIIDNENNIISIV
FT                   LWNDEEIKNKKELDIPVVIMAGGLGTRLYPYTKILPKPLIPIGEIPISEHIINRFNKYG
FT                   CKEFHLVVNHKKNMIKAYFNEIEKDYIINYVDEDIPLGTGGGLSLLKGKINSTFILSNC
FT                   DILIEEDYEKIYKFHKDNNNLITMVCSLKTIRIPYGVVEINKNGEIEEMKEKPVLSFFT
FT                   NTGMYIVEPKVIEELNENEFIGFPDIIEKYKNNGEKVGVYPISENNWLDMGQIDEMEEM
FT                   RRRLEKDE"
FT   gene            426509..427156
FT                   /gene="epsM"
FT                   /locus_tag="CLOST_0366"
FT   CDS             426509..427156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsM"
FT                   /locus_tag="CLOST_0366"
FT                   /product="putative O-acetyltransferase"
FT                   /function="16.8 : Protect"
FT                   /function="16.5 : Explore"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20496"
FT                   /db_xref="GOA:E3PV16"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20496.1"
FT                   /translation="MNKKILLIGGGGHCKSVLDTLLLLNEYNEIAIVDLFENIGNSIIG
FT                   IPIIGADTDLAHLFKDGYEFAFITMGSIGNPRLRIKLYDEISSIGFNIPNIIDISANVS
FT                   NFTKLGKGIFIGKKSIVNAGAIIGNGAIINTGSIIEHDCKIGEFVHIAPGAILGGAVEI
FT                   GKNSHVGSGAIIKQQIKIGDNSVIGMGSIVTKIIGNNKKAYGNPCREVNDYE"
FT   gene            427149..428144
FT                   /locus_tag="CLOST_0367"
FT   CDS             427149..428144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0367"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20497"
FT                   /db_xref="GOA:E3PV17"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20497.1"
FT                   /translation="MNSYIIAEAGVNHNGSLELAKNLVDKAKEAGADCVKFQTFIASQI
FT                   VSKNAVKADYQKKQTANSESQHEMLKKLELSFDDFIELNNYCKEIGIEFLSTAFDFESI
FT                   DFLNQLGMKVWKIPSGEITNLPYLIKIAKLNKKVILSTGMSTMREIEDAVNILKDHGAS
FT                   ELIILHCTTEYPTPYEDVNLNAMLAIKEKFGYEVGYSDHTMGIEVPIAAVALGAKVIEK
FT                   HFTLDRTMDGPDHKASLEPSELKTMVDAIRNIELSMGTGIKEPADSEKKNIAIARKSIV
FT                   ANQSIKKGDILTETNLTVKRPGDGISPMKWFEIIGTKAIRDFEEDELIEI"
FT   gene            428141..429310
FT                   /gene="neuC"
FT                   /locus_tag="CLOST_0368"
FT   CDS             428141..429310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuC"
FT                   /locus_tag="CLOST_0368"
FT                   /product="Polysialic acid biosynthesis protein P7"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20498"
FT                   /db_xref="GOA:E3PV18"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20498.1"
FT                   /translation="MKKIISVLTATRAEYGLLKPVIKKLNKIEDFDVRLVVTGAHLSPE
FT                   FGLTYKEIEADEIYIDEKIEILLSSDTPSSISKSMGLAMISFADYFSKLKPDLLIVLGD
FT                   RYETLAVAMTAMNQRIPIAHMHGGETTEGAIDEAIRHAITKLSYLHFASTDEYRNRVIQ
FT                   LGEAPDRVFKVGATGIENIINEPLFTKEELELQLGISLDKKYAVVTFHPVTLENSTTKD
FT                   QIIELLEACKNKDDINFIITKANADADGRVINTLIDYYASNTSNIYAYTSLGLKRYLSA
FT                   LKYCIMVIGNSSSGIVEAPSFGVPTINIGDRQKGRIQASSIINCEPKKEQIMNSVEIAI
FT                   SDSFLNIAKNTINPYGEGNTSDKIVRIIVDFLGNNKINLKKKFYDCEAK"
FT   gene            429312..430013
FT                   /gene="neuA"
FT                   /locus_tag="CLOST_0369"
FT   CDS             429312..430013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="neuA"
FT                   /locus_tag="CLOST_0369"
FT                   /product="N-acylneuraminate cytidylyltransferase
FT                   (CMP-N-acetylneuraminic acid synthetase) (CMP-NeuNAc
FT                   synthetase) (CMP-sialic acid synthetase)"
FT                   /EC_number="2.7.7.43"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20499"
FT                   /db_xref="GOA:E3PV19"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20499.1"
FT                   /translation="MKNLAIIPARSGSKGLKDKNIKLLNGKPLISYTIEAAINSKMFDE
FT                   VMVSTDSIEYAEIAKLYGAKVPFMRNSELSNDTASSWDVVRDVLHKYKKDGKEFDTVAL
FT                   LQPTSPLRTGKDIIEGYKVLKDKSANMIVSVCEVEHSPLWMNTLSKNNSMENFINSNIV
FT                   GLPRQELEKYYRINGAIYIIKTEYLLKTNNIYKDKSFALIIDKKKSIDIDDELDFIIAE
FT                   ILIKSTNLDTL"
FT   gene            430023..431540
FT                   /locus_tag="CLOST_0370"
FT   CDS             430023..431540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0370"
FT                   /product="Integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20500"
FT                   /db_xref="GOA:E3PV20"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20500.1"
FT                   /translation="MKKTALLIMIITLFSKLLGFGRDIFLSYFFGASGITDAYLISLTI
FT                   PSVIFGFIGIGIVTAYIPMQTKIVLEEGEEEGSKFTTNFTNAILVLTTIIFSFGLIFTE
FT                   NIVKIFALGFYGDTLMLSVEFTRISLFGMYFTALVSIFSGYLQIKKNYVIPALAGFPFN
FT                   IIVIISIFFASKGNYKILAIGTLVASASQFIMLIPFIYKEKFKYSLYVNFNNDKLKRVL
FT                   YIALPSVLGASANQINTLVDKTIASSISVGGISALNYADRLNIFIQSLFVLSIVTSMYP
FT                   IISNYASINNIKGIKETIMEAISIISLVVIPITVGAIFFSKEIITLLFGRGAFNEQAIV
FT                   MTSLALFYYSFGMWGYGLREILSRGFYSIQDTKTPMLNATFGVVINIILNIILSKYMGV
FT                   GGLALATSISGSITALLLYISLQKKIGYFQNRKLIISLIKILIASLIMGTIAKKSFELM
FT                   SNSINFGFSLIASIFLGVLVYFIAIFIMKIEELNNITTIFKNKIKKA"
FT   gene            431569..431817
FT                   /locus_tag="CLOST_0371"
FT   CDS             431569..431817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0371"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20501"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20501.1"
FT                   /translation="MEQKVNSYRIEMLDYLRGIMAIAVMSYHLLIPLTYSYVISNYKLI
FT                   FLNYFFLFAWVDPISYIAIGAWSIGNECVLQQLFFVK"
FT   gene            432246..434588
FT                   /locus_tag="CLOST_0372"
FT   CDS             432246..434588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0372"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20502"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20502.1"
FT                   /translation="MKKILLGLIILMICLLSAKSLKEKHDLYNLEFDLKDNQIYLTWNI
FT                   VNEEASYLLTIYEDDIQVYSQWVVGNNFVIKDDFSGDHIEFKVAASGREYSKSVNYIKF
FT                   KPVLYNPYGTIEPSEISFSWSSDKNIKFYNIEISSLTQKYEKIYKTREDFLILPNILPG
FT                   EYKWRVIPYTDIKTKGIESEWAYFNMSPYPLDESNIVGIEKNIKTSYLSTSLTYPESAM
FT                   MDENGSIFISDTHSNVIRKCSDNISDIVVGNLIAGKNDNEDPSEFMLNQPGGIIFDSDG
FT                   NLIFSDMGNGRLCKYDIKKDNIEVLWNHGEWVKNVYLESDSSLTILTASGKIINNKHGA
FT                   LFNKYRFKYPSSMIREGNKAMVLDSIKNELVLFKEDIFVDKISLNNHSSALFIHKGDIY
FT                   LGEHTTIYKLGWDFSKEVFSDGYANVSNISLGKNDELLVTDSDAGNVYTLNLLTKKKNI
FT                   LVGAKKLFGAIVEIEKSGDHLYLLDNQASIVWKYNLNTGLTERFIGNGKSEIATLGANR
FT                   LETGLFYPTGLTSDVNGNFYIAEQHHILKINSKGVVEIFAGRLNRDEYGYKDGESQEAL
FT                   FQSIRGITFDDRTKSLYIADTYNNRIRKVQNGIVSTVAGNGATGEPEFGEKATNTYLSR
FT                   PHDVIIKNDEIIISDSWNNIVSKVDKYGMLHPLVGKVKYTGYQGNGSYFGENINSLNSL
FT                   LNTPLNLFYDGEVLYVIDSFNNRVRVIENGKIRTIIGNDFKGYDSENASILNMPTAIYV
FT                   DDNYIYVADSGNYLVRKYSKNKYSNDN"
FT   gene            434700..435590
FT                   /locus_tag="CLOST_0373"
FT   CDS             434700..435590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0373"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20503"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20503.1"
FT                   /translation="MDNYFYNVALKGATHIVDSNEKARFISIDEGTKPIYRQITTPPNL
FT                   LYIDLPENNTFITDDMGMAVFEIDKFGNVVWEQKQKDKTYFGIIPINLNEIVFNAYSYG
FT                   RVEKLNKVTGEANIIYDGYMRDIVPAEGGNLLLVGHEDKGKAVIIDVEGKLIWESNPEF
FT                   YYPRGVWQKEDGNILIVDFRGKAYEIDYYTKNIIWEMKGFNCPNSIQETINKNYLIADE
FT                   HNNRVVEINPINKKIVRTYSRDLWSPNYARELKNGDWLICDTDNNRVIQINNQDNMVWE
FT                   LSNMHTPNRAVRLEP"
FT   gene            435932..436606
FT                   /locus_tag="CLOST_0374"
FT   CDS             435932..436606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0374"
FT                   /product="Cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20504"
FT                   /db_xref="GOA:E3PV24"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20504.1"
FT                   /translation="MKELFRKDYPMFKLVLNSKPDILDKWEVLDFEKDEVICKYNDVYE
FT                   YFCVLLKGSINIYHTSEKGKTYSQSVYKEGSYFGELEIFHSLPYVCEIKAMNRVRLIRL
FT                   KKCYFEKWINSDNEVAIYILKSLCKTSYELSKKAIVDTLYSLKFRICDYLITSYESRVK
FT                   KEHNKFYISKDHLSEHFVVTRRSINRILKDIHDKGYISVYRDKIEILDIDSLIDERESE
FT                   RY"
FT   gene            436645..437667
FT                   /locus_tag="CLOST_0375"
FT   CDS             436645..437667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0375"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20505"
FT                   /db_xref="GOA:E3PV25"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20505.1"
FT                   /translation="MKKKIFGFVSMFLIMAMVMVGCAGNQPAEQSEEPAAEEASALKVA
FT                   LVVAGGLGDRSFYDSSNEGLKMAIEKLGVEGKVLECKNDPTLYTDQLVQASTASDVVVV
FT                   VGFEFYDVIQEVAAEFPDKKYVYIDNVIENVENITCIDYKENEGSFLAGALAAMESKTG
FT                   KIGMVGGMDIPVIRNFQVGYEAGAKYINPDIQVETIFAGDFEDPAKGKESALALYAKDI
FT                   DIVFQVAGKTGEGVFEAAKDTGKFAIGVDSDQRYINPDAIIASMIKGVDISIYETIEKI
FT                   QKGEFESGNVYEYGAKENGVRIAYGTEDMPKLVSDETMNQIQELTAMIIQGDIEVPEAN
FT                   "
FT   gene            437736..439256
FT                   /locus_tag="CLOST_0376"
FT   CDS             437736..439256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0376"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20506"
FT                   /db_xref="GOA:E3PV26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20506.1"
FT                   /translation="MSEEIIKLIGITKRFPGVLANDNVTLDVRKGEIYALVGENGAGKS
FT                   TLMKTMYGLHQPTEGEVWIKGKRIEDFSPSTAIKNGIGMVHQHFMLLPSFTIAENIVLG
FT                   KELRKNRVFLDKDEANKKVISLSKEYGLEVDPKLKIEDASVGLQQRVEILKALYKGADI
FT                   LILDEPTAVLTPQETKELFAVIKKLVKEKDMTVIIITHKLNEVIEISDRVGVMRAGKLI
FT                   GVENTKDVTEKILAEMMVGREVLFEHIDKNDAYGDILVQVDNLWVKDNRGFDAIKGISF
FT                   GVRAGEILGIAGIEGNGQSELIEALTGIRKVEKGKVYIKNKEATNLSSKKIREMGTSHI
FT                   PEDRLTTGMSKDSSIEDNILMGKQHSEEFATKGIQLKRKSIKKYAKDLIEKFDVRTASE
FT                   EVKMGSLSGGNMQKVIIAREFSFDTPILFISQPTRGVDIGAIEFIHEQIVKKRNEGCAI
FT                   VLVSAELDEIFRLSDRIICLYEGNITGKFKNGEISKLDIGYYMTGNRN"
FT   gene            439269..440330
FT                   /gene="yufP"
FT                   /locus_tag="CLOST_0377"
FT   CDS             439269..440330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yufP"
FT                   /locus_tag="CLOST_0377"
FT                   /product="YufP"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20507"
FT                   /db_xref="GOA:E3PV27"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20507.1"
FT                   /translation="MRGKFNEQLEYLGSLFLAIFLALVLGAGIMILNGKNPVQGYMALV
FT                   SGALGSKYLFATTLAKTVPLILTGLATAISFKSGIFNIGGEGQLYLGAFAAAYVGFTFT
FT                   DLPVVAGIVLAVIAAMAVGGLYAFIPALLKVYYNIDEVITTIMFNSIAIMFTGYLVNYP
FT                   FQASQGKMGGTDMIAEGFKFPKLVAMSKLNTSIFYTMIIAVLIYYLMKKTSYGYNFNIV
FT                   GENSIFSRYAGINNKKYMIWAMIISGALCGIAGAFEVYGTHYRFLQNISKGLAFDGMLV
FT                   SLIVKNNPVGIVLMSLFFAVLKTGSNAMELNTGVPSELILVIQSVIILFIAGESGFKEI
FT                   LKRRQLNKARTVK"
FT   gene            440330..440872
FT                   /locus_tag="CLOST_0378"
FT   CDS             440330..440872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0378"
FT                   /product="Inner-membrane translocator (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20508"
FT                   /db_xref="GOA:E3PV28"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20508.1"
FT                   /translation="MKDIFDLALLQNTIRTATPLILAALGGLLTMHAGILNIGMEGMIL
FT                   IGAFFGVLGSYFFASSFMGVVLAIISGIVIGALFGFFVIELKSDEFIIGIAINIFAGGL
FT                   TVFLLRSIFGVKGAFSSPDIKPLPDLHLPFLDKIEVLDKIFNNHSILVYVSWILVLLIY
FT                   FALQDSLWLLDKRGRRA"
FT   gene            440820..441233
FT                   /locus_tag="CLOST_0379"
FT   CDS             440820..441233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0379"
FT                   /product="sugar ABC transporter, permease protein
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20509"
FT                   /db_xref="GOA:E3PV29"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20509.1"
FT                   /translation="MLYKTPYGYWIRGVGEHEEAIETAGINPKKIKYISSILGGVFCGI
FT                   AGAHLSLGYLTLFTENMSAGKGFISLAAIIFGGSNPIKVYGASLLFGFFDALGIRMQSL
FT                   GIASQFTQMIPYVATVLVLFMVAQKKLMKRKGN"
FT   gene            441235..442551
FT                   /locus_tag="CLOST_0380"
FT   CDS             441235..442551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0380"
FT                   /product="putative FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20510"
FT                   /db_xref="GOA:E3PV30"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20510.1"
FT                   /translation="MRYDAVVIGSGAAGLYFALSASKKGKKIALVEKAQLGGTAFATGC
FT                   LPVKKIMDKIKSYEKAKALENENLLKLNSDKEVLFKAGIKSLENIESFISDKLSKNNID
FT                   VYIGEGEVVSETRVKVNEALIETENIILATGTTASTVEGFAPIDHEMILSHESLLTMKQ
FT                   LPEEMTILGGNVEGIEFASMLSELGVKVKVIEKEAQILQGNDEDLIENIKARLINNEVE
FT                   LILNTEVTAIEKIEEEAVINFSNRESLKVKSILVTGIRKPNIPKGIKELKLDMKSGFIK
FT                   VDENLMTSKASIYAVGDINGIHGMAHIALQQGILLADYIWEGKQISTQYSSLPRCIFTI
FT                   NELAGAGCQEHELENCVVKKLYFKDTFRGLDSSYDDGFMKIIIQDEIVKGIWINSIDAG
FT                   ALVGNVGLWIDNKVSVEAIKRSLFIHPTLSEALIDAIID"
FT   gene            442566..443309
FT                   /locus_tag="CLOST_0381"
FT   CDS             442566..443309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0381"
FT                   /product="Purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20511"
FT                   /db_xref="GOA:E3PV31"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20511.1"
FT                   /translation="MIQPHIQCDKVSKMVLLPGDPQRVDRVGSFLDDAVVIANNREFKT
FT                   LTGSYKGMQVTVTSTGIGGASAVIALEELINCGGEYFIRIGSAGAVQKDINIGDLIISM
FT                   ASVREDGASAMYVNKDYPAVSDFEILTALKNNAVKLGYEHHVGITRSHDSFYIDDEIEK
FT                   MEFWNKKNVLGSDMETSSLFVIGKLRGVKVGSVLNNVVLYSKDVKDGVNDYVNQKDLAQ
FT                   QGEDREILLALESLHEIKISRDGSF"
FT   gene            443597..444382
FT                   /locus_tag="CLOST_0382"
FT   CDS             443597..444382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0382"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20512"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20512.1"
FT                   /translation="MKKILFAMTLVFALLGFSPTVVEANTLSKGVILDGEQISMDGTPI
FT                   IENGRTLVPVRGVLEAIGATVDWNQATKTATAHLGEFSASVTVDKYTAYVDGYAVNLDV
FT                   PAKIVNGRTMVPLRFMAEALGYDVSYKDGWVYLDTPSTDLDPEFAAELEDFESILKDSP
FT                   VKDYFESFSIAYSDEEGAVVLSFEGDGTNKKVHEMINKPDEWAYYIEYMEMISMEMVMY
FT                   FKQLGYEVNSIVEVIDDENPEYVLLKVFNGLVDYDIATE"
FT   gene            444481..445806
FT                   /locus_tag="CLOST_0383"
FT   CDS             444481..445806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0383"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20513"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20513.1"
FT                   /translation="MSIWDVLGIEATSEEKIIKRAYSKKLKALDTDIHHKEFIELREAY
FT                   TAALNHIDLDTYEYEEEIIKTEGLENEYIQNENDDIKHNDEVNHDFTYESIVDDTDLEI
FT                   DYEDYKHYLYKECLEDKLENFEFRMSVDSWIEYFSNRNISASLDYQDFISLLNFIEEMP
FT                   VLPCEVWHFIKEYVVAHNTYSSLQYEDEYKRITNCIMIIDRFLSFSFTEKFGKNFSSNQ
FT                   NIEGLYEKISELHLSINNCDFEKAKSIYLEIKDNGYLGYWSERILKAEVNVNLVSRFKF
FT                   KLLISKLLKDKSIDKYILLYLFDLFIEKEFFCICKKILKKMRKNKESNLYIILSMKLGC
FT                   KRNKKRATRRLYKKYMNLTGLDYIEKNQVEFLKKFDLLSKPKWRGFSYLFNRILRWGII
FT                   IIYSMVVISVLISNPFIIIIAIIYYLYKYIKKEFFVHANNRD"
FT   gene            445787..447475
FT                   /gene="hscC"
FT                   /locus_tag="CLOST_0384"
FT   CDS             445787..447475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscC"
FT                   /locus_tag="CLOST_0384"
FT                   /product="Hsp70 family chaperone Hsc62, binds to RpoD and
FT                   inhibits transcription"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12183460, 14734171, 22055095, 9735342; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20514"
FT                   /db_xref="GOA:E3PV34"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20514.1"
FT                   /translation="MPTIGIDLGTTNSLVSFWNDGKPQLIPNNYGSFLTPSAIAIDNDN
FT                   KVLVGQPAKEWLVNNSNDGVICFKRFMGTEKIYNIKGHTFSPTELSALVLSTLKEDAKN
FT                   YFNEEVSDAIISIPAYFNEFQRTATINAGKMAGLNVVKLITEPTAAALAYGLHNADAEA
FT                   KFMVLDLGGGTFDVSILEMFEGVMEVRSIAGDVFLGGEDFNEAIFKAICEQENIDIKYI
FT                   SVLEGGQLKKLAEVCKKLLSDKEICKIEYNFRGTSRVLEYSRNQFEKLVAPLILRLKKP
FT                   IERALRDAKLNTSNIDSIILVGGATRMPIIRSVIGVMFSKIPFVTIHPDEAIALGIAVQ
FT                   AALKEKNEAVSELFMTDVCPYTLGISSLDSNENESIFSPILERNTCIPCSKVGTYSTSH
FT                   NKQKEIKIEVFQGESIDLVNNLKLGEFKIKVPPNDKGKEKVDIRFTYDGNGLLEVEAKV
FT                   LSTQLVKSYIIEKSPGYMTEQEIQERLKKLSYLKVHPRDKQKNIAILARADRLYQELLG
FT                   INRDIIAAQVSNFKEVLDSQDERLIQEAYDDFEGFLNSLDSYNFF"
FT   gene            447686..448996
FT                   /locus_tag="CLOST_0385"
FT   CDS             447686..448996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0385"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20515"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20515.1"
FT                   /translation="MDKIFDKFLTKLNIRLHRLYGKIQSSIMAFGINKGYFVNFCIGLF
FT                   ALINLFYNENIFGIEFLKEDFYKKVPILFTILSTGLTMIYSIIKYLKTSNEYTIILDSY
FT                   NKKEIIEKIKLSDKYLNNGYRIRTFHNGKTQEKFVMSDYINIMLLERSTININIIDYKF
FT                   EIADEIKSFVPSIMRRTFLSDKVIFNGKLVRMASDLFLESTAINMQKTRYFEGQCTNEI
FT                   VYKQIKSNHSIEEPFRGECLMLNKDNVLFDLEHSSCSNYIGASTLVVVNRKHILIGKQG
FT                   EYSKANSGRYAPSGSGSVNYKDINKSTDFYSLIINAMEREFCEENNYKLNNNIKTIVLG
FT                   YVRLLERGGKPDFFGISFLDLDSEVINNDKIKKEELGIAGNRLIIDIDINEGIGRTVLE
FT                   FCRKNILDNKVSIQLMILAELIIKYESRILEILEKEN"
FT   gene            449028..450080
FT                   /locus_tag="CLOST_0386"
FT   CDS             449028..450080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0386"
FT                   /product="putative translation initiation factor EIF-2B
FT                   subunit 1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20516"
FT                   /db_xref="GOA:E3PV36"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20516.1"
FT                   /translation="MIRKDEGLGFILKYENVAWYEGGKVKILDRRIYPTQISFVTCSTH
FT                   EEVAKAIADMVTQSAGPYTAAGMGMALAAYEIRNESKEKQLEYLEKAAYTLSHARPTTV
FT                   NRMKLITSGCLEVARKALDNGEQVDEKIFNSTIDSLNRRYENMEVVGNYLVDMFPNKGT
FT                   IMTQCFGETIVGMMLKQAKNRNKDIRVIVPETRPYFQGARLTASVSQDQGFDTTVITDN
FT                   MPAFVMKTNKIDLFTSAADVICLDGHITNKIGTYQLAITAKYHEVPYFVTGIPDIDNPT
FT                   VDTVKIEERDPALVLEARGIKNTLDGVKGYYPSFDITPPHLISGVVTNKGIYSPYDLKR
FT                   YFKSDVKKFY"
FT   gene            450090..451310
FT                   /locus_tag="CLOST_0387"
FT   CDS             450090..451310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0387"
FT                   /product="5-methylribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20517"
FT                   /db_xref="GOA:E3PV37"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E3PV37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20517.1"
FT                   /translation="MDRFSEHFRMDEEAIRVYVAEKLKLFENIEDIKVSEIGDGNINYV
FT                   FRAEDIKSKKSVVIKQADKLLRSSGRPLDVDRNRIEAEVLKFYGEVASDYVPKIYHYDE
FT                   VMCALTMEDISEYENLRHGLMKNKIYKNFAEDITTFMVNTLISTMDIVMNPWKKKEDVK
FT                   KYINVELCDITEKLVFTDPYTNHFGTNIVLDESSEFVKKEIYNDEELVFEAGKLKYKFM
FT                   NNPQSLLHGDLHSGSIFVTESKTKVIDPEFAFYGPIGYDLGNVVGNLFFSYIHSDIVMS
FT                   NEVEKRAYLNYLETTIAEIVEKFTEKFGRAYDEKVIDPMAKNPLYKKWMIASILEDAAG
FT                   MAGTEVIRRTIGDSKVKEIESIESIEARVYMDKFLILLGKSLIKDRYKIKTGEDYVALI
FT                   DKIKKLI"
FT   gene            451331..451969
FT                   /gene="fucA"
FT                   /locus_tag="CLOST_0388"
FT   CDS             451331..451969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucA"
FT                   /locus_tag="CLOST_0388"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20518"
FT                   /db_xref="GOA:E3PVF1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20518.1"
FT                   /translation="MMEYEKEQVVRYGKKLIDRRLTTGSGGNISVYNREQNLVAISPSG
FT                   LDYYETTPEDIVILDIDGNLVEGKNRPSSEAGMHLAFYKNRADVSGIVHTHSKFATAIA
FT                   CMGWELPAVHYLIGMAGHRVKCTGYATYGSDELAKKALETIGDSNAVLLANHGLIALGE
FT                   DVDRAFSTAEHLEFVSEVYYLTKTLGTPNILSDENMDEVMKKFGTFRYR"
FT   gene            452045..454147
FT                   /locus_tag="CLOST_0389"
FT   CDS             452045..454147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0389"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20519"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20519.1"
FT                   /translation="MRNKISADFKKYCEYYYNEKLLNINLDGKILELPYVIIYDNLYHS
FT                   ISAKDISFRIHYNNFMVEEKILALTEEMFRQYCTDNNIKEMLAEKRLRLFDIIKNNNKL
FT                   ELEIQMLNYVDCIHTNSIIDLKSENNYTSLRELLHNNGKLDEISNSKLANQFDISIALF
FT                   TGDNCLVVKKIKSDGIIGEENLYPSIADSIMLEDIIDNNLVCKKLEKEFNLKYEYVDEI
FT                   FFLGIARNLIKGGKTDIFFLVTTKLNNSDILGRYYFENNRNNSILEFVKFNSIKYDERI
FT                   FITDKKIFNFDMKAIMSEKLDNMTLELLGSISLFINWINKEDLVESSAGTNDIDKILKI
FT                   IKNKISNKSKDIIKYVEAYFEFISDEKEREFEIQIGNLIKLEIDKYLENVFDRILLDSN
FT                   FSYKVKYASFYSLCTLYRRNKEYSKYHKLIDSYTKDFQTQYTFPHLKSMCLREIISLRK
FT                   IGYNLDLKDSINLAKEAKNNLPNNIGVLHSYAVVVAMAFEEELYDINNEENKKELYDAI
FT                   EIAQRIINKEDFAKFYSTYGRLLCIDGKYDEAKKNIRNAIDKEDKDKLGYALSIGDYQT
FT                   QLLNVEFKKSKNEFSDIKKLLENKVEGVKTDIIEAREKLENEKTNNLEFLGFFTAIISF
FT                   TIGSIQIANGQDVRDAARLIVVLAGSLLIVLGGFGTILHGKNRFMSNLFTGIMGIVMII
FT                   LGLSFI"
FT   gene            454172..455029
FT                   /locus_tag="CLOST_0390"
FT   CDS             454172..455029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0390"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20520"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20520.1"
FT                   /translation="MKVIQKDSISKSLKKYNEDISYIGDSWAWVIDGATGLSGRNLLKD
FT                   KTDASWFVYQWNEYLISNIKNYNFDLSTIIKLGIESIYDKYRFLVKKEEDLLISPIDFP
FT                   SATIALIRWNSNHIEYFLLGDCEILIQNGQTNLVHISDEALKPFDDKVIDLMTNEKIIN
FT                   GLTHDEARDKATSMLVEHRLMKNKPKGYWSLEFDDIAVDMAKKGKICLDQEAKCLLMSD
FT                   GFSILFQKYLKVDKYKIINFVEKNGLVGCYNLLRDIESNDSECIRYPRLKKSDDSSAVF
FT                   IRFF"
FT   gene            complement(455047..455598)
FT                   /locus_tag="CLOST_0391"
FT   CDS             complement(455047..455598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0391"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20521"
FT                   /db_xref="GOA:E3PVF4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20521.1"
FT                   /translation="MEILSEIADKIKELRKEKGYTLKDLADKTELSVSFLSQVENGSSS
FT                   LAITSLKKLVDAFSVPMTYFFYSMETHNYHVKIDEQKSFKMEGLPSEFVRLSGDFSGRS
FT                   LESMIVTIPGGQKHGHKYNHPGEEFAYVLEGVLIVEIEDKEYLVQSGDSIHYPSTMPHQ
FT                   WRNPLGSPVKILSVITPAVF"
FT   gene            455897..457276
FT                   /locus_tag="CLOST_0392"
FT   CDS             455897..457276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0392"
FT                   /product="Proton-dependent oligopeptide transporter
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20522"
FT                   /db_xref="GOA:E3PVF5"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20522.1"
FT                   /translation="MSDMVVKNKRPFGFYVCSVAFMFERMAYYSAKYLIYVFVAATIAT
FT                   GGLGLTKVEAAYIQSNLVAFTYLAPIIGGYISDRFIGARYCVPVGIALMAAGYWIGASA
FT                   TDAVGMNIMVTLVAIGTGLFKGNVAAISGALFDDKEQLDSAFSTQYSFVNIGAFIGTTA
FT                   VGLLVTKTFAHGDIQGFRAAFQVCAAICAIDLVWFLFGSKFLGEVGKKPFKLGKEVDKD
FT                   VVVENKPLTKSEKKKVFAIILISTFSVIFWVFWYLTYLAAYDYGAAFINMNVSGFNVPL
FT                   SWFDSLNSMACIALGPVLGVLWFKLSKTARGDLSLFKKLGIGLGLLGAAFLMLVFAEFS
FT                   RGVGASDASKASLFWLIAFGLLLSVGEMFFSPLGNSFVSKYAPNKMVSVLMGVWIFATF
FT                   IAGKSYGYLYEFASKFSVIQAYSVIPAILFVAAVMLFVFDKKLTTLLEDDSDDAEDALV
FT                   S"
FT   gene            457415..458488
FT                   /locus_tag="CLOST_0393"
FT   CDS             457415..458488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0393"
FT                   /product="putative peptidase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20523"
FT                   /db_xref="GOA:E3PVF6"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20523.1"
FT                   /translation="MKLNRLESILEKMKAENLEQMIISDPASIFYLTGKWIHPGERMLA
FT                   LYISTRGEHKLFVNKLFPITEDLGVEIVWFDDTNNAVEILSEVVLKDKSVGVDKNWPAR
FT                   FLIGLMELKAGSSYVNGSLIVDRVRMIKDEAEKDFMREASRLNDLAMEKLKNEVTKGHS
FT                   EKELMQVLQGIYKELGTDGFSFEPILGFGANAANPHHSNTDKVAEIGDSIILDIGCAKN
FT                   SYCSDMTRTVFLKEASDKAKEVFEIVLEANKRAINTVKPGVRFCDIDAAARDYIASKGY
FT                   GEYFTHRTGHSIGIDVHDYGDVSAINTDKVEPGMIFSIEPGIYLPGEIGVRIEDLVLVT
FT                   EDGCEVLNKADKELCIL"
FT   gene            458681..459433
FT                   /locus_tag="CLOST_0394"
FT   CDS             458681..459433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0394"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20524"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20524.1"
FT                   /translation="MWTRVELKLKAKDFLRMYYWKAFLVAFMIFIVGGNQNMLLNSGGS
FT                   SGRGGQDAHYQGGQIIVDDPNSFVGRFTELMGMPGILALSIVIVLFVIGFFLIFRFFIG
FT                   IPIEIGGRKFFLDGINEEPDVKSLGWVFKSGSYMNISITMFLTGIYNFLWFLLLIIPGI
FT                   IKHYSYMMVPYILVENPNIEPSKAIRQSIQMTQGHKMNMFILDLSFLGWYILGTLMLGI
FT                   GVLFVNPYYEATYAQLYISLKDNETIEY"
FT   gene            complement(459550..460791)
FT                   /locus_tag="CLOST_0395"
FT   CDS             complement(459550..460791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0395"
FT                   /product="Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20525"
FT                   /db_xref="GOA:E3PVF8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20525.1"
FT                   /translation="MEKNYDASSTVSNIQYIFNFEGAHKRIEQVLRPTNLIHSTFFSSY
FT                   CSNNVYIKPENLQTTGAFKIRGAYNKISKLNSEQKSQGLISSSAGNHAQGVAYASKELG
FT                   VTATIVMPKTTPLIKVESTKKYGANIVLHGDCYDEAYEEAKRLESSENMLFIHPFDDAD
FT                   VIEGQGTIAIEILKEAPNLDVIIVPVGGGGLIAGVAACAKALNPNIKIIGVEPEGANAM
FT                   SLSMKNNKLTCLEKVCTIADGVAVKNPGNLTYELIKTYVDEIVEVSDFEIMEAFLLLMQ
FT                   NHKLVGENSGVLPFAALRKIKEKNKNIACIISGGNIDFLTISSLINQGLVSMGRIFCFS
FT                   VNLPDKPGELAKISNLLAKLGANVIKLDHNQFKASNRFMDAMLEVTVETNGHNHVELIY
FT                   DEMKALGYTIKRVY"
FT   gene            complement(460847..461076)
FT                   /locus_tag="CLOST_misc_RNA_13"
FT   misc_RNA        complement(460847..461076)
FT                   /locus_tag="CLOST_misc_RNA_13"
FT                   /product="T-box"
FT                   /inference="profile:Rfam:8.1"
FT   gene            complement(461128..462486)
FT                   /gene="ykbA"
FT                   /locus_tag="CLOST_0396"
FT   CDS             complement(461128..462486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykbA"
FT                   /locus_tag="CLOST_0396"
FT                   /product="putative amino acid permease"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20526"
FT                   /db_xref="GOA:E3PVF9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20526.1"
FT                   /translation="MQQTVKLQPKESQPSNQNLKKQVGALDAITMVIGIVIGSGIFFKS
FT                   SPVFSNAGSPFLGIMAWIIGGLLTVASALTISEIATAIPKTGGLFVYIKELYSEKWAFL
FT                   FGWVQSFIYVPGVTAALSIIFVTQATFFIPMSDFTQKILAISLIFFLILVNIASTKIGS
FT                   KIQVVATIAKLIPIVIIIAFGFMKGTVGGVSEVSKVSLSGASLAGFGSAILGTLWAYDG
FT                   WVGVANMAGELKNPSKDLPKSIILGLSITMIIYVLINIAIINVIPVDAVIASQTPASDA
FT                   AVLMFGKSGAILISAGIMISIFGAMNGYLLTGVRVPFAMASEGLFPFADKLSYLHPQSN
FT                   TPVLAFVLEGALAVLYVMSGSFEVLTTLAMFMVWFFFVMAVAGIFVLRKKFSHLNPAYK
FT                   VPFYPFVPLVGIAGGIYILLSTLVTDFKTAVLGILITALGVPVYNHITKSKRA"
FT   gene            complement(462726..463799)
FT                   /locus_tag="CLOST_0397"
FT   CDS             complement(462726..463799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0397"
FT                   /product="Copper amine oxidase domain protein precursor
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20527"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20527.1"
FT                   /translation="MIKRLFTLTIMMCILLVSSTLSFASSHHYYTSQKFSNGKTAKYVL
FT                   LNLNATDISPAMGLANNKILAADSLQNIVNTRAIEGKKAFAAVNGTYFSAYNGVPVPYG
FT                   TIIDKGKLLHIGNYGAVLGITKDKKLVIDNLNIEITGSIDGVENQYYTWGINHPRTEPD
FT                   AIMIFTPDFASSTQMPDAQNVIVRNGKVSQKNSGNTAIPSDGFVISFNPSMHYLMERFN
FT                   IGSTVDYTPEFRSTRENATEADYAVWKDVVYAVGAGPSLILNNTITADGTKEGFTEAKI
FT                   NTQRSQRSFVGYREDGRVIIGTVANASITELSQICKELNLKSAMNLDGGASSALLYNGS
FT                   YKTNPGRNINNALIFFE"
FT   gene            464021..465091
FT                   /locus_tag="CLOST_0398"
FT   CDS             464021..465091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0398"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20528"
FT                   /db_xref="GOA:E3PVG1"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20528.1"
FT                   /translation="MSLFVNYNDSRFIDIAQKIFEEQFRRDPKLKAQLDNRRKKLMYDD
FT                   VVYNISHLMTAVYFSDEKIFENYALCVYELLCNLMKDFDRDRIMQMMVDHYTITAEVLE
FT                   ADAKEMFSEKELEKAVDYLKIAIKVTKEAVTNIELSDSFEKGKYKKLRKEYLDALLKSQ
FT                   TTEAYRIIEDARASGVSLVDIYEEVLSKVLYEVGELWHKSIITVDKEHYATSITQSIMS
FT                   RFYDEIFNRPRKSKTLLSCAVGSELHEIGVRMLSDMFEYHGWDTIYLGAALPEDAILNA
FT                   IKEHQPDLVALSVTMQPYLTECESVVLSIRKNFPAIKIAVGGQAFIPTERLWEKWPIDF
FT                   YSRKAIDLIEWAKENI"
FT   gene            465171..466202
FT                   /locus_tag="CLOST_0399"
FT   CDS             465171..466202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0399"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20529"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20529.1"
FT                   /translation="MDLTGFLLECDKNGKILNVYWNEPTYIVSPYQKRLTDLFSEDATQ
FT                   DLEAMLVKSKDVSEMLYCSKNLELRSPKRQISVCFLASEKSILVHGIDVMELGIESAIP
FT                   ALKKMIYNFMKVLHMYDGKVITDNERIMRFQFEQIQKLNNDLLNTQRQLQKANAQLKRA
FT                   NEVLNNRLVKDALTGLVSRYQYREEIDMLIKTSPEKKGIFTFIDIDDFKRINDNYGHNV
FT                   GDIYLKIFAKRLSKLNFENAIFMRISGDEFGVYIHGYDEVNDYDIKKVWEEIENKILSS
FT                   QFEIQDNKHFIYCSAGMAVYAEDTNSVYELIDYADFAMYIAKKSGKNSYRRFNLEQYKS
FT                   AKN"
FT   gene            complement(466238..467254)
FT                   /locus_tag="CLOST_0400"
FT   CDS             complement(466238..467254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0400"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20530"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20530.1"
FT                   /translation="MKKILTTILAFTLLSSFSFAFADSTSDYIVIDVPYVSQLYPTRAV
FT                   VGCEPTALLMALKSKGLTNDITLKDFLDAMPKTTTDPAKGFAGSPYSPSEKIRTTIYPK
FT                   PLSEYANTYMPSITRDISGSELEDIKKELLSGNPVVIYATMGWVKPFYRQFDIEGEKQW
FT                   LLRNNHAVLLTGYDAQNQKFYVADPYNKKSPTKPYFYWILESKLKPIYDERKWAIAIGE
FT                   APKPPYPESLEDISPDEYKAVSINETSYQGIMFDEDVYLDLALIVQSELDASYSYDSSL
FT                   RSALISSGNEDYTINFINGSVYKNNSNIGKLSEKKLKLDEKLYLTIQDIELLLTLLK"
FT   gene            467487..469358
FT                   /gene="yveM"
FT                   /locus_tag="CLOST_0401"
FT   CDS             467487..469358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yveM"
FT                   /locus_tag="CLOST_0401"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein YveM"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20531"
FT                   /db_xref="GOA:E3PVG4"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20531.1"
FT                   /translation="MREILSNKLIRKLVLLFADAALVNLAALLALEIRFDFYITGSNIE
FT                   YKIAFIDHFVIYTGIVLVIFYLFGLYRSLWRYASINEMMSIALAALWSNIATYITFLLL
FT                   DVNMPRSFYIINMFTMAAFVGGLRFSYRVLRRIEMGKLQTNKLNRPLSKVLIIGAGEAG
FT                   VMTAKELLRTPDMNKVLVGFVDDDSNKIGKKINGIPIVADISSGVKFLDDVDEIILAMP
FT                   SITHKRRKEIIEIYKDSGVKMKILPGIYELIDGQVDIKKIRDVDIEDLLGRDSIALDNT
FT                   KIAEDIKNKIVIVTGGGGSIGSELCRQIAGFSPKLLIIFDIYENSVYDIQNELKSKYPT
FT                   LPLKVLIGSVRDVNRLDEIFLKYRPQLVFHAAAHKHVPLMEDSPFEAIKNNTVGTKNIS
FT                   EIAGKYEVQRFVLISTDKAVNPTNIMGASKRLAELVIQDMNKKYSTEYVAVRFGNVLGS
FT                   NGSVIPLFKKQIEKGGPITVTHPDIIRYFMTIPEAVQLVLQAGSMAKGGEIFILDMGEP
FT                   VKIVDLAEDLIRLSGFEPYEDINIEFTGLRPGEKLFEELLLAEEGILDTKHEKIFVGKP
FT                   FDKDDDFTRKSLEGIIESTFEGNYSQLEQRIKFLIPSYRDKLEQKKA"
FT   gene            469541..471181
FT                   /locus_tag="CLOST_0402"
FT   CDS             469541..471181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0402"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20532"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20532.1"
FT                   /translation="MKKLLSLITVMAVVLTLIPFQSTFAATPASKVRVSDKVWVGNMEA
FT                   QHAALVTFTEDSNNAWEDTQNLTLRLPDGVSWNKFTRINARLINMADVDGRDLTIKLVN
FT                   TKNIDRIVLDPYFDIERSVEKGDLVLRVYRGDVADSDKELVVAEIKDYGAKLTSSDIAE
FT                   FNFIKPGSKDVVVYLEEFIDGSLVDTQTYDLEVENAEIDKAKGIQIKRLTGDKKLTSTM
FT                   NGDYVKLNVDKTPGKSKWELKFTITPEKEYEGDIVLNLEGRGVEDSITLGTVLKNVDMM
FT                   TGTATSIGLGFQDQDVAGIEITEMERGALLKGVYTIAINPEYKGLVFTDAKLNVTEGNI
FT                   DIDNFEYRDGKFVFEVKSASTRASKIVINDIKVTVDQFGYLGDYKGELIFNHGQSDQIK
FT                   VDEEVLFTATGSKPSEGQAKYVGRFIIGSPSFIITTNGINRVETFDVAPYIQDNRTMMS
FT                   VKAAGVALDAKVSYDTDKKMVTVESGDTKATMTIGSKILNINGEEKEMDTEAVISNSRT
FT                   FIPLAFLADVFDAELKWDNITKTVTIMKN"
FT   gene            471345..471929
FT                   /locus_tag="CLOST_0403"
FT   CDS             471345..471929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0403"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20533"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20533.1"
FT                   /translation="MKKIYKTMLLMLIVILATISVTFFVTNKFHEQELYSVSGVLEQVK
FT                   DISELNTVEMYFNEIIDFKNAKLFNNFQIPFTEKSFIFTVKSKVKAGVDLSSIDEGDIA
FT                   ISGKSLIIKLPNPKITSKEILSYKVYDEKNGLFNEVTTEDTLKALELFEKDIEKQALDS
FT                   GIIEKSKENTKLIIRNLFLSYGFESIEIKWK"
FT   gene            472101..473759
FT                   /locus_tag="CLOST_0404"
FT   CDS             472101..473759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0404"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20534"
FT                   /db_xref="GOA:E3PVG7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20534.1"
FT                   /translation="MVRSIRTKVIISMMSLVILSGMFLGYVNYMDSEKLAIDIIKRNNK
FT                   AELENINEYYFEKLIFDMEYIVNIWANNQEIINYTKTDDKLYVRSIPEDFINIYEKWLG
FT                   LTESMKNVTWFYYALEEDGSIYIAPVDETMPLDYDARSRDWYKGTVDKHGEIFWTEPYI
FT                   DAGNSGKLLQTVSKAVYKDNELRGVIGLDIELEKFTEIIEGLSYSKQSNIFLLNEKLEV
FT                   LASNENASENLSIYAKKAVSGEQELFTLDKIQYVSTYVPISINNWKLVALTQTNLNEEL
FT                   NLIRDRILTIVLLTIIIGILMSLILSRNLLKPLRSLILTTEKVSDGDFKVRSTVTSNDE
FT                   FSVLSMSFNSMLDDIENLLTQRDENYIKTVTVLANAIEASDEYTRGHCDRVGDIALQIA
FT                   DKLNLTSKQKNDLRFACILHDVGKIGISDRILNKPGPLTDAEYEIIKKHPEIGFEIIKE
FT                   IDFLEEPANIMLEHHERIDGRGYPQGLKGEDIRIEAKILAVADTYDSISSARVYRDRIL
FT                   TKAEIREELLKNIGIQLDEEVVIALLEILEDDMKN"
FT   gene            473775..475784
FT                   /locus_tag="CLOST_0405"
FT   CDS             473775..475784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0405"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20535"
FT                   /db_xref="GOA:E3PVG8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20535.1"
FT                   /translation="MRGGLIILKSNKFKITILLILFVIGIAGTIYSFNSNQKPEEEIFL
FT                   TAEETKWLNENKDDIKIGYTTDYPPVEFLDNDKYVGMSADYFKLLEKKLGIKINMVEFD
FT                   NWDELIEQAKSRKISGITAATKTPERSEYLDFTVPYILNPNVIITRKNFSENLTFEKLA
FT                   NTSMEILVVEGYDIIEFLNERFPKLEYKTVKTPSDGMRMVAFGEADAMIIEIMSASATI
FT                   ERDNITNLVVNVETPYESSLSIATRNDWPMLSTIFNKGLAQISQQERKEIEQRWMPLQR
FT                   KNLFENRYFWFGLLTLLLGLSIIIIVISIWNASLKKAVKEKTKALEVSTQELLYKTYHD
FT                   ELTGLYNRVYFSEILEEIQSKPLPLSIILADLNCLKITNDTFGHEAGDKLIIKMAKLIQ
FT                   SNIEESHIACRIGGDEMIIIMPETDAKKSLDILAKIKQATISSKEEPIRPLVALGAATK
FT                   INEDESFSRLFKRAEEKMYENKMDESEYTYDKVIGSFKKAILENEYESLEHYDRLKALC
FT                   LELGYAMNLDKEDLDALVLLSDLHDIGKAGLDKEILLKEGPLTHDEWEKIKRHPELGFK
FT                   IVSSSVKFSHVGKGILAHHEHWDGKGYPQGLKGEEIPLIARIFAVVEAYDVMTHKRPYR
FT                   QILTKNEAIQELKNCSGTQFDSRVAEVFINMIDN"
FT   gene            476171..478243
FT                   /locus_tag="CLOST_0406"
FT   CDS             476171..478243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0406"
FT                   /product="Methyl-accepting chemotaxis sensory transducer
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20536"
FT                   /db_xref="GOA:E3PVG9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20536.1"
FT                   /translation="MEIIKNATSRNNQKSKPSKRGTIRTKLLMMPIALIMVGVIVIGLL
FT                   SSYYTKESLFDQMRKNGIFISEQFVKRVSDNQQSLNNANVMLEAIIRGVGNTVITNQGQ
FT                   LSNDYLIKLANDMGVDEINYTDANGNITYSNLESSLGYNFGADHISYPMLSGKQNELME
FT                   NIRKSSETDDYYKYGYVINPNGGMVQVGLLANDINAMTEKFGYQKAVEDIVSNENIVYA
FT                   LYIDSEYKAVAHSNKDRIGIDLKDDKGAISAIKNKEVFSSEFYYEAEKVDVYDVVYPVE
FT                   VNGFVIGAVNIGFSVKDVQDAVAKNRMMIALIGIGIILLLGIILFVTTTRVLNFIKNLK
FT                   GQVGYMADGDFSHDIDEKLLKSNDEIGDIAEAIGDMQNSMRHIVSQVMDKSSQVAASSE
FT                   ELTATSQQAASASEEVARAIEEIANGANSQAKDTENTAENVNVMGNLMEQDEKYLKELN
FT                   EAANLIEKEKEEGFKILGVLINKTNESTKSAREVYEIIMSNNESAEKIDTASTMIQSIA
FT                   DQTNLLALNAAIEAARAGEAGRGFSVVAEEIRKLAEQSNNFTSDIKEVINELKSKSQSA
FT                   VDTMNIVQNTIMDQTSSVKDTEGKFEAIASAIDSVNTIIEKLNSSSVQLMENKNLIISL
FT                   TENLSAISEENAAGTEEASASMEEQSATIQEIANSGESLASIAEELQSLVAKFRV"
FT   gene            478578..480809
FT                   /locus_tag="CLOST_0407"
FT   CDS             478578..480809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0407"
FT                   /product="Methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20537"
FT                   /db_xref="GOA:E3PVH0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20537.1"
FT                   /translation="MDKLNDKKALENLESIHNADNMSNLDNNELDETTEIINDIEKLDV
FT                   IDNKQEGKNKAKLRFKKNSGDNIKSNENKSNSIKTKLLTIPLVLILLGVGAIAFASSYL
FT                   TRDSLFDQMKDNGVFTAEQFVKRVNDNQQSINNANRLLENSIRGVGNVIITSQQMISNE
FT                   FLAQLAKDMGIDEINFVDQNGTIIYSNLESSIGYTFPEDHISTPVKDGKLADYMEEIRQ
FT                   SAVTNSYYKYGYVHNVNGGMVQVGILANDINAMTQKFGYQAIIEDIAKSDNIAYALYMD
FT                   SIYKVKAHSNPELLEGYLVDDIGAKTAIQDKKIYTATANYESHEVYEVVYPVDVNGYIA
FT                   GAVKIGYSIDSVQKAVTKNTMMIIGVGLAIFLLLGAALYFTITKVIAVINKLKKQISIM
FT                   SEGDFTNDIDKSLLSNNDELGEIAKAIDNMQASMKDMISKVIDKSSLVAASSEELTATS
FT                   QQAANASEEVARTIEEIANGASEQAKDTENTVQSVNDMGNLMEKDSQNLKDLNQAAVLI
FT                   DKEKEEGFNILKTLIEKTDQSTKSTKEVYEIIMSNNESAEKIDTASTMIQSIADQTNLL
FT                   ALNAAIEAARAGEAGRGFSVVAEEIRKLAEQSNNFTSDIKEVINELKAKSQSAVDTMKV
FT                   VQTTIMDQTSSVKDTEGKFEAIARAIDSVNDIIEKLNESSKLMIQNKDIIISLSENLSA
FT                   ISEENAAGTQQASASMQEQAATIEEIANSGESLAEIAEELQALVAQFKI"
FT   gene            complement(480877..481074)
FT                   /gene="yjbJ"
FT                   /locus_tag="CLOST_0408"
FT   CDS             complement(480877..481074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjbJ"
FT                   /locus_tag="CLOST_0408"
FT                   /product="putative stress response protein"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20538"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20538.1"
FT                   /translation="MNFDMLKGKFNQILGDAKTEFGKLTDDELKMLEGQRDKFIGVVQE
FT                   KYGIAKEEAEKKVNEFLKKY"
FT   gene            481246..482109
FT                   /gene="rmlA"
FT                   /locus_tag="CLOST_0409"
FT   CDS             481246..482109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="CLOST_0409"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /function="6.11 : Sugars"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.7.7.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14253441, 5833803, 7517390, 7517391, 92120472, 94292435,
FT                   96032389; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20539"
FT                   /db_xref="GOA:E3PVH2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20539.1"
FT                   /translation="MKGIILAGGSGTRLYPITKSVSKQMLPVYDKPMIYYPLSVLMLAG
FT                   IKEVLIISTPRDISDFEELLGDGSDIGMDFSYAVQNQPKGLAEAFIIGEEFIEDDSVCL
FT                   ILGDNIFYGANLVNVLHNASNLDSGAVIFGCYVKDPRAYGVVEVDSDMNAISIEEKPEH
FT                   PKSSYAVPGIYFFDNKVSQIAKNVKPSKRGELEITSVIEHYLNNKDLKVEIMGRGLAWL
FT                   DTGTHESLLEASNFVEAIQKRQGLYIACIEEIAYKKGYISDEQLNKLARPMKKTDYGQY
FT                   LMDLIK"
FT   gene            482161..482279
FT                   /locus_tag="CLOST_misc_RNA_7"
FT   misc_RNA        482161..482279
FT                   /locus_tag="CLOST_misc_RNA_7"
FT                   /product="FMN"
FT                   /inference="profile:Rfam:8.1"
FT   gene            482488..483636
FT                   /gene="ribD"
FT                   /locus_tag="CLOST_0410"
FT   CDS             482488..483636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="CLOST_0410"
FT                   /product="fused diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase; 5-amino-6-(5-phosphoribosylamino) uracil
FT                   reductase"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9068650; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20540"
FT                   /db_xref="GOA:E3PVH3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20540.1"
FT                   /translation="MISKNERTDVDMGVIDMLESDEKFMKLALSLAEKGRGYVNPNPLV
FT                   GAVIVKDGKVIGEGYHTAFGKSHAEIEAINSATEDIKSATMYVTLEPCCHQGKTPPCTE
FT                   AIIKNQLARVVVATTDPNPLVSGSGIEKLKQSNIEITVGVLEEMAKIQNEVFIHYMTTN
FT                   LPFTILKYAMSLDGKIACHTGDSKWITSEKSRTDVHRLRSSVSAVVTGIGTILSDDASL
FT                   NVRLIDSKGREPHRIVVDSAARISLDAKIINLDSKSDTYIAVTEAASDGKLRKLEDYGA
FT                   KIIMTKSKDGKVDLEELWKELGFLGMDSILIEAGEQLSAALLEAKLVNKIRAYIAPKII
FT                   GGTNAKSPIGGYGASSMSEVINLKSMNFTHIENDFVVEGYIK"
FT   gene            483716..484393
FT                   /gene="ribE"
FT                   /locus_tag="CLOST_0411"
FT   CDS             483716..484393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CLOST_0411"
FT                   /product="riboflavin synthase (alpha subunit)"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="2.5.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12456892, 2106516; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20541"
FT                   /db_xref="GOA:E3PVH4"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20541.1"
FT                   /translation="MFTGLIEETGSILNIRPGSKSTSVSIKASKVLEDANIGDSIAVNG
FT                   ICLTVTSKSADNFTADVMPETIKRTNLHRLTKGSKVNLERALKLGDRLGGHMVSGHIDS
FT                   TGEIIKITPDENAVLIEIGLSENLLPYIIEKGSVSIDGISLTVASVTKRSFIVSVIPHT
FT                   KKMTTLEKAMPGQMVNIECDMIGKYIQIFVANSNILSSNLTEDNIEKPSKLDMGFLASN
FT                   GFL"
FT   gene            484512..485729
FT                   /locus_tag="CLOST_0412"
FT   CDS             484512..485729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0412"
FT                   /product="bifunctional 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase/GTP cyclohydrolase II protein"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20542"
FT                   /db_xref="GOA:E3PVH5"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20542.1"
FT                   /translation="MFDSIESAIEDIKNGKMVVVVDDEDRENEGDLLMAAEFATGDDIN
FT                   FMVKYGRGLVCMPTLKSRLDELKIGAMVSNNTDPKETAFTLSVDYKTTHTGISAHERAL
FT                   TITKLMDDEVSGEDFTRPGHIFPLCSKDGGVLVRAGHTEAAVDLARLAGLKPAGVICEI
FT                   LNDDGTMARVPELIEFAKLHNLKLITIADLIAYRRKNEIFVKCEAISQLPTKYGNFVMK
FT                   GYVNSLTGEHHVALVKGEINPELHVLVRVHSECLTGDAFGSLRCDCGDQLAKALELIEK
FT                   EGRGILLYMRQEGRGIGLINKIKAYNLQDHGKDTVEANLELGFPEDMRDYGIGAQILYD
FT                   LGVRKLKLMTNNPKKISGLEGYGLEITDRVSIEMNHNEKNDFYLWTKKEKMGHMLDNFK
FT                   KQEVEK"
FT   gene            485726..486187
FT                   /gene="ribE"
FT                   /locus_tag="CLOST_0413"
FT   CDS             485726..486187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CLOST_0413"
FT                   /product="riboflavin synthase beta chain"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number="2.5.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20543"
FT                   /db_xref="GOA:E3PVH6"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20543.1"
FT                   /translation="MNVFEGKLMASSHRVAIVVGRLNEFIGSKLLEGAKDALVRHGASE
FT                   DDITVAWVPGAFEIPLVAKKLASSNNYDAVICLGAVIRGATPHFDVVASEVSKGVANVS
FT                   LETGVPVIFGVLTTDTIEQAIERAGTKAGNKGFEAGVTAIEMINLLKLM"
FT   gene            486274..486524
FT                   /locus_tag="CLOST_misc_RNA_17"
FT   misc_RNA        486274..486524
FT                   /locus_tag="CLOST_misc_RNA_17"
FT                   /product="T-box"
FT                   /inference="profile:Rfam:8.1"
FT   gene            486671..488374
FT                   /gene="leuA"
FT                   /locus_tag="CLOST_0414"
FT   CDS             486671..488374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="CLOST_0414"
FT                   /product="2-isopropylmalate synthase (Alpha-isopropylmalate
FT                   synthase) (Alpha-IPM synthetase)"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20544"
FT                   /db_xref="GOA:E3PVH7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:E3PVH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20544.1"
FT                   /translation="MNYKKYKGYETIVLEDRNWPSRKIEKAPQWCSVDLRDGNQALITP
FT                   MGLKQKLRFFEYLVKMGFKTIEIGFPAASDTEYEFTRTLIEEGYIPEDVTIQVLTQSRI
FT                   QIINKTFEALKGTKNAVVHLYNSTSTLQREVVFRNSKEETIELAVFGARAIKELALKNP
FT                   ETNFTFEYSPESFTGTEMDFAAEICNSVIDVWKPTKDKKVIINLPSTVEMATPNTYADQ
FT                   IEYMCRNLKSRENIIVSLHAHNDRGTGVAATELGLMAGADRVEGTLFGNGERTGNADIL
FT                   NLGMNLYTQGINPELDFSDINSMIEIYEESTAMNVHPRHPYAGDLVFTAFSGSHQDAIK
FT                   KGMARMNKQAQYWEVPYLPLDPKDIGKSYEPIIRINSQSGKGGVSFILEQNYGLYIPKD
FT                   FQKDAGRVITAYSDKMQTEIGAEEIYEVFLNEYVDIRTPLQLNYHKTQSVDSDWDLVFI
FT                   EAEIEYNMQKHYVQAEGNGVVSAFCNSLKEIIGMDIDIVDYRGHSMEYGTKAKAISYIE
FT                   LKNETGERFYGAGTSSSVGKSSLRAVVSAINKMILAQQTKDMDTQEEDIA"
FT   gene            488398..489666
FT                   /gene="leuC"
FT                   /locus_tag="CLOST_0415"
FT   CDS             488398..489666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="CLOST_0415"
FT                   /product="3-isopropylmalate isomerase subunit, dehydratase
FT                   component"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2124684, 2993799, 374346, 8119295, 9298646, 9600841,
FT                   9740056; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20545"
FT                   /db_xref="GOA:E3PVH8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20545.1"
FT                   /translation="MGMTMTQKILADHAGRKYVEAGELIKVKLDIVMGNDITTAVAIPE
FT                   FNNTGASEVFDKEKVVIVLDHFTPNKDIKAAEQCKVCREFAYEKDIVHFYDVGDVGIEH
FT                   VILPEKGIVAPGEVIIGADSHTCTYGALGAFSTGIGSTDMAVGMATGEAWFKVPSAIKF
FT                   NLTGSLSKHVSGKDVILHIIGMIGVDGALYQSMEFTGDGIKSLSMDDRFTIANMAIEAG
FT                   AKNGIFPFDEQTKDYIDIHSTKPYKIYEADEDANYEKIYNINLSSIRPTIAFPHLPENT
FT                   VTIDEADEIEIDQVVIGSCTNGRLSDMKITADILRGKKVNKRVRTIIIPGSQKVYLECI
FT                   KAGYAEDFINAGAIFSMPTCGPCLGGHMGILASKERCISTTNRNFVGRMGHVESEVYLA
FT                   SPAVAAASAIAGKLIDPAKLKEA"
FT   gene            489668..490177
FT                   /gene="leuD"
FT                   /locus_tag="CLOST_0416"
FT   CDS             489668..490177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="CLOST_0416"
FT                   /product="3-isopropylmalate dehydratase small subunit 1
FT                   (Isopropylmalate isomerase 1) (Alpha-IPM isomerase 1) (IPMI
FT                   1)"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20546"
FT                   /db_xref="GOA:E3PVH9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20546.1"
FT                   /translation="MRARGRVFKYGDNIDTDVIIPARYLNVSSGEELAKYCMIDIDSDF
FT                   VNKIKAGDIMVAGKNFGCGSSREHAPLSIKCAGISCIIAESFARIFYRNAINIGMPILE
FT                   SREASLNIEDSDEIEVDFSLGIIKNITKNCEYQAQGFPTFIEEIMKADGLVKQTRMNLS
FT                   SNDKGK"
FT   gene            490201..491352
FT                   /gene="leuB"
FT                   /locus_tag="CLOST_0417"
FT   CDS             490201..491352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="CLOST_0417"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number="1.1.1.85"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 204639, 8119295, 8875643, 9086278, 9298646; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20547"
FT                   /db_xref="GOA:E3PVI0"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20547.1"
FT                   /translation="MGSFKVAVIEGDGIGPEVCRAACEVLEKTGEIFGHEFEFNKALAG
FT                   GIAIDETGECLPEATVNLCRASDSILLGAVGGPKWDDLSGEARPETALLGLREELGLYA
FT                   NLRPATIHMALKNACPLKEEIIGDGIDILIVRELTGGIYFGEKGWKGSKNGMKAYDVES
FT                   YSEAEVKRIAIRAFDSAMNRQKRVVSVDKANVMESSRLWRRVVTEVSHDYPEVELTHMY
FT                   VDNAAMQLIKDPRQFDVMVTSNIFGDILSDEASMITGSIGLLPSASLGEGNFGMYEPIH
FT                   GSAPDIAGQNTANPIAAILSSAMMLRHSFGLIEEARCIENAVTKVLESGYRTYDIKDSY
FT                   KIIKSEEGRESVSSMIMGCKEMGSLITNMIQAENKVFANNTSF"
FT   gene            491500..492753
FT                   /gene="glyA"
FT                   /locus_tag="CLOST_0418"
FT   CDS             491500..492753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="CLOST_0418"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="1.5 : Serine family"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number="2.1.2.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10656824, 2034230, 6190704, 6300791, 89166458, 92118786,
FT                   92388117, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20548"
FT                   /db_xref="GOA:E3PVI1"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20548.1"
FT                   /translation="MLEITRQTDPILAQILDEELWRQEQNIEMIASESTVPIPVMELSG
FT                   SVFTNKTLEGYPGKRFQAGSHLADKLEELAWERAKELFGAEHVNIQSYSGSTANYSVFA
FT                   AILKPGDKVLSMRLDQGGHLTHGSPANWVSRIYDFEFYSIDKDTELINYEDIEEKAKAL
FT                   KPRLIIAGGSSYSRLIDYERIAKIAKENDAYFMVDMAHIAGLVAAKVIPSPIPHADFVT
FT                   SSTTKTFCSARSGMVFCKKQHAKLLDKGTFPGALGSMHLHTMAAKTWSFKYAGSEEFKA
FT                   IMKQVVINSRCLASELESYGFRIVSGGTDNHLLVADLRGKKITGQVFQEALDSIGITVN
FT                   KNMIPFDPESPAVTSGVRIGLTAVTQRGLKEAEIKQIANIMNKVADAPHDEANLASCKD
FT                   EARNLIANFPLYPAGSFE"
FT   gene            492992..494695
FT                   /locus_tag="CLOST_0419"
FT   CDS             492992..494695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0419"
FT                   /product="putative Serine phosphatase precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20549"
FT                   /db_xref="GOA:E3PVI2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20549.1"
FT                   /translation="MQSQVASSDKSEKTIRYLSTVVASSVVIFLFSIFINRFVEIKISQ
FT                   DTYLMFHVFTEIASALISFSIFVVLFFTYDIFYRRYSLILANTFFITGLLDIFHMLTYN
FT                   GMYSLFPENIQTPTYFWIFSRFILGIGLFIAYTTKKDALSSIKKGYSIIVGILVVGVVF
FT                   LLSVTYVEQMPPLIIKGKGLTNTKVIWEYIITTIFIIDIFAYVNRSEGKYTTANIYMLS
FT                   GLMLGLFAEVCFMLYVNVYDTLNITGHIFKILSYGYIFRAVFVKNVRRPYQQIFEQKEM
FT                   LTLDINDMTIAMEEQTAKIYKQNKELEFINTKIKDDLASTSEIQKAMFPRKDLVINDLR
FT                   FNFEIFPCEELSGDYVNYFSIDDENIGFYIMDVSGHGVAAAMLGVFAAQSIGESMRINY
FT                   KEASIFSPAAVLNHFYSLFNKSNFPDEIHIVMLYGMYNKNDNKVILSSAGLNCNPILIS
FT                   QDSKPRFLEIESGFPICKLGDVFEPNFEDYEIELKFGEKLLIHTDGLTEMRRQDGDFWG
FT                   ADSLLAYIDSIGVSPSFILNNKLKSQIVQNINNSGQDDDITYCVIEKISP"
FT   gene            complement(494848..495345)
FT                   /locus_tag="CLOST_0420"
FT   CDS             complement(494848..495345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0420"
FT                   /product="putative Multiple antibiotic resistance protein
FT                   marR"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20550"
FT                   /db_xref="GOA:E3PVI3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20550.1"
FT                   /translation="MFQDYDFQGYIDAYSFIEFSSGQTIINILKTERIMRMVYDRLFEK
FT                   YNISEPKFFVILLLSIHEADGMPLIELGKNMMVSRANMTTLIDRMIKENLVEKRKNADD
FT                   KRSIKAHLTPKGRQLFDEIKDLHMEFSQRMTKALTEEERATLNSILKKLQEDIVQDFSK
FT                   TK"
FT   gene            complement(495351..496454)
FT                   /locus_tag="CLOST_0421"
FT   CDS             complement(495351..496454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0421"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20551"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20551.1"
FT                   /translation="MTNFISELKKFFTVPKNLLFMIGIPMIFTVFFGNVYRNDYLNTIP
FT                   ITVYDMDNSSLSRSLVEEFDKNPRYTVDFYSENLDEVKQAVESTQVYMGVIIPSDFEKD
FT                   VKSKKSSKVALIVDATNMAVANNALASATEIISTVNAGVNLQFLEGKNVPPSLSKRYVN
FT                   IFEMNNRTLWDPKLSYKYYVMPGMILVLVQQLFLSIFVVNVIEDKTNIFYKILIHTIIS
FT                   SLTFLICTSLLKHVLGINIIGNMLTSTFLSFMYLISLSSIALVLALSISSPLRATQLCM
FT                   LLSVPSFLTAGYVWPVMKMPQLSVYIIKALWPLIYMIAPLRDYLIKGALPYYFKSNMLQ
FT                   MTIFACIWFFIAFLISKKSRSCLDEED"
FT   gene            complement(496447..497595)
FT                   /locus_tag="CLOST_0422"
FT   CDS             complement(496447..497595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0422"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20552"
FT                   /db_xref="GOA:E3PVI5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20552.1"
FT                   /translation="MNINFKKYIAPLILILIFPNLVNILTCYSMKEKQLRYIPSAVYLG
FT                   DNTSMTRDIVRNLKSSETFDVQYIVDDPNEVEALMRDGKILFGLIIPQNFTNDIKNFKS
FT                   PKLTTVIDGTQLSPASFTKIASSELLMTIKAGAMMSTYQGKLSMSETEALNTAMPINIV
FT                   NRLIGNPTRNYINFLLPGMMLAIVQVAVAMNAASSKIVKKSSGIIDFFKNVMKNLIDYG
FT                   ILGIVSAVLVLAVQHYIFDVPIKASYTSVLLLLIVFMLAVVSMSLLIASIFSKKQVFAT
FT                   QVAAVWFIPSSILSGYSWPLISMPDFFRQISSFMPYTYFVSTLRNLMLKGHSYDYTNNI
FT                   AMLLILTLGSLILSLISFVIRKQILKRNITLKSLSGRKVLHD"
FT   gene            complement(497607..498689)
FT                   /locus_tag="CLOST_0423"
FT   CDS             complement(497607..498689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0423"
FT                   /product="putative Secretion protein HlyD family protein
FT                   precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20553"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20553.1"
FT                   /translation="MTKQFTLTRKLLVFFIISSLLLSSVLTGCTTSSAEDLNLLQGNLE
FT                   AEDVDINTKIPGKILTIEVEEGQYIEKDDVIATIDAKDLAAKREGLVAQANAALAAVDI
FT                   AKAQQQAAEGQLEAAKALLSKAQNGARSEDIQKAQANYDIMKKSYDRILALYEEGAVAL
FT                   AQLDEIETKLKVAEQDLSIAKSGARAEDIEAAKGQVAAAQGQVAAAAGSVIAANEKYTQ
FT                   ATAGITEVDTYITDAAIRSPLSGYVTSLNCSAGEMLSTGMNLATITNLDKITLTVNADE
FT                   TLLPKFKENQAVKVSVLSYKDEEFNGKIVQINKKPDFAIKKASNENGDFDLITYGIKIE
FT                   IENKDQKLRPGMTAFINIEE"
FT   gene            498947..499246
FT                   /locus_tag="CLOST_0424"
FT   CDS             498947..499246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0424"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20554"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20554.1"
FT                   /translation="MINMNKIADEAIEKYDIVITGQYGPHACLKEAKEYLFRTHPELVA
FT                   YHLYKSAQEYASKLETAKENLTYGVFESRECLIIFIHNKEVNDTKFIPYHILKG"
FT   gene            499428..499592
FT                   /locus_tag="CLOST_0425"
FT   CDS             499428..499592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0425"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20555"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20555.1"
FT                   /translation="MLIQPICRSFQATGPVTDGTLEISRYRISVGAISQILCDRISQVK
FT                   KTENMEMLF"
FT   gene            499668..500765
FT                   /gene="gcvT"
FT                   /locus_tag="CLOST_0426"
FT   CDS             499668..500765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="CLOST_0426"
FT                   /product="aminomethyltransferase,
FT                   tetrahydrofolate-dependent, subunit (T protein) of glycine
FT                   cleavage complex"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.1.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8219277, 8375392, 87055238, 9298646, 93387305, 99421649;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20556"
FT                   /db_xref="GOA:E3PVI9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20556.1"
FT                   /translation="MTERLKRTPLFEVYGNYDPKIVPFAGWEMPIEFKGITEEHKMVRT
FT                   SAGIFDVSHMGEIEVKGKDAEEFCQKICTNDISKLEDNQILYSFMCYENGTVVDDILVY
FT                   KFSQDDFMLVVNAGNISKDYEWIVNHTTGYEVNINNISDNIGQVAVQGPKAEAILQKFT
FT                   DTDLSEIKFFYALRNVDIKGINTIVSRTGYTGEDGFEIYCEAKDSVKLWKLILDESPEE
FT                   DILPIGLGARDTLRFEANLPLYGNELSDEITPIEAGYGYFVKLDKDDFIGKEALKAQKS
FT                   EGLKRKIVGFELLDKRISRHGYEVYLENDKIGIVTTGYQSPTLQKSIGLALIDAQYVAL
FT                   GNEIYIDIRNKKVPAKIVSRNFYKK"
FT   gene            500877..501257
FT                   /gene="gcvH"
FT                   /locus_tag="CLOST_0427"
FT   CDS             500877..501257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="CLOST_0427"
FT                   /product="glycine cleavage complex lipoylprotein"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.2 : Amino acids and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1802033, 8219277, 8375392, 87055238, 92199239, 93387305,
FT                   99421649; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20557"
FT                   /db_xref="GOA:E3PVJ0"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20557.1"
FT                   /translation="MSTSKVYFTKDHEWIKVEGNVAYIGITDYAQKALGEIVYVELPEV
FT                   DSEFSLGDVFSVVESVKAASDIFMPVDGKVVEVNEALSDEPEKINQDANDIWIMAVELE
FT                   NSIESYELMSESEYIAMYEKEA"
FT   gene            501261..502604
FT                   /gene="gcvPA"
FT                   /locus_tag="CLOST_0428"
FT   CDS             501261..502604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvPA"
FT                   /locus_tag="CLOST_0428"
FT                   /product="putative glycine dehydrogenase [decarboxylating]
FT                   subunit 1 (Glycine decarboxylase subunit 1) (Glycine
FT                   cleavage system P-protein subunit 1)"
FT                   /EC_number="1.4.4.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20558"
FT                   /db_xref="GOA:E3PVJ1"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20558.1"
FT                   /translation="MHPYLPNTEQEIKAMLDTIGVKSTEELFEDIPASLKLSRKLNLSD
FT                   SLSEFEIRKHFKDIASKNTSIEDKVCFLGAGIYDHYIPSVIPQLISRAEFFTSYTPYQP
FT                   EISQGSLQAAFEYQSMICELTGMDVSNISLYDGATAAAEASVLACVSTRRKKVLVSNTV
FT                   SPETRAVLKTYFQYRNMDVVEVSSIEGQTDIDDLKSKLDKDTAGVLLQYPNFFGIIEDI
FT                   SKYEPIIHENKSLMMLYTDPIALGLLKSPGELGADMALGDGQDLGLPLNFGGPTLGFIN
FT                   VKDKLLRKMPGRIVGQSVDSNGNRAFVLTLQAREQHIRRQDATSNICSDQTLNAIRAGM
FT                   YLAVVGKEGIKEVAKSCLNKANYAYKELQKLENVQALFEGPIFKEFAIKTKASSEKVLQ
FT                   ALLEAGILGGYSLSSTDYGLENAILIAVTEKRTKEEIDKLVSVIGGVR"
FT   gene            502601..504058
FT                   /gene="gcvPB"
FT                   /locus_tag="CLOST_0429"
FT   CDS             502601..504058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvPB"
FT                   /locus_tag="CLOST_0429"
FT                   /product="GcvPB"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20559"
FT                   /db_xref="GOA:E3PVJ2"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20559.1"
FT                   /translation="MSYDKMIFELSAHGRKAIDFPELDIDFAFEDSLIPKEYLREKSAN
FT                   LPEVSQLDAVRHYTNLSKKNYSLDAGFYPLGSCTMKYNPKINEEIAANDKFSGVHPLSP
FT                   VETVQGELEIMYNLANMLSEITGMDEFTLQPAAGAHGEWTGLMLIKAYHMHRGDEKRTK
FT                   IIVPDSAHGTNPASANVAGFEVIELETNADGSIDIEKLKAVLSDEIAGFMLTNPSTLGF
FT                   FETQIEEVASLVHASGGLLYYDGANMNAIMGIVRPGDMGFDVCHLNLHKTFSTPHGSGG
FT                   PGSGPVGVKKHLAEFLPVPKVEKVDDKYILNYDKKDSIGSIKSFYGNFGILLRAYVYIL
FT                   SMGADGLRAVSENAVINANYMRQMLKDDYQLAVDKLCKHEAIFAGIKDKSTGITTLEIA
FT                   KRIIDYGFHPPTVYFPLIVDSAIMIEPTETESKQTMDEFINAMKQIAKEAKENPEIFKT
FT                   APHHSPASRIDEALAARKPVLTYKPSL"
FT   gene            complement(504114..505298)
FT                   /gene="yhdR"
FT                   /locus_tag="CLOST_0430"
FT   CDS             complement(504114..505298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdR"
FT                   /locus_tag="CLOST_0430"
FT                   /product="putative aspartate aminotransferase"
FT                   /EC_number="2.6.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20560"
FT                   /db_xref="GOA:E3PVJ3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20560.1"
FT                   /translation="MISNKMQSLVANSSVIRAMFDEGKRLSKIYGEENVFDFSLGNPNV
FT                   EPPEVIKESIKDILDNEVATYVHGYMNNSGFEDVRTTIAEHESKKHGMNISFESIVMTV
FT                   GAAGGLNIIFKTLLNPGDEVITFAPFFGEYRAYSANYDANLVVVEPDIDTFEPNIEALK
FT                   SAITPKTKIVIVNSPNNPTGVIYSDAALTKLAEVLKQKEEELGIDIFLISDEPYREIVY
FT                   DNAEVPCLLKYYKNTIIGYSYSKSLSLPGERIGYLVVHPEIADFSDVMGSLNVANRILG
FT                   FVNAPSLFQRVVAKNLNAEVDVNVYKKNRDALYNHLVSIGFECVKPQGAFYLFPRSPIA
FT                   DDKKFCEDAKQFNLLLVPGSAFGCPGHFRLSYCISYEKIINSLPAFDKLIALYK"
FT   gene            505712..507700
FT                   /locus_tag="CLOST_0431"
FT   CDS             505712..507700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0431"
FT                   /product="Translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20561"
FT                   /db_xref="GOA:E3PVJ4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20561.1"
FT                   /translation="MRVYESDKIRNIAILGHSGSGKSNLMEAVHYTVKLTNRISKPTDE
FT                   AKLTSSMNLHSLEWNDHKYNFLDTPGYFDFDGEVVSAMAAASGTIIVVDGTTDLQVGTD
FT                   KALEITDEYQTPRFIFVNKIDSEKSDYDKILDQLRERYGKKIAPFHVPWGKAEAFKGFI
FT                   NVVDMFAREYNGKECVNVDMPTDMDDIIAPVREMLMESVAESDEALMEKYFAGEEFTTE
FT                   EIHKGLRKGVLEGDVIPVLCGSTAKNIGVHTLLDMIWDYLPSPLDEKDIKESDVFAGQI
FT                   FKTIVDSFVGKISFVKIHEGHLKPESELYNVKKGHKERIPKVFTLVNGEYKEMSEARAG
FT                   DIVAFTKLQDSSTGETLSSKSGHESYDDLVFPKPQMLVAVEPTNKGDEEKISSGLQRLM
FT                   EEDPSFTWERNAETKQTVLGVQGEIHVNSLKDKLKDKFGVEVKLLDLKVPYRETIKGKS
FT                   DVQGKHKKQSGGHGQYGDVKIRFGPSSEPFEFAEEIFGGSVPKSYIPAVEKGLKESMEK
FT                   GILAGFPVTNIKAVLYDGSYHDVDSSEMAFKLAANMAFKKGMEEAKPVLLEPVMKLKIV
FT                   VPEEFMGDIMGDINKKRGKVLGMEPFKGTKQLIMAEAPQSETFKYAIDLKAMTQGKGYF
FT                   EMEFERYDEVPSQLAQKIIEERKNEEH"
FT   gene            complement(507829..509175)
FT                   /locus_tag="CLOST_0432"
FT   CDS             complement(507829..509175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0432"
FT                   /product="putative Glutaminyl-peptide cyclotransferase"
FT                   /EC_number="2.3.2.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20562"
FT                   /db_xref="GOA:E3PVJ5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20562.1"
FT                   /translation="MMKKVSAFALASLIIVTPIFSNALTKDPDAGELAYKHVVELSDEI
FT                   GDRTQATNGEYDAKDYIEDVFMDLGYDTKLQSFEIQRTKDDKPYDTVTSYNVIAVKPGE
FT                   SKREIIIGAHYDSKNNTGKGADDNASGVAVMLETAEKISDLKTPYTVRFIAFGAEESFK
FT                   NSDNIKNGGLNGSSYYAENMTQAEVNNTVAMINLDSLLAGDFMYVYGDLGKKGFVREQA
FT                   LAIAKELGLDLETNPGHNKDYPAGTTGDWSDHAPFVERGIPYGYFEATNWHLGDMDGYT
FT                   QTEKHGEIWHTENDNLDFLEREFPGRVEERLMTFSNTLTELVLNFNPAEYNSVKIKIGK
FT                   DEIKNNGKPEKAAKKPFIKEGRALVSLDVIEKAMKLEVSVSNNEKELTISKNGKTVVFD
FT                   LDTEKTYDKDSKAVITEDGDIFVAVNEIAKVLNGNVKWDAKDKSVEIVY"
FT   gene            complement(509334..510047)
FT                   /locus_tag="CLOST_0433"
FT   CDS             complement(509334..510047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0433"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20563"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20563.1"
FT                   /translation="MKKIAIALFLSAILGTSVLAGCSPKEEAPAPDTTKEEAAPEAEQP
FT                   AAEEESADLAELFKKGENAFKDGIYYAQTFTMADQQSQMKTWHKGDKVKSSIVADGDEM
FT                   INIIDSKTGEFITYSASEKTGMRFKADSGDSSFMPDTSMTDIASVDEQVDTATFEVVGD
FT                   EKILGENCAVILSKDKATNEEVKLWVSKKYGITMKMVSKGVDGSEMTIEVTELKVGDIN
FT                   DSEFEVPSDVVIEEF"
FT   gene            510174..511439
FT                   /gene="lysA"
FT                   /locus_tag="CLOST_0434"
FT   CDS             510174..511439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="CLOST_0434"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14627808, 9044297; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20564"
FT                   /db_xref="GOA:E3PVJ7"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20564.1"
FT                   /translation="MQENFEFCSVDSVYLAQKYSTPLYVMSQDIIEEKIDYIKVNFLDK
FT                   YPRTYAYYASKAFLTKAMAKIIKKSEMGIDVVSYGELYTALDAGINPDKIMFHGNNKSK
FT                   DELEFALERGIGRIVVDGISELKLLIELAGERFTAKILLRISPNVEAHTHKYISTGQLD
FT                   SKFGLSFASKDLDEAIELAIKSEHIDFKGFHFHVGSQLFDNEAHVESTKKAMELIKEIK
FT                   DKYDYEIEDLNVGGGFGVRYTAEDEPMPLEYFTDAIMEEVIALIDKYEIIRPNIFIEPG
FT                   RYIVAEAGITLYTVGSVKNIESVRKYICIDGGMADNPRPALYQAKYSACIANKMYDEDT
FT                   ELVTVAGKCCESGDILIWDINLPKVERGDILAVMGTGAYNYSMSSNYNKLAKPAVVMIH
FT                   DKEDRLIVQRESYEDLLKNDLG"
FT   gene            511451..512500
FT                   /gene="rmlB"
FT                   /locus_tag="CLOST_0435"
FT   CDS             511451..512500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="CLOST_0435"
FT                   /product="dTDP-glucose 4,6 dehydratase, NAD(P)-binding"
FT                   /function="6.11 : Sugars"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="4.2.1.46"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7517391, 92120472, 94292434, 94292435; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20565"
FT                   /db_xref="GOA:E3PVJ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20565.1"
FT                   /translation="MNLLVTGGAGFIGSNFIKYMLKHHDYRIVNLDLLTYAGNLENLED
FT                   IEGDARYKHIKGDICNRELVESIFRRFDIDMVVNFAAESHVDRSIEDPEVFLRTNIMGT
FT                   QALLDIAKDFWKIDLFDKYCKEYKKGVKFVQVSTDEVYGSLGETGLFKETTCLNPNSPY
FT                   SASKASADMIVRAYSETYGLPVNITRCSNNYGPYQFPEKLIPLMINNAINDKPLPVYGD
FT                   GKQVRDWLYVEDHCSAIDSVLHKGMLGEVYNIGGNNEKQNLDIVKLILNVLGKDETLIT
FT                   HVKDRLGHDRRYAIDNTKISTELGWEPKYTFDEGIKLTIKWYLDNPRWIEKIISSEYRN
FT                   YYSKMYEGR"
FT   gene            512748..513290
FT                   /locus_tag="CLOST_0436"
FT   CDS             512748..513290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0436"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20566"
FT                   /db_xref="GOA:E3PVJ9"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20566.1"
FT                   /translation="METNTYEDIEQALIGYKEATATWDKQEYLRQLLAYITPLIKKKIR
FT                   HYFGYVDEDLLQLGYVRTIELIDNYELERNILFMGYMKRMLGCYYYDEKRKQAKVADLV
FT                   EYDETFMESDYDHGYFDIELEDLLKGLSYKERYVVERHIMEKSLLKNVAKELDVSYVYA
FT                   KELKRNAIKKLRVLICL"
FT   gene            513595..514866
FT                   /locus_tag="CLOST_0437"
FT   CDS             513595..514866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0437"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20567"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20567.1"
FT                   /translation="MRKNRRFLAIIMVLAFLGWSFNAQRVFADSEIPPEIQQEEQEVVD
FT                   EEQNEEQPENNLEPENEEEVIEEEPFEEEEVIEEVIEEEIVEEIIEEEPIEEIVEEVID
FT                   EEIEEIIENEEVPMSLMKAPEILDVDVQYSGPAAQQPIDEANFKLEETGYETEKVDDSP
FT                   RGSGTISLDNEEFIKWFVSEDAKYLSWETSSSNVTVYKVYVKGGQGEDGTKGYLYVYDP
FT                   TISSDSGLHPAVNKNDSIAAISHFSFLFGLVIPEDPEDPEDPEDPEDPEDPEDPEDPED
FT                   PEDPEDPEDPEDPEDPEDPEDPEEPENPENPEEPEEPEEPTVPEDDDDDDDVVVIEEEE
FT                   TPLALPGEPDVFVATVTSINTPEEIVEEEVPLGVPQVEEPEEEIIEEEVPLAAPELPKT
FT                   GGFAPELLYALGLSLISVGFKFRK"
FT   gene            515263..517257
FT                   /locus_tag="CLOST_0438"
FT   CDS             515263..517257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0438"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20568"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20568.1"
FT                   /translation="MRKVKKNRLLALLLMGSLLFSNYGIMAYADEIPTAQSDSGVTQDG
FT                   GTQAPSQDEGTQTPSQDEGTQTPSHDEGTQTPSQDEGTQTPSQDEGTQTPPQDEGTQAP
FT                   SQDGGSQAPSQDGGTQTPPQDGNPPQIIEVEPAKVEIVDYKETQNVDKNGNKIIAKEVE
FT                   YSNTGTEGETITEIVPKWGDFNDEEYETKVFDLKNTKDSKEDVTAYCNDIDTNLKNNSK
FT                   YSVQELPQNSKDIKTSEKLRGIVLNGYDPNTNIETYRSELLKDASKYLTQNQINNLTEE
FT                   DAIAATQMAVWKLDNPNKKFVDYDWEKGFLGIKKRVEDEKVVKLAEYLSKQKESDPSKN
FT                   NLKIEAKATDENTAVKLENGEVSVNYTYSILNRVNEQVQTFLEVFVNGNQLDTNAYTVV
FT                   DLGNGNKSLSFKNAIEDKTKNAEIEAKIVIKGTYAVEDVYDLVPTKDNKNTQRLVSTPM
FT                   LMSYNLPTLKQMFKIEYTAPKVELVDPDEPGEDEPGEDEPGEDEPGEDEPGEDEPVEDE
FT                   PGEDEPGEDEPVTPGGGGGTTNPPVVEPQPEPTNPTPQPTTPVAQNDNDDDDEDIEDEA
FT                   TPLAAPQIIPVALPVATLASAEQTEEVIDEETPLSAPPVMETEEEIIEEEVPLDAPAPV
FT                   LPKTGGFAPELLYALGASLIATGLKIRKK"
FT   gene            complement(517420..518226)
FT                   /locus_tag="CLOST_0439"
FT   CDS             complement(517420..518226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0439"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20569"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20569.1"
FT                   /translation="MRKLLLLNMITIIVVTLTACSVIEKPESFTNAVTSSKKNASYDAK
FT                   ATASLPQPVEIRIESDFGETEAFSYDIKYPVISNLQNQNTQAALNLKLKNQVYNYMNNI
FT                   KSLSKSNSKAESFVPYSVTTDFEIKTSNQNILSMVATYTQNTGKANPVTALATYNIDTS
FT                   SGKELSLEDLFKSDFDYKNVINKEITNQIKKDISGKVYFQEKNLRFVSISQMPQFYIED
FT                   GNLYIQFDIYEIAPYATGTPVFLIPNEIIYSGLKEQYKPMLLNQVD"
FT   gene            518382..519476
FT                   /locus_tag="CLOST_0440"
FT   CDS             518382..519476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0440"
FT                   /product="putative ABC transporter"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20570"
FT                   /db_xref="GOA:E3PVK3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20570.1"
FT                   /translation="MRVLDVVFDNHPIFDSNTISFETEDKKILDTIILAGINGSGKTTL
FT                   LSSIFKTFKKLEDNKFCLDEKDTVNLHLDINEDELEKAPKMIYLPSEVRFQSIHNSNQA
FT                   DEIPLAYCIDDKSTHDIISYIKQAFDKQIFSNPETTVGKSIDAVCDEINSIFSILDMDV
FT                   YLVGIKDPKTKMPLFRNESGVEFDINGLSSGEKQLFIRLLSLKSLEPEGCVILIDEPEI
FT                   SLHPSWQQRIVEVYQNIGKDNQIIIATHSPHIISSVKRESLKILSKKERWVKVINGENL
FT                   DETYGVTADMILLDIMGLSTTRHPHIQEKIDELKSMVRNELYETEEFKLLYEDITGVIG
FT                   TIDQDILLVNIEIARRKGLKNAGH"
FT   gene            519463..520065
FT                   /locus_tag="CLOST_0441"
FT   CDS             519463..520065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0441"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20571"
FT                   /db_xref="GOA:E3PVK4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20571.1"
FT                   /translation="MLDIKKADPPDFLLEFIEEKSNASYKNMRGDMRKDLRHYIAYNEQ
FT                   CKSSRCFCAYCEREIVVNSDNANGSHIEHIKPQSRFPEDDLDYDNMIVSCNAKESCGIR
FT                   KGSHYFEGFIDPVNFSPDVFFIYDLMTGEIIPKEGIKDSNTPAYKSLDLLGLNSVRLTD
FT                   ARKRVIVEIDNLLKFMKKEDIRHFLKQFPSLLDYMLK"
FT   gene            520083..521096
FT                   /locus_tag="CLOST_0442"
FT   CDS             520083..521096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0442"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20572"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20572.1"
FT                   /translation="MADLNYKAEDIVYKVKEIGGYMELELPRKESYYYGPDVVEVNTGR
FT                   AAIYHAIKASKAKKLYLPHYLCTSMLQVIEPLNLEFEFYNIDENFMPIFDRQTTEDEAF
FT                   LYINYFGTASNNTIKKLKNCHKNFLMDNTQAFFAKPIKGAYSLYSARKFFGVNDGGYLI
FT                   KDGIQKIDLESDISYPHAIHLLKRIEEGANAAYLDNMKNEDRFDDFNPIGMSKLSKRIL
FT                   ESIDYEEVKLKRQRNFYYLHSKLKDLNKLNLEHSFEAPMVYPMLIEHKDLRAYLVSKKI
FT                   YVPHWWKDVLSRVESNSFEHYLSTYLLALPIDQRYDLEDMDYIVGHIKAFDNSILL"
FT   gene            521124..521681
FT                   /locus_tag="CLOST_0443"
FT   CDS             521124..521681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0443"
FT                   /product="putative Galactoside O-acetyltransferase"
FT                   /EC_number="2.3.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20573"
FT                   /db_xref="GOA:E3PVK6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20573.1"
FT                   /translation="MDEKKLNNIASSMDKVFWSFWDNLIYKALESSVDIMPPRLQKLIA
FT                   NYYTDARIRKLYFDRLGVKMGEGSFANLGMKIIVSANHRYSIEIGDNVSIGPNLTLVTE
FT                   AAAGNGKEINTLPYVKEKLTKEAKIYIEDEVWIGANVVILPGVRVGRCSVIGAGAVVNS
FT                   NVEPYSVYAGVPARKIRDLEKE"
FT   gene            521684..522616
FT                   /gene="yfdH"
FT                   /locus_tag="CLOST_0444"
FT   CDS             521684..522616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdH"
FT                   /locus_tag="CLOST_0444"
FT                   /product="bactoprenol glucosyl transferase; CPS-53 (KpLE1)
FT                   prophage"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12878731, 13129938, 9689094; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20574"
FT                   /db_xref="GOA:E3PVK7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20574.1"
FT                   /translation="MDKVSIIVPIYYNELNIPHLYEQMKEKILSRTDFEAEIVCVDDGS
FT                   KDGSYKALLELREKDDRFKVVKLSRNFGSHTAILAGFAHATGDCMTMVAADLQEPLEII
FT                   IEMYEKWRQGKKVVIAVRKDREDGFFQKLFSNTYYSLMQKYALKDMPSGGFDCFFIDKK
FT                   VRDVLVSMNEKNSSIVGQVLWAGFEMDKIYYVRKKREIGESKWTLSKKIKLFIDSFMAF
FT                   SYVPIRFISTLGIFISIVGFILAVFLIVNKFMFNVPVQGWTTMMITLLMLSGIQMLTLG
FT                   VIGEYLWRNFDESRGRPTYIVEETHGIDE"
FT   gene            522643..523656
FT                   /locus_tag="CLOST_0445"
FT   CDS             522643..523656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0445"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20575"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20575.1"
FT                   /translation="MVYCFYDIATNEKTKCSKTDFDFRFKALKTNEVLFFDSEDFHLYH
FT                   SKNADEVYFLGFLKESKAIGYCIVGLRDNSGRAMLCIPYSSPFSTFYFNPKIDDLDKAR
FT                   CINGLKSMANELDADFRLILAPDIYDETLAISMGLVLDEGFKLQYSHVNNYYNLKEITD
FT                   IDEFVSERAHSFRKNLNKAMRSNLVIRLNDDSFLQNAYEVIKLNRAEKGYPLAMSYQQI
FT                   LDISIMDKSKVDAFVVSSEQTDIAAAIVFEISSNAVQVVYWGALDEYSNLRPMEFLAMN
FT                   VVKYYKEKGYDYVDIGPSTADDKISHGLLRFKKTIGCHTNFKPVFLWQTRGSYDSD"
FT   gene            523649..525148
FT                   /locus_tag="CLOST_0446"
FT   CDS             523649..525148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0446"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20576"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20576.1"
FT                   /translation="MTKIKDLFSKALIILSFFLFLSIFVYINYIASPNFKAPVLKSLVL
FT                   TLGFLLIFIAVDYFMDKFKNKKAVYYAIIGIIIFAGLLIRLYWTNSVSTIQISDFGRMW
FT                   ESAGEIAEGNFSRFQKNGYLYTYPHLAFTTLFYSLIHMITGSSLMAMKFVNIGLSLLTA
FT                   LLVYLISGELSNGKKATAIFIMAINSPFIFFNNILDSQNLAAPVFYFAVLLYLKVFKKK
FT                   IHPLYLVAVGALLSLGNLFRSVGPIFVIAIIMHMLIFSSYSLIQKRKKGKPLKLDKALL
FT                   GPLCLVLMLVAMYVTTFVLNYIFIWAGVFQKPTWDTGGNLILYINAGFNHESNGMWNQE
FT                   DYDLLRDVGFDYDKAEIEARKRLEQRLSDKDKVLTLISNKYRTQWGAGDFGGLYWSTVE
FT                   LESNPKATNDMLVWLNYHFYYVQAFYSALILAIMLKLARGYYKNEIKPEFYFGLILFVG
FT                   FVCLHTLIEMQPRYGYIAMPMITALAAASIGERRSTYEGSV"
FT   gene            525132..526223
FT                   /gene="eryC"
FT                   /locus_tag="CLOST_0447"
FT   CDS             525132..526223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eryC"
FT                   /locus_tag="CLOST_0447"
FT                   /product="Erythromycin biosynthesis sensory transduction
FT                   protein eryC1"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20577"
FT                   /db_xref="GOA:E3PVL0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20577.1"
FT                   /translation="MKVAFNVLDRQFMMHKEEYEAKALEVLRSGWYILGKEVEAFETEF
FT                   AKYLGSRHCVGLASGLDAIVLAFRALDIKAGDEVIVAGNAYIACVMGISMNNAVPVFCE
FT                   PDEYYNIDASKIESLITSKTKAILAVHLYGQPCDMKSIKQICDKHKLYLVEDCAQSHGS
FT                   TYDGIMTGRFSDIGCFSFYPSKNLGAFGDAGAIVTDNSELADKIRVLRNYGSEKRYYNE
FT                   VVGYNSRLDELQAGLLRVKLKYLDELNKERIDIAKRYLSEVDNPKIILPKILDKAMPIW
FT                   HLFVVRVKDRAEFISYLNECNIGSVIHYPIPPHLSQAYEYLGYKEGDYPITESYANEVV
FT                   SLPIYNGMTKEEVDYAIKCLNKY"
FT   gene            526258..526674
FT                   /locus_tag="CLOST_0448"
FT   CDS             526258..526674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0448"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20578"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20578.1"
FT                   /translation="MDKKFKVIDFQELGDPRGHLVVAESNKEVPFLIQRIFYIYGTKDG
FT                   VVRGQHANRESEFMLINLQGSVKIVIDDGRQKDTVILNKAHQGVYLDKMVWKDMCEFSS
FT                   DSILLVLSSMSYDASEYIRDYDEFVREVNDGKLD"
FT   gene            526655..527056
FT                   /locus_tag="CLOST_0449"
FT   CDS             526655..527056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0449"
FT                   /product="membrane protein, GtrA family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20579"
FT                   /db_xref="GOA:E3PVL2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20579.1"
FT                   /translation="MMANLINKIKNSSFFGFALVGAINTGFSFIIYILLLRLDLYYILA
FT                   SILAYIAGIAVSYLLNTKFVFKEEKTIGNLSKFVSVYLTALVINTGLLYALVNLIGFNP
FT                   VLGQIGVTCLVLFYNYVLQKLWTFKKASS"
FT   gene            complement(527081..528304)
FT                   /locus_tag="CLOST_0450"
FT   CDS             complement(527081..528304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0450"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20580"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20580.1"
FT                   /translation="MIKISKEIKRKLLQNRIYLFSLAALVCLLGFLVYYQPGVGYEVKL
FT                   NEKHVGFVKRISHVEKMMTQLDTELRESKGKDITYEANLEYNKGKLNGNDLTEQEDMKL
FT                   SAMSALEIKSPGYLIKSDGKVLMAVKDEKTAQNILDAIKAPFVASKQNAKVEFVQEVNL
FT                   VKAEKINIEKILNSYQALAIVKSPTSASTVSRSSVSREIPETEVAEEGKPLIDVKVTYQ
FT                   DNVNLPIYKAEQRVADSTLTEGTTKVKSEGTNGIKEVVREVVEINGEAVEKTVISETVV
FT                   EPSSPKIVAYGTKPKVSGVVAIAKDYIGVPYKWGGTTPKGFDCSGFTQYVFRKAGVSLP
FT                   RTSSAQGKVGTKVSRSELRAGDLVMFPGHVGIYIGSGKFIHSPSPGKSVRIDDLSTRKN
FT                   FLYGRRVN"
FT   gene            528511..529896
FT                   /locus_tag="CLOST_0451"
FT   CDS             528511..529896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0451"
FT                   /product="putative Efflux transporter, RND family, MFP
FT                   subunit precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20581"
FT                   /db_xref="GOA:E3PVL4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20581.1"
FT                   /translation="MGLEKLKNRFKKTSEQDSVKEEKKKFFKGKKKIIIPVLIIVILGA
FT                   SIFAWSKSKGEQNPMVTTMPLTKGTIEHSLSITGKIEGTDSAEISSSLNYEIVQINVKE
FT                   GDYVEKGQVLAVLDDKDLKQEINLSQKDLELAELQYKENIDSKSKLDTSTASANISVNQ
FT                   SQIEYDEAKRQLEIKKALFESGAIPKEEYTQAEISVQKSEIALELAKDGLRKAKLDVQK
FT                   TIDEQSPKASDKKALEIKREQLNQKQQDLEKVYIKSPISGTVTRVNARLGRTPQASDDN
FT                   KPLFVVENLSDLRMKVSISEFDIGSIKAGLGAEISADVLGSDKVNALVYNISPTGEPKE
FT                   GGNSKEMVIPVILDIVDEDPRLIAGVTASAKIMIEQKDNVFKVPYEAVLEEDGKNYLVI
FT                   EKDNVLKRVPVELGLESDVELEVISSELKENDSVVLSPDPSYIDGMKVEKMPEMGAEIK
FT                   TEN"
FT   gene            529996..530709
FT                   /gene="yknY"
FT                   /locus_tag="CLOST_0452"
FT   CDS             529996..530709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yknY"
FT                   /locus_tag="CLOST_0452"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20582"
FT                   /db_xref="GOA:E3PVL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20582.1"
FT                   /translation="MQTSVESKNSEDVLLELKELYKIYIMGSVEVQALRGIDLTIEKGE
FT                   FISIMGTSGSGKSTLMNIIGCLDGPTKGNYFLEGIDIKEKSEDELSFIRNQKIGFVFQS
FT                   FNLIARTSAVKNVELPMIYAKMHANDRHERAKQLLEKVGLGDRIHHMPNELSGGQRQRV
FT                   AIARALANEPPIMLADEPTGNLDSKSSIEIMEIFRNLNEEGKTVIIVTHERDIAEYTDR
FT                   IVTFKDGQIVSDERR"
FT   gene            530782..531918
FT                   /locus_tag="CLOST_0453"
FT   CDS             530782..531918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0453"
FT                   /product="abc transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20583"
FT                   /db_xref="GOA:E3PVL6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20583.1"
FT                   /translation="MTMLGIIIGISSVITIASLGETSKAVIAKEFEAFGKNRVVIYMPY
FT                   SEEIRDSDYFTMEDIDKVKAKYKEDIVYLAPSTYENTEAISGRKKAKVSTEGVANGYEK
FT                   MVNMDLVKGRFITEADIKSRRYVSVVDKAMADKIFPGENAVGKTIRISVEGQPADAKIV
FT                   GVYEKKKSIFDGMMSSDSTTMYMPYSIFSSQLMYMGSIDMKINESKSSIEVGDSIANFL
FT                   AKMKKREPGFYIVNTTQGEQNSIDQILSTLSLAIGAIAAISLLVGGIGIMNIMLVSVTE
FT                   RTKEIGIRKSLGARRKDILLQFLVESMIVSATGGIIGTTLGIVFASIVSLVLSVPPVVS
FT                   PGIVIIAVVFSAVVGMFFGIYPANRAAKLDPIDALRYE"
FT   gene            532112..532987
FT                   /locus_tag="CLOST_0454"
FT   CDS             532112..532987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0454"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20584"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20584.1"
FT                   /translation="MNKFRQSIFIFIFLALFSLITATTSLAAPSTVQIFVDGVPLMTDQ
FT                   PAVIRNSRTMVPFNALFSALGATVIWDEPQQKVTGTKGDLKVELFINKTGAKVNGQSVT
FT                   MDTPVQIINGRTMVPLAFASSYLGSSVAWDGVNYAAYVSTGLAPDIFQPTIPGVGPVVP
FT                   PVVDPVVPPTVPGITAPAKDTAPKSNVLSGTYVAENLSKQRFAIQFNSSMNADIKGITS
FT                   GTIGKGTYTVSGSSVTISSDLISGTFNMEELTYNGRKIILLKDTSSTGQKTLAMTPVSY
FT                   EEFAKAYVSK"
FT   gene            533337..533951
FT                   /locus_tag="CLOST_0455"
FT   CDS             533337..533951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0455"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20585"
FT                   /db_xref="GOA:E3PVL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20585.1"
FT                   /translation="MKKSEQTKLKISSAACELFCEKGYSATSTSEIAKRAEVSEGTIFR
FT                   YFATKKDLLLYIATYGIEMFAEDIAIKPLVDLSEKYKDESIEKFLYELVMNRYKLMEEH
FT                   KSIIMIFMNELSFHNEIQELFRKEIGEKVNDILTKSFDNFFKRGVFRDDINTRSAMRYF
FT                   SGMIFVIFMEHVHGMRDENVSIEEDVKIAIDIFLNGVRNRN"
FT   gene            533996..535153
FT                   /locus_tag="CLOST_0456"
FT   CDS             533996..535153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0456"
FT                   /product="putative Efflux transporter, RND family, MFP
FT                   subunit precursor"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20586"
FT                   /db_xref="GOA:E3PVL9"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20586.1"
FT                   /translation="MKKLKYLISGILMISLVVSGCSKKAEPEVVEEKKITVETMQSVLD
FT                   DISVETTISGSFKASDEVDVVPKVMGKVTNVSVKEGQVVSKGQVLFTLDSQNAQSAVRN
FT                   AKAAVENAQTAVETARISMERAEQQYNNAVLNYERSKQLYDAGAIPLTQLEQAELAASP
FT                   LSLELAKTQYYQAQVAVDTAKGSLSDANIALGDFTVTAPISGTITAVNVNSGNVFGGGP
FT                   AIKISNLANLTMKVDVSENLIKYFVVGEAMDINVKSAGDTILSGKVKEILPPSQGSLTY
FT                   PVEILVSNPPSEVKAGMFAEINITTESRNQVIAIPSEAVVVKEGNTIVYIIEKDKAKLI
FT                   SVKTGLDNGKMVEITEGLNEGMEVVVKGQNFLEDGALVSVVKQEE"
FT   gene            535157..538300
FT                   /locus_tag="CLOST_0457"
FT   CDS             535157..538300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0457"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20587"
FT                   /db_xref="GOA:E3PVM0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20587.1"
FT                   /translation="MFVSGMSVKRPVTTVMLMLIAVLLGLVSLNRLPVDLYPEIEVPVA
FT                   IVSVDYSGVAPAEMETLVTKPLEQVLSTVSDLDAISSYSRQGSSIIIVQFQYGTNMDFA
FT                   ALEMREKVDMVKGALPDGSGTPMVLKIDPNAMPVIALSMSSQMPIDKLQSIVEDDISSR
FT                   IERLDGVASVSSSGGKEKEIRVELNQAKLSGYGLSIAQIQNVLRSENLNLPGGTVKRGD
FT                   QELIVRTTGEFRTVDEIRNIPLTLRSGESIRLYDVASVEEKYKDINSMSRYNGESSISL
FT                   SVSKQSVANTVKVAESVLLEVGKLKAEYPDINMEIAMDQSEFINKSISNVVASAVGGGL
FT                   LAVIILFLFLRNIRSTFIVGIAIPVSIVTTFALMYFADLSINLISLGGLALGVGMLVDN
FT                   SIVVLENIYRLAEQEGYQMEKAAIEGTKQVGMAVFASTLTTVAVFLPIVFVEGFTAIIF
FT                   KQLSYTVTFSLLSSLVVALTVVPMLSAKILKVGETKKREHKGFSLGRVLDVFSNGIDWV
FT                   AKKYSGLLRTALSHRKLSIILAVALLISSVALVSMVGSEFFPAEDEGSFTVDIEMPFGA
FT                   SLEDTDALVKKVEAIVDEIPEKDDVFSNIGSTGNQFSLSATNSSQVSVNLKDSDERDRA
FT                   TKEIVEEVRKKVELIPGAKIEVNESSSMSGGGGAQGSPISVVIKGDNLETLEDLGLAFR
FT                   DIIRNVPGTTEVKLDVEEGEPEARIIVDRNRASMYGVSVAEVANGLKASIEGVKATTLK
FT                   TGEDEIDVVISLDEGTRSSIENMKQIEIFTASGKKVTVGQIADIEFDNSPTQIARANQV
FT                   RTISVNSDISDRDLGSVVADIEKELEKYPLPDGYSYEFSGEQEQMAEAFSGLVLALLLS
FT                   LIIVYMILASQFESLLHPFTVMLSVPFALSGGFIGLFITGKALSLPAFIGIIMLAGIVV
FT                   NNAIVLIDYINQLRAKGMERNDAIIKAGKDRFRPIMMTTLTTVLGLLPMAIGLGEGSNT
FT                   IAPLAIVVVGGLSLSTVLTLSFIPVVYTVFDGGSRRFKNLKSKFGNRKNKKKLANEQA"
FT   gene            complement(538335..538550)
FT                   /locus_tag="CLOST_0458"
FT   CDS             complement(538335..538550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0458"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20588"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20588.1"
FT                   /translation="METTLNLVFEKASGKKHTMRIADAKLSQDPVKVKALMDYIVDNNL
FT                   IYVKDDALVAALEANLQNVTENPIEL"
FT   gene            complement(538565..538786)
FT                   /locus_tag="CLOST_0459"
FT   CDS             complement(538565..538786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0459"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20589"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20589.1"
FT                   /translation="MIEKISMPSSIRLKYLTGVDTDGKEMFKTRTINNITSSVTDELVY
FT                   GLKAMLEEVQNSPIAEFTRIETSKITQS"
FT   gene            538927..539802
FT                   /gene="galU"
FT                   /locus_tag="CLOST_0460"
FT   CDS             538927..539802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="CLOST_0460"
FT                   /product="glucose-1-phosphate uridylyltransferase"
FT                   /function="6.11 : Sugars"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="2.7.7.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14253441, 1537791, 7528731, 7961613, 9298646, 94222839;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20590"
FT                   /db_xref="GOA:E3PVM3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20590.1"
FT                   /translation="MQTVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTLQYIIEEA
FT                   VASGIKEILIITGRNKKSIEDHFDKSVELELELEHKGKLDLLEMVRNISNMINIHYIRQ
FT                   KEPNGLGHAIHCAKSFIGDEPFAVMLGDDVVDAEKPCLKQLIEAYEEYHTTILGVQQVA
FT                   NEDVNKYGIVDGRYIEDGIYKVKDLIEKPDIETAPSNIAILGRYIITPEIFDILENTKP
FT                   GKNGEIQLTDGLKTLCKNQAMYAYVFEGKRYDVGDKLGFLEATVDFALKNPELRDGFLE
FT                   YMKKTVSSNM"
FT   gene            539901..541826
FT                   /locus_tag="CLOST_0461"
FT   CDS             539901..541826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0461"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20591"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20591.1"
FT                   /translation="MTRGKKAASILLCSAMVFSSFATSFAASYTDMSKHWAESYVQNIK
FT                   EKQIISGYEDGSFKPDKSVSRLEAIIMISKMFSVNQINQIYASKKDAWEGKLVSYKIPD
FT                   WSWPYVVFAVENNIIPGTDDFLSKIMNQSEKNVQNAALRYEVMVYMVRALNWESELGKT
FT                   AVLKYKDIQTIPAQAIPYIDVMIKKGIIGESGDQNGNFGAQRPVTRAEMAVMLANAYKY
FT                   VSQLSPTINTDTAQVDSNNVTNVQMPSTIPSTGTQAVVNNSLSVMDGTVELVTSVGDYT
FT                   SFTISSASGVFHSFGNNNSMIQIKIGNSPASLSDLKIKDKVKVLYEEGNKARNIIIADK
FT                   EQKVTGVFSGTGMGTTIQLLSDGQVQSYVYDATTKITLDGINVDLSQIRANDQIEIFVL
FT                   SGKATEVKAYSSNKTVYGTVADIRSSSVVIEENNRENQYEVADNALITKNGSRVYNLNE
FT                   LGINDQITAVMQNGKITSIEAASVKSRIRKGVIKQILISSTKTQIIVADSDNKDYTLDV
FT                   NINTQVRIDGRRSSVNDLKLGYEVDVYLDGNIIEEISADGSYKQSMYVGKVVYHDDRDR
FT                   IIEMKDSDGNTIKVYYDSSTMIEDIKTGNTLRARQIYKGDEVTIVGIERLGGLDATRIM
FT                   VSMQYY"
FT   gene            541843..542490
FT                   /gene="fsaB"
FT                   /locus_tag="CLOST_0462"
FT   CDS             541843..542490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsaB"
FT                   /locus_tag="CLOST_0462"
FT                   /product="fructose-6-phosphate aldolase 2"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="4.1.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11120740, 21179155, 7773398; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20592"
FT                   /db_xref="GOA:E3PVM5"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20592.1"
FT                   /translation="MKIFLDTANVEEIREAASWGIVDGVTTNPSLVAREKRDFNEVVQE
FT                   ICSIVDGPISAEVISLEAEKMILEAREVAEIHPNVVVKIPMTVDGLKAVSVVSKEGIKT
FT                   NVTLVFSANQALLAAKAGATYVSPFLGRLDDIGTEGMNLVRDIVDIFDIHGYDTEVIAA
FT                   SIRNPMHVTDAALAGAHISTIPFGVLKQMTKHPLTDIGIEKFMQDWEGAFGK"
FT   gene            complement(542659..544098)
FT                   /gene="yueK"
FT                   /locus_tag="CLOST_0463"
FT   CDS             complement(542659..544098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yueK"
FT                   /locus_tag="CLOST_0463"
FT                   /product="YueK"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20593"
FT                   /db_xref="GOA:E3PVM6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20593.1"
FT                   /translation="MRNLTMLTDLYQLTMMNGYFKSNIHEDILVFDMFFRKNPSSGGYT
FT                   IIAGIEQVIDYIENLKFSEEDIDYLRSLNLFGEDFLSYLINFKFTGEIYAVREGTIMFP
FT                   NEPIVRVKAPAAQAQLIETAILNMVNFQSLIATKASRVCYSANGDPVMEFGLRRAQGPD
FT                   AGLYGARAAVIGGCVGTSNVLTGQEFELPILGTHAHSWVQKFPTELEAFRAYATTYPDK
FT                   TMLLIDTYNTLESGLPNAIKVFDELRANGHEPLGVRIDSGDLEYLSKEIRKILDDAGYP
FT                   NVKITASNDLDEYAISTLKSQGAKIDIWGVGTKLITSSDWPSLGGVYKLSAAMENGELV
FT                   PKIKLSEDPQKINNPGYKRVVRIYNKTTNKAEADLMMLADETIDESKPLKVFHPVYTWK
FT                   TKIFYNYYTKDLLEPLFIDGKLATNRYKVKEIKEYAQKEKDSFWPQYLRISSPERYKVD
FT                   LSEKLWELKNDLIEMRKRDQQ"
FT   gene            544384..546339
FT                   /gene="metS"
FT                   /locus_tag="CLOST_0464"
FT   CDS             544384..546339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="CLOST_0464"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11233169, 12682299, 12792655; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20594"
FT                   /db_xref="GOA:E3PVM7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20594.1"
FT                   /translation="MSNKTFYVTTPIYYPSGRLHIGHTYTTVAADAIARYKRFTGFDVR
FT                   FLTGTDEHGEKIQKTAAEKKMMPKDYLDGMIEDIKKLWETMEISYDDFIRTTDERHEKA
FT                   VQKIFQKLYDKGDIYLGEYEGWYCIPCESLWTDTQVGEEHLCPDCKREVQKKKESSYFF
FT                   KLSKYQQPLVDYYNSHPDFCFPESRKNEMLNNFINAGLDDLSVSRTTFDWGIKVPFDDK
FT                   HVIYVWIDALCNYITALGYLSEDESLMEKYWPANMQIVGKEIVRFHTIIWPALLMALDL
FT                   PLPDKVYGHGWILFSEDKMSKSKGNIVYPEPIIERYGIDALKYFLLKEFTFGQDGNYTN
FT                   RNFLTRINSDLVNDLGNLLSRTVSMIEKYNDSIVPEPKVFDSVHAELKKVASSMPAKVD
FT                   DAMNRMQFNEALEEIWKVVRRSNKYVDETMPWVLAKDETKKDELDTVLYNLAEALRLVT
FT                   VMISPLLHITAKKIFEQLSAGEEIRTYESALSFGGLKPGTKVAKGEILFPRLDIEKELE
FT                   VMESMFKPKTEEPVKEEVETKEIIHKDEITIDDFAKMELRVGKVLEASKHPKADRLLVF
FT                   KIQVGSEIRQIVSGIAKFYDPKDLIGRNVVIVANLKPVNLRGVESQGMILSAATDDDSK
FT                   LVVIQAEGIEDGVEVR"
FT   gene            546340..547110
FT                   /locus_tag="CLOST_0465"
FT   CDS             546340..547110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0465"
FT                   /product="deoxyribonuclease, tatd family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20595"
FT                   /db_xref="GOA:E3PVM8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20595.1"
FT                   /translation="MKLFDTHAHLDDERFDEDRELLIEKLKEENVSLVVNPGADMKTSR
FT                   AAIKLSEKYDFIYAAVGIHPHDVKDIKEEDLIELEQMAKHEKVVAIGEIGLDYYYDNSP
FT                   RELQREFFIKQIELANKVNLPIIIHSRDASIQTYEILKEYKKDIGCVLHCFSQSMEMAE
FT                   LYLKLGCHLSFAGPLTFKKSHKLKEVARNMPLDKIFIETDAPYLTPEPFRGRRNDPAKV
FT                   KYVAEELSNLRAISVDKIAEITMENAIKFFNISL"
FT   gene            complement(547284..547766)
FT                   /locus_tag="CLOST_0466"
FT   CDS             complement(547284..547766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0466"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20596"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20596.1"
FT                   /translation="MPSILAFFNDNKSAHNCMLDVKKNIKQSTRVYTVAQHEYKEATND
FT                   THFAQVQAQKSRISTKVGGFLGLLIGVAFAVAVEVDLFSSMSTFAGILFIVIASAAAGS
FT                   LIGLFVLSATDKLSKKNESFKEERGELILIVENPSDDKDKIVSIIEKYNPDKIKVY"
FT   gene            547931..548476
FT                   /locus_tag="CLOST_0467"
FT   CDS             547931..548476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0467"
FT                   /product="Ribonuclease M5"
FT                   /EC_number="3.1.26.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20597"
FT                   /db_xref="GOA:E3PVN0"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20597.1"
FT                   /translation="MIKEVIVVEGKDDISAVKKAVDAEVIATNGYGFPKGVVERIIKAH
FT                   KERGIIVLTDPDYAGERIRDKITKLVGNCKHAFISKEAGLKNDDVGVENASPESIIQAL
FT                   EKARYEEVDKRNEFTQADMLRYDLVGMENASFRRDVLGKKLGIGYCNAKQFLNRLNNYG
FT                   IEREEFEAALKELEIDNE"
FT   gene            548469..549338
FT                   /gene="ksgA"
FT                   /locus_tag="CLOST_0468"
FT   CDS             548469..549338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="CLOST_0468"
FT                   /product="Dimethyladenosine transferase
FT                   (S-adenosylmethionine-6-N', N'-adenosyl(rRNA)
FT                   dimethyltransferase) (16S rRNA dimethylase) (High level
FT                   kasugamycin resistance protein ksgA) (Kasugamycin
FT                   dimethyltransferase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20598"
FT                   /db_xref="GOA:E3PVN1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20598.1"
FT                   /translation="MNNLASHKITKDIVSKYGFRFTKSLGQNFLVDEHVLSQIVDSAEI
FT                   DSEDTVIEIGPGIGTLTRELSYRAKQVISIEIDKNLIPILSETLADRDNIKIINQDILK
FT                   TDLHELVNEFSPDRKVKVVANLPYYITTPIIMRFLEEKVPLKTMVIMIQKEVANRINAV
FT                   PSTKDYGSLSVAVQYYCDTDIVAKAPKGAFIPEPGVDSAVIKLEVKEDKGIELIDEDLF
FT                   FEVVKAAFSKRRKTLLNALSTFGNIGGKQEAKMALEIANIDAQLRGETLDMKQFASLAN
FT                   AYAKVLNK"
FT   gene            complement(549476..550837)
FT                   /gene="murC"
FT                   /locus_tag="CLOST_0469"
FT   CDS             complement(549476..550837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="CLOST_0469"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase
FT                   (UDP-N-acetylmuramoyl-L-alanine synthetase)"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20599"
FT                   /db_xref="GOA:E3PVN2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20599.1"
FT                   /translation="MKIHFIGIGGISMSGLAHVCINLGYEVSGSDKSMSPILQKLINEG
FT                   ATIYIGHDESQLNEDIDLVVYTAAVKEDNPELAKARRLKLNIIDRAQFLGDIMKKYENS
FT                   IAISGTHGKTTTTSMTTVVFNANDEDPTVLVGGNLSVIDGNVRIGNSEVFITEACEYVD
FT                   SFLKFYPKIAIILNVEEDHLDYFSGLEQIEASFAKFASQVKPDGFVIANGDDENILKAL
FT                   KDVDKTKIYFGRNKNCQAIIHDEVYNSSGYATFSLSMDDKFIGRFTLKVPGKHNVLNAT
FT                   AAILSAYVSKLPLDAIKTGIESYTGVGRRFEYKGEVNGIKVYDDYAHHPTEVAATLSAA
FT                   KMIKHHLLYTIFQPHTYTRTKELLDRFAVSFNDSDVVIISDIYASRENDPGNIHSKDLV
FT                   EAIKKSGKDALYIGSLDEVQNYLGSVLEPEDIVFTIGAGDVYTLGESLLHKTNS"
FT   gene            551088..551921
FT                   /gene="purR"
FT                   /locus_tag="CLOST_0470"
FT   CDS             551088..551921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="CLOST_0470"
FT                   /product="transcriptional regulator of the purine
FT                   biosynthesis operon"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11591660, 12837783, 12837784, 15629952, 16163456; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20600"
FT                   /db_xref="GOA:E3PVN3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20600.1"
FT                   /translation="MKLKRNERIGAIVKILTEHPNKTFTLSYFTEKFNTAKSTLSEDVM
FT                   LVKSVFERMKLGRVITIPGASGGVRYIPDVSKDEVYNFLQTISKKIQSEDRVLPGGFLY
FT                   LIDIIYDPDIVASIGNIFASVIDYTNVDYLVTIETKGIPMALMTAKAMNIPLLIIRKNS
FT                   KISEGSSLGITYVSGTSGTVQTMSLPRRNIKEGSRVILIDDFMRGGGTLKGMHDLMKEF
FT                   KVEVAATGVLISTTKPEEKMIDNYFSLLELDEQSVKNKVWPNEKIINKISENLNL"
FT   gene            551997..552296
FT                   /gene="spoVG"
FT                   /locus_tag="CLOST_0471"
FT   CDS             551997..552296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="CLOST_0471"
FT                   /product="putative septation protein spoVG (Stage V
FT                   sporulation protein G)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20601"
FT                   /db_xref="GOA:E3PVN4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20601.1"
FT                   /translation="MEITDVRVGKLSEEGKMRGIVSVTFDNAFVVHDIKIIEGQSGLFI
FT                   AMPSRKVGEGEFRDIAHPINSEMRKSLQDDILRAYEEAKVRMEVEEDEDYVEQE"
FT   gene            552455..553810
FT                   /gene="glmU"
FT                   /locus_tag="CLOST_0472"
FT   CDS             552455..553810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="CLOST_0472"
FT                   /product="fused N-acetyl glucosamine-1-phosphate
FT                   uridyltransferase ; glucosamine-1-phosphate acetyl
FT                   transferase"
FT                   /function="5.1 : Amino sugars"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="6.11 : Sugars"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.7.7.23"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11084021, 6395859, 8083170, 8407787, 8555230, 94012475,
FT                   9733680; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20602"
FT                   /db_xref="GOA:E3PVN5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20602.1"
FT                   /translation="MNLKIVILAAGQGTRMKSKIPKVLHKVLDKPMLDHVMEAAQVVTN
FT                   NKPIVVIGHMSDMVREHLGDKAEIALQEEQLGTGHAVMMAEHYIDDEDEVLILCGDTPL
FT                   IKGETLKEMTKIKSEGYAAVVMSAVEDDPTGYGRIIRDGSNDFMRIREQKDASEEEKAI
FT                   KEINAGMYIIDGKLLKENLSKLSVNNAQREYYLTDVLEHIKNAGHRIGVYQADKMEIMG
FT                   VNSRLQLSEAERIMRLDVNKMHMANGVTLIDTNSTYIDKNVKIGRDTIIYPNCHIKGNS
FT                   VIGEDCIIRENTTIEDSHIEDHVTIKSSTILSSKVGARTTIGPYAYLRPKTVLGEDVKI
FT                   GDFVEVKNAEIGNGSKASHLSYIGDAIVGKNVNIGCGVVFVNYDGKNKFKSIVEDNAFI
FT                   GSNSNLVAPVTVKEGGYIATGSTVTVDVPEGALCVARAREVIKEGWRTKKGL"
FT   gene            553839..554795
FT                   /gene="prsA"
FT                   /locus_tag="CLOST_0473"
FT   CDS             553839..554795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="CLOST_0473"
FT                   /product="phosphoribosylpyrophosphate synthase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="2.7.6.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3009477, 88139171, 89255522, 9298646; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20603"
FT                   /db_xref="GOA:E3PVN6"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20603.1"
FT                   /translation="MNTSGSEIKIFTGNAHKELAADIAKELGVPLGDAEVGRFSDGEIS
FT                   VNINETVRGVDAFIIQPTCSPVNGNIMELLIMIDAFKRASAGRITAVIPYYGYARQDRK
FT                   AKARDPITAKLVANLITAAGADRVLTMDLHAAQIQGYFDIPLDHLHGGPILAEHFKKKN
FT                   IQDLVVVSPDLGSVGRARTFAEQLDAPLAIIDKRRPKANVSEVMNIIGDVKDKNVILID
FT                   DMIDTAGTLVNGAEALKKFGAKEVYSCCTHPVLSGPAIDRIEKSVLKEVVVLDTLPLSS
FT                   EKRIEKIKVESVAPIFASAIRKIFANESVSKLFTVEK"
FT   gene            554949..555509
FT                   /gene="pth"
FT                   /locus_tag="CLOST_0474"
FT   CDS             554949..555509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="CLOST_0474"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number="3.1.1.29"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 91073389, 9144799, 92007806, 92215859, 9303320; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20604"
FT                   /db_xref="GOA:E3PVN7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20604.1"
FT                   /translation="MYLIVGLGNPGSKYEKTRHNVGFVTVDVLAGQLGIKVNKLKFKSL
FT                   IGEGNIGSEKVVLIKPQTYMNLSGEAVMQAINFYKPDHDKIFVIYDDIDLDVGRLRIRK
FT                   KGSGGTHNGMRNIIYLTGFDDFPRFRIGVSKPKNGQDLASFVTSGFNKDEIKPLCEAID
FT                   NAADAIVLAIKEDIDKAMNKYNV"
FT   gene            555554..558946
FT                   /gene="mfd"
FT                   /locus_tag="CLOST_0475"
FT   CDS             555554..558946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="CLOST_0475"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20605"
FT                   /db_xref="GOA:E3PVN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20605.1"
FT                   /translation="MQEDIFLLNLQNKTEFSSVLGNISQNKSPLLINGLLSSQRAHIAH
FT                   YLSANLEKKLVLVTSNEIEAERIYTDLEFYNPDRVLFIKNEETRFYAIEAKDRKEESKR
FT                   IESLIRLAQEDYDILVLSVETLMRKYLPKRLYVESKPDLEIGSIWNLAELVDLLVHYGY
FT                   EREARVEGPGQISLRGGILDIYLPTAELPYRLEFFDDEIDSIRTFDPISQKSIEKIKQI
FT                   TISPAREFLFREGFEEAAKRLSDDLSKSSNDDLAFDIERISEGHYFEGMHKYIDYIYPD
FT                   ERKDLFSYINKEAIFVIHEPNRVLEKGENYFEEFSEDYKHALEKGFALKGQGELLYNLD
FT                   YVTEYMGSHFIVLQSFLPKSVKGFNTASIVNFETREPVSFQGKIPALLEEIKYQKKQGY
FT                   TIVLVERDEDTIMSLYKELSNASLEPIYLRDRKAEIPEGKVVLVKGRLTEGYVYSKSKL
FT                   AVISDKEMFGVTKKSSKQKIKHKGKKIESFIDLKAGDHVVHETYGVGKFVGIESKKFDD
FT                   IRKDYIKIVYSAGDALYVPLSQMDKVQKYIGTGAGDAVKLNKLGTSEWKKTKAKAKKAV
FT                   DEIAQDLIDLYAERRDARGYAFTEDTPWQKEFESLFPYEETVDQINAIEDVKKDMQNIK
FT                   PMDRLICGDVGYGKTEVAIRAIFKSCMDSKQVAFLVPTTILAQQHYNNLKERFAGYPIR
FT                   VEVVSRFKTKKAQEQIIDDARRGLVDVLIGTHRILSNDVSFKDLGLLVVDEEQRFGVKH
FT                   KELLKKLKKDVDVLTLSATPIPRTLHFSLSGIRDMSLLEEPPEDRHPIMTYVTEAREGI
FT                   ILDALERELARGGQVFFVYNRVQTIDKMADIIRRLVPDANLAVAHGQMSPRQLENIMVD
FT                   FLEKEYDILLSTTIIETGMDISNANTMIVYDADKMGLSQLYQLRGRVGRSSRQAYAYFM
FT                   YQKDKVLTEVSEKRLKAIKEFTEFGSGFKIAMRDLEIRGAGNILGERQHGHMTEIGYDL
FT                   YVKMLDAAIRNLQGQVVEQKVDTEIELDINAYIPENYIDDEMSKIEIYKKIASIESKQD
FT                   LYEIEEEVEDRFSNIPEPVRNLMHIAYIKALGEKLGILKIKQNETVISFVGPTPESSVK
FT                   KDFKEKESYKLITNISSFLEMML"
FT   gene            558980..560044
FT                   /gene="prsA"
FT                   /locus_tag="CLOST_0476"
FT   CDS             558980..560044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="CLOST_0476"
FT                   /product="putative foldase lipoprotein (Late stage protein
FT                   export lipoprotein) precursor"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20606"
FT                   /db_xref="GOA:E3PVN9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20606.1"
FT                   /translation="MKKLLSLIMSSLMIFSLAACSNTASANEWAAKVNDVEISYSDYEK
FT                   NLAIIKKQIEATVGADIWTQDSGQGKTYNEILKDQVLEKLIEDQLILAEAKKENITVDA
FT                   DEFEKEFTQFKEQVKSLPDYETFLKEEGITDEFLKKQLETDTIVFEYKEKFMEKNTPSE
FT                   EDLKKYYDDNQENYNVNEVKASHILLKTVDENFVPLPEDKIAEIKKEAEAVLAKVNSGE
FT                   DFAVLAKEYSQDEASAVNGGDLGFFAKGVMVKEFEDVAFSLEPNQVSDLVETTYGYHII
FT                   KVFEKKNEVTPFEDVKENIKNELAQKSYLDFVASLKESAKIEKNDAALKKADEESKSES
FT                   QNEEQPAEEESTEN"
FT   gene            560087..560563
FT                   /gene="moaC"
FT                   /locus_tag="CLOST_0477"
FT   CDS             560087..560563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="CLOST_0477"
FT                   /product="molybdopterin biosynthesis, protein C"
FT                   /function="4.6 : Molybdopterin"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10903949, 93368423; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20607"
FT                   /db_xref="GOA:E3PVP0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023046"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20607.1"
FT                   /translation="MELTHIDEKGHVKMVDVGEKAISAREAKAQAIVKMNPETLMLICE
FT                   GKMPKGDVFSCARIAGIMASKKTHELIPMCHNLPIDSVELDITPMGNDRVYITAVARCH
FT                   YKTGIEMEALTAATVAALTIYDMCKAVDKKMEISEIFLLEKTGGKSGHFLRNND"
FT   gene            560618..562204
FT                   /locus_tag="CLOST_0478"
FT   CDS             560618..562204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0478"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20608"
FT                   /db_xref="GOA:E3PVP1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20608.1"
FT                   /translation="MSKNSFLKGAVVLGVAGLIVKILGAFFRIPLGRLITSEGMGYYQT
FT                   AYPIYVLLLSISTSGFPIAISKMVSERRAVGNYKGAHRVFTITLKILLVLGLLTFSIFF
FT                   FGARIIVNALNNPNAYYSMVALAPALLFVPIMAAYRGYFQGRNNMTPTAVSQIIEQSAR
FT                   VGFGLILAYFLMPKGLDYAAAGGSFGATAGAIFGMAFILFVYYINKPKIEKELLKSEEF
FT                   EEESYKVIIKSMLTIALPIIIGASVMPIMNMIDVSIVINRLMASGYTQSEANALYGQLT
FT                   GMAATLINLPQVLTMSIAMSIVPVVSQAYALRDMESVKENANLSVRMAVLLGLPSGVGL
FT                   MVLATPIMQLLYPNEPASIGQILFFMSLGVVFLSLIQTLTGILQGLGKSQIPVMNLFIA
FT                   AIFKLVCTYTLTSIPSLNVKGAAIGTVLAYMIAAGLDIYWVRKLLNIKFDINHLLIKPL
FT                   LTAAIMGVVAKLTHMGLTDKLGNSLSTVIAIVLAIIVYVVVLILIGGITKEEIEKLPKG
FT                   KKLSKFIPSKK"
FT   gene            562578..562754
FT                   /locus_tag="CLOST_0479"
FT   CDS             562578..562754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0479"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20609"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20609.1"
FT                   /translation="MNALVKVKPVIGNNSQDCGLKKTFKKVLTVKSHRDILIHVLSERA
FT                   KQTASKEEIRINR"
FT   gene            563102..564274
FT                   /locus_tag="CLOST_16S_4"
FT   rRNA            563102..564274
FT                   /locus_tag="CLOST_16S_4"
FT                   /product="ribosomal RNA 16S"
FT   gene            564563..566970
FT                   /locus_tag="CLOST_23S_4"
FT   rRNA            564563..566970
FT                   /locus_tag="CLOST_23S_4"
FT                   /product="ribosomal RNA 23S"
FT   gene            567654..567750
FT                   /locus_tag="CLOST_5S_4"
FT   rRNA            567654..567750
FT                   /locus_tag="CLOST_5S_4"
FT                   /product="ribosomal RNA 5S"
FT   gene            567759..567833
FT                   /locus_tag="CLOST_tRNA3"
FT   tRNA            567759..567833
FT                   /locus_tag="CLOST_tRNA3"
FT                   /product="tRNA-Asn"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            567840..567915
FT                   /locus_tag="CLOST_tRNA4"
FT   tRNA            567840..567915
FT                   /locus_tag="CLOST_tRNA4"
FT                   /product="tRNA-Val"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            567940..568036
FT                   /locus_tag="CLOST_5S_5"
FT   rRNA            567940..568036
FT                   /locus_tag="CLOST_5S_5"
FT                   /product="ribosomal RNA 5S"
FT   gene            568063..568139
FT                   /locus_tag="CLOST_tRNA5"
FT   tRNA            568063..568139
FT                   /locus_tag="CLOST_tRNA5"
FT                   /product="tRNA-Asp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568180..568254
FT                   /locus_tag="CLOST_tRNA6"
FT   tRNA            568180..568254
FT                   /locus_tag="CLOST_tRNA6"
FT                   /product="tRNA-Thr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568290..568374
FT                   /locus_tag="CLOST_tRNA7"
FT   tRNA            568290..568374
FT                   /locus_tag="CLOST_tRNA7"
FT                   /product="tRNA-Tyr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568379..568452
FT                   /locus_tag="CLOST_tRNA8"
FT   tRNA            568379..568452
FT                   /locus_tag="CLOST_tRNA8"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568463..568539
FT                   /locus_tag="CLOST_tRNA9"
FT   tRNA            568463..568539
FT                   /locus_tag="CLOST_tRNA9"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568553..568628
FT                   /locus_tag="CLOST_tRNA10"
FT   tRNA            568553..568628
FT                   /locus_tag="CLOST_tRNA10"
FT                   /product="tRNA-Gln"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568635..568710
FT                   /locus_tag="CLOST_tRNA11"
FT   tRNA            568635..568710
FT                   /locus_tag="CLOST_tRNA11"
FT                   /product="tRNA-Lys"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568743..568831
FT                   /locus_tag="CLOST_tRNA12"
FT   tRNA            568743..568831
FT                   /locus_tag="CLOST_tRNA12"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568852..568943
FT                   /locus_tag="CLOST_tRNA13"
FT   tRNA            568852..568943
FT                   /locus_tag="CLOST_tRNA13"
FT                   /product="tRNA-Ser"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            568952..569028
FT                   /locus_tag="CLOST_tRNA14"
FT   tRNA            568952..569028
FT                   /locus_tag="CLOST_tRNA14"
FT                   /product="tRNA-Pro"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569057..569133
FT                   /locus_tag="CLOST_tRNA15"
FT   tRNA            569057..569133
FT                   /locus_tag="CLOST_tRNA15"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569168..569242
FT                   /locus_tag="CLOST_tRNA16"
FT   tRNA            569168..569242
FT                   /locus_tag="CLOST_tRNA16"
FT                   /product="tRNA-Trp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569266..569342
FT                   /locus_tag="CLOST_tRNA17"
FT   tRNA            569266..569342
FT                   /locus_tag="CLOST_tRNA17"
FT                   /product="tRNA-Pro"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569372..569448
FT                   /locus_tag="CLOST_tRNA18"
FT   tRNA            569372..569448
FT                   /locus_tag="CLOST_tRNA18"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569475..569551
FT                   /locus_tag="CLOST_tRNA19"
FT   tRNA            569475..569551
FT                   /locus_tag="CLOST_tRNA19"
FT                   /product="tRNA-Met"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569557..569632
FT                   /locus_tag="CLOST_tRNA20"
FT   tRNA            569557..569632
FT                   /locus_tag="CLOST_tRNA20"
FT                   /product="tRNA-Phe"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            569645..569721
FT                   /locus_tag="CLOST_tRNA21"
FT   tRNA            569645..569721
FT                   /locus_tag="CLOST_tRNA21"
FT                   /product="tRNA-Met"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            570205..571377
FT                   /locus_tag="CLOST_16S_5"
FT   rRNA            570205..571377
FT                   /locus_tag="CLOST_16S_5"
FT                   /product="ribosomal RNA 16S"
FT   gene            571551..571626
FT                   /locus_tag="CLOST_tRNA22"
FT   tRNA            571551..571626
FT                   /locus_tag="CLOST_tRNA22"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            571749..574156
FT                   /locus_tag="CLOST_23S_5"
FT   rRNA            571749..574156
FT                   /locus_tag="CLOST_23S_5"
FT                   /product="ribosomal RNA 23S"
FT   gene            574724..574798
FT                   /locus_tag="CLOST_tRNA23"
FT   tRNA            574724..574798
FT                   /locus_tag="CLOST_tRNA23"
FT                   /product="tRNA-Glu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            574804..574879
FT                   /locus_tag="CLOST_tRNA24"
FT   tRNA            574804..574879
FT                   /locus_tag="CLOST_tRNA24"
FT                   /product="tRNA-Val"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            574892..574968
FT                   /locus_tag="CLOST_tRNA25"
FT   tRNA            574892..574968
FT                   /locus_tag="CLOST_tRNA25"
FT                   /product="tRNA-Asp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            574978..575062
FT                   /locus_tag="CLOST_tRNA26"
FT   tRNA            574978..575062
FT                   /locus_tag="CLOST_tRNA26"
FT                   /product="tRNA-Tyr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            575127..575201
FT                   /locus_tag="CLOST_tRNA27"
FT   tRNA            575127..575201
FT                   /locus_tag="CLOST_tRNA27"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            575226..575299
FT                   /locus_tag="CLOST_tRNA28"
FT   tRNA            575226..575299
FT                   /locus_tag="CLOST_tRNA28"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            575339..575415
FT                   /locus_tag="CLOST_tRNA29"
FT   tRNA            575339..575415
FT                   /locus_tag="CLOST_tRNA29"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            575567..576382
FT                   /locus_tag="CLOST_0484"
FT   CDS             575567..576382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0484"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20610"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20610.1"
FT                   /translation="MWELKDIVFNIGIFDVIDIAIVAYVFYKLYQLIKETRAEQLVRGI
FT                   VILLLATKASEIMQLHVVNWILKNTMTVGMIALLIVFQPELRRVLEYLGRTKFIIKPAI
FT                   EDTEKVDVVVEEVVQSMTSLARQKIGALLVFERETGINDIIQTGTMMDAKVTRQLLINI
FT                   FIPNTPLHDGAAVIRGGKIMAAGCFLPLTENKFLNKELGTRHRAGLGISERSDCIALIV
FT                   SEETGFISLAQNGKLYRDLSEESLRTFLLKGLRKEEESKGFFKKGGIFK"
FT   gene            576379..577581
FT                   /locus_tag="CLOST_0485"
FT   CDS             576379..577581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0485"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20611"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20611.1"
FT                   /translation="MKTLLNQNLKMKIFAVIFAFFMWIYVMAEVDPIIIRDIDSVPINI
FT                   TNMQELELLELTPEYGTDLNVRVSLRGRRSILNAQITKGIKTEGLINNPKEGQNILVVD
FT                   LKDVDSNVEYTLYPSDKQINLEKKMVIRKSVSVVQTGTLPEGYEIKEIKSNPASMYIEG
FT                   PKSLVDSITTLMTTLDVSNYDKDFSKKLQVIPVDRDNQEVKGVSINQDTVFVHAIVVKA
FT                   KTVPIVLDIPSSENDELKLSGYTIDPPEVVIKGKANVIDSIKEIKTEKVELLQLVENPN
FT                   LKVKLVMPTGVETQTPEITLKSSMEKVISKEFNISKERIQISGNGQLPDISDNPDISDF
FT                   IAVKITTTDKIMDTISENDIRVYIKMQEYENNPARVPIHVEVDEEVESIETTPLYLNLE
FT                   G"
FT   gene            577720..578799
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0486"
FT   CDS             577720..578799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0486"
FT                   /product="branched-chain fatty-acid kinase"
FT                   /function="16.8 : Protect"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="2.7.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094682, 12427936, 15241682; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20612"
FT                   /db_xref="GOA:E3PVP5"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20612.1"
FT                   /translation="MKLILVINPGSTSTKVALFKRTENVIQNNLTHSAEEIAKFERVSD
FT                   QLEMRQALIEDWMKEEGYQLSDLEAVVGRGGLLRSMPGGTYEVTSKMKEDLIAAHRGEH
FT                   ASNLGGLIADKIAEKAGVKSYIVDPVAVDEFEDIARISGIPQIERISLGHALNVKAVGR
FT                   RAAKELGKGLDEVNLIVAHIGGGISICPLRKGKAIDYNNANEMGPFSPERTGGLPCGDL
FT                   VKLCFSGKYTLAEMKKKISGKGGLVAYLGTNDAREVQKLIDAGDEKAKLIFSAMAYQIA
FT                   KEIGQMATVLKGEVDAIVMTGGVSYSENLTNQVKEMVSFIAPYMVIPGEDEMLALAEGT
FT                   VRVLNSEEKAKIYENEVKF"
FT   gene            578800..579705
FT                   /gene="yqiS"
FT                   /locus_tag="CLOST_0487"
FT   CDS             578800..579705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiS"
FT                   /locus_tag="CLOST_0487"
FT                   /product="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20613"
FT                   /db_xref="GOA:E3PVP6"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR014079"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20613.1"
FT                   /translation="MKNFNEIIAFAKERGPKTISVACAQDKEVLLAVEAARKEGIAKAI
FT                   LVGDEVKIAEIAETLNIALSDYEVVNEPDLTNACLKAVELVSNGVADIVMKGLVDTSII
FT                   LKAVLNKEIGLRTGLPLSHVAVFKIDGYERLFFVTDAAMTLSPDLMTKKQILENAVSLA
FT                   HALDIEEPKVAVLCAKEKTDEKMPCTIDAFKLEEMQKNGEIKGCLVGGPFALDNAVSEE
FT                   AAKHKGMTHPIGGKADILLVPNIESGNILYKSLVFFAKGENAGLIVGAKAPIVLTSRAD
FT                   SDITKLNSIALAVLAASKQN"
FT   gene            579729..580817
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0488"
FT   CDS             579729..580817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="buk"
FT                   /locus_tag="CLOST_0488"
FT                   /product="putative butyrate kinase (BK) (Branched-chain
FT                   carboxylic acid kinase)"
FT                   /EC_number="2.7.2.7"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20614"
FT                   /db_xref="GOA:E3PVP7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR011245"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20614.1"
FT                   /translation="MEGTMSTYKILAINPGSTSTKIAVYENETQIMEKTLRHSTEEINK
FT                   YEKIFDQFEFRKNVIVDAVSEAGIAIEELDAVVGRGGLLKPIKGGTYEVSDELIAGLKE
FT                   PYLGEHASNLGGIIAKEIADAALAPSFIVDPVVVDEMNDVARISGMPEIPRFSIFHALN
FT                   QKATARRFASEIGKSYEDINVIVAHMGGGVSVGAHEKGRVIDVNNALDGEGPFSPERAG
FT                   GLPVGDLAKLCFSGKYTHAQIKKLLKGEGGIVAYLGTNDARDVEKMIAEGDEKAKLIYE
FT                   AMAYQVAKEIGSCATVLKGKVDAIILTGGIAYSEMITTWIKERVSFIADVKIYAGEDEM
FT                   SALAQGALRVLREEEKPQRYEA"
FT   gene            580820..581497
FT                   /locus_tag="CLOST_0489"
FT   CDS             580820..581497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0489"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20615.1"
FT                   /translation="MFINDKRIRIIIGHYGSGKTEFSVNYAMKLKQATASKVAIADLDI
FT                   VNVYFRSREKQVMLEEQGIKVIASSIAGNALDLPAVAADIITPLEDKTYEYVIDVGGDS
FT                   VGARVLGRFKNYIEDGDYDMFMVVNANREQTMDLEGIKRHKETIEATSRLKVTGFINNT
FT                   HLIRETTLEDVLKGDKLLKEASKELGIPIRYVSAMSHIASQIPDEVSGEILALDLIMRD
FT                   QWM"
FT   gene            581559..581777
FT                   /locus_tag="CLOST_0490"
FT   CDS             581559..581777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0490"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20616"
FT                   /db_xref="GOA:E3PVP9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20616.1"
FT                   /translation="MAKGKVYFDQDRCKGCELCTTACPVKIVVMDKTQINIKGYHPATV
FT                   LEMDKCIGCANCATMCPDYVITVEREQ"
FT   gene            581795..582850
FT                   /gene="vorB"
FT                   /locus_tag="CLOST_0491"
FT   CDS             581795..582850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vorB"
FT                   /locus_tag="CLOST_0491"
FT                   /product="Ketoisovalerate oxidoreductase subunit vorB (VOR)
FT                   (2-oxoisovalerate oxidoreductase beta chain)
FT                   (2-oxoisovalerate ferredoxin reductase subunit beta)"
FT                   /EC_number="1.2.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20617"
FT                   /db_xref="GOA:E3PVQ0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3PVQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20617.1"
FT                   /translation="MAKVLMKGNEAVAKAAIEAGCKYFFGYPITPQNEIPEYMAREMPK
FT                   VGGVFLQAESEVAAINMVYGAAGAGARVMTSSSSPGIALKQEGISYIAGAELPAVIVNM
FT                   MRGGPGLGGIQPSQADYFMSTRGGGNGDYRHIVYAPATIQEAVDMTMEAFEVADYYRMP
FT                   VMVVGDGMIGQMMEPVEFNPPAKRELQEKTWASVGTKGLRKPNVINSLYLEAQELEDHN
FT                   IRLEKKYEEIIEKEARWENYKIEDADIILVAYGTTARIAKNAAEDLRKEGIKAGVIRPM
FT                   TLWPFPNKAFENLNCKALLTVEMSMGQMIEDVKTAVEFKLPVHFVGRVGGMIPEPVMIV
FT                   DKAREIMGGVR"
FT   gene            582850..583599
FT                   /locus_tag="CLOST_0492"
FT   CDS             582850..583599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0492"
FT                   /product="putative subunit of oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20618"
FT                   /db_xref="GOA:E3PW03"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20618.1"
FT                   /translation="MAVVFKKTQGLTDVQTHYCPGCTHGIIHRLVGEVLEELGVLGDSI
FT                   GVAPVGCSVLAYKYFNCDMQEAAHGRAPACATGIKRVHPDKVVFTYQGDGDLASIGMAE
FT                   IVHAAARGEKITTIFVNNAIYGMTGGQMAPTTLVGQKATTSPYGRDAALVGFPIRVSEM
FT                   LSTLDGAVYVERVTVNTAANVRKAKAAIKKAFQAQINGEGFTMVEVLSTCPTNWGLHPV
FT                   EALKWLEDNMIPYYPLGNFKNVDGEAK"
FT   gene            583601..584155
FT                   /locus_tag="CLOST_0493"
FT   CDS             583601..584155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0493"
FT                   /product="putative subunit of oxidoreductase"
FT                   /EC_number="1.2.7.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20619"
FT                   /db_xref="GOA:E3PW04"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20619.1"
FT                   /translation="MQTQKIICAGFGGQGVMSMGQLITYAGMLESKEVSWLPSYGPEMR
FT                   GGTANCSVIVSETPIGSPVITNDATSAIIMNLPSLTKFEKDVAPGGSIFINRSLIEKKV
FT                   ERTDVDVYYIDANEIALELGNPRVANMVMLGALIEINKTVSIDSVLEAFKKVFGPSKEK
FT                   FVPLNKEAIEKGMQAVRESVK"
FT   gene            584278..585141
FT                   /locus_tag="CLOST_0494"
FT   CDS             584278..585141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0494"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20620"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20620.1"
FT                   /translation="MPETTNKKMKPFIRILTLALGSLICAVGINGYLRPLGLLSGGATG
FT                   IAIIMNHLTSFNIGLIVFAINIPLFVLAAFKLKREFVIYSMINMTMFSTLLGVTGEVYK
FT                   YIGVDDIMLSAIVGGVLNGIGMGITFRGRGSQGGMDIIAALIRKKWDISLGNALMGANL
FT                   VIIGWGGTIFGIKSFLYTIIVLFISYNFLDKVQTTFETKKSVMIISEHPKEIGDALMAN
FT                   MNRAITYLNGEGGYSHLEKQIIYTIINPREVSKLKKIVNDHDPKAFISVFETNEVRGYR
FT                   FKERFI"
FT   gene            585197..585316
FT                   /locus_tag="CLOST_0495"
FT   CDS             585197..585316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0495"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20621"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20621.1"
FT                   /translation="MYKNMVSYKNWTLFVNKSWILAYMSNLGLAKQLVFLMQL"
FT   gene            complement(585321..587471)
FT                   /locus_tag="CLOST_0496"
FT   CDS             complement(585321..587471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0496"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20622"
FT                   /db_xref="GOA:E3PW07"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20622.1"
FT                   /translation="MGVVDIRRIFIRLFTLIFIFINILFSYSSYALSSSIPFTSEELNF
FT                   LKAHENETFLLGLDPYSGMDYFEFRGQKAGFLLDVIKLIERETKINIEIASEKSWGEAV
FT                   SGLSTRDIDILFGANPTLLRRQYMEFTRPMIQYPYAVFAKKGSAVQTIGDLDNKKVAFI
FT                   DGDINLQPFLDIYNNIHPKIRIFPDQKAALEALSAGAVDGFVVSGGVIIHDFIYNYSDL
FT                   NYIAEVNTLTSDMTFSTLKENAILAGILDKIIEKYLDTEINEAIENSEVLFNRKILRLT
FT                   ESELNWLDKNETVTVGVADDYLPFDYYSNGEYQGVAGSVFNELSHLIRLNVNVVHGSFS
FT                   DIYSKALNREIDVVNMAKTPDRINHFYFPQPFSYERDEIYGKRESMHVQDVYGLEGKKV
FT                   AVIDGFWHEEYLLKNLREVEIIKTKSVEESISKVDKGEADYLIENPTVADFYIQGLGYT
FT                   SIIKKGSTSSDSFLYFGISKNKPELYSIIDKTISLISYEELKHRGLSNVPVPEPIKYKR
FT                   LTLVIAMLTATMFIIALFTFRILKSLANEKAKTLLLSERTKLLYTDSLTGLKNRTCFKD
FT                   METEFNCMGFPQLIIMADMNNLKKTNDLYGHHMGDLLIKKCSKILEQVFDNALIFRMGG
FT                   DEFLILYAGNIDTQIEDKIDLVNEIASNTSISDGTSTIKGLSIAMGASSRQSIDDDFNE
FT                   KMIEADNNMYIHKKFIKSIAKS"
FT   gene            587631..588989
FT                   /gene="glmM"
FT                   /locus_tag="CLOST_0497"
FT   CDS             587631..588989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="CLOST_0497"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="5.1 : Amino sugars"
FT                   /function="6.11 : Sugars"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="5.4.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10231382, 10671448, 8244950; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20623"
FT                   /db_xref="GOA:E3PW08"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20623.1"
FT                   /translation="MRKYFGTDGVRGIANKELTAELAYNLGRAGAFVLQKHSEHGSDRV
FT                   KVVIGSDTRISKDILSMALSAGFMSMGADVIDAKVLPTPAVAYLTKHYKADIGAVISAS
FT                   HNPMEYNGIKFFNSKGFKLADEIELEIEKYLDDMSLLNEYPTHENIGKRMKVTNPEEAY
FT                   IEFLKSCVSTDFKGMKVVIDTANGAAYKIAPEVFAQLGAEVVCIGCQPTGTNINANCGS
FT                   THTKNLEAMVVEHKADLGLAYDGDADRLIAIDEMGQIIDGDKIMLICANDMKAKNQLKK
FT                   DTLVVTVMSNMGLHVAAKALGIKLAVTGVGDRYVLEEMVKEGYSLGGEQSGHMIFLDHI
FT                   TTGDGTLSSLLFAEIVKNSGKKASELSKIMEIYPQVLINAKVSNGNKHTYMENQEVADK
FT                   IKLLEEKMDGQGRVLIRPSGTEPLVRVMLEGKDQNQIEVMARELADFIEIKLG"
FT   gene            589201..589355
FT                   /locus_tag="CLOST_misc_RNA_5"
FT   misc_RNA        589201..589355
FT                   /locus_tag="CLOST_misc_RNA_5"
FT                   /product="glmS"
FT                   /inference="profile:Rfam:8.1"
FT   gene            589413..591239
FT                   /gene="glmS"
FT                   /locus_tag="CLOST_0498"
FT   CDS             589413..591239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="CLOST_0498"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /function="5.1 : Amino sugars"
FT                   /function="6.11 : Sugars"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10091662, 11916143, 13827775, 2826397, 3010949, 3134953,
FT                   6283361, 6395859, 8805567, 91182805, 92117657, 92232690,
FT                   9739095; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20624"
FT                   /db_xref="GOA:E3PW09"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20624.1"
FT                   /translation="MCGIVGYVGKKNAQDVILQGLEKLEYRGYDSAGIAIVEDGVIKSE
FT                   KFKGRLAVLSDFLEANPIKGSLGIGHTRWATHGAPSDENSHPHLNADNTIAVVHNGIIE
FT                   NYVSLKEDLIAKGYKFKSQTDTEVIVHLLDSLYEGNLLEAVNKLTSIIRGAYAIGVVCS
FT                   KSPNEMVAVRNESPLIVGLGQDENFIASDIPALLKYTRDVCILENGETVHLTPEKVTIY
FT                   SPDKKEVKRDKFTVDWDVESASKGGYDHFMLKEIHEQPTAIKDTLLRRLDENGKIKLDD
FT                   IKLTKEDLEKISKVYIVACGTAYNAGLVGRYAIEKFAQIPVEPDIASEFRYREPFIDQN
FT                   TLLIVISQSGETLDTLAAIREAKRKGARILSVTNVVGSSVARESDDVFYTWAGPEIAVA
FT                   STKAYTTQMTALYMIALDLALTKGTITEEFYFDMIEKMKELPAKVEKILENYEDIKQVA
FT                   KEIKDKHSAFYLGRGLDYQTAMEGALKLKEISYIHTEAFAAGELKHGTIALIEEGTPVI
FT                   AIASQERLYEKMLSNIQEVKARGAYVIAIANENRKEIEAQADRVIYVPEVDDILAPVLT
FT                   AVPTQLIAYYTSLIKGNDVDKPRNLAKSVTVE"
FT   gene            591366..591929
FT                   /locus_tag="CLOST_0499"
FT   CDS             591366..591929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0499"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20625"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20625.1"
FT                   /translation="MEARKLLDILLVAERLKDTTRHCYTAKGRHESVAEHSWMMTLMAF
FT                   FMRDEFPDVDMDKVMRMCVIHDLGECFTGDIPTFEKNEAHEQKEEDLLYGWVDSLPEKY
FT                   AIEMRELYEEMSERKTAEAKIYKAIDGLEAVIQHNISDISTWIPKEYDLNLTYAQDKVE
FT                   FSEYLKELRQLVREDTLKKIDEAK"
FT   gene            complement(591940..593031)
FT                   /locus_tag="CLOST_0500"
FT   CDS             complement(591940..593031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0500"
FT                   /product="putative Metal dependent phosphohydrolase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20626"
FT                   /db_xref="GOA:E3PW11"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20626.1"
FT                   /translation="MRFVPIEYIKENSILGDTIYSVDGVLLANEGIKLTARLLNKIKEN
FT                   QIFTLYITDEHSNSKINRLIHPNLRNKAMLIVKEIFLAAGYRDANGQLKSKSIYEYMSS
FT                   LNSIVDEILLELASKKDIPLEYIDIKSVENYLYMSSLNCGILGALIAMDMNYNYEMTKN
FT                   IFLAGIFHDIGMALIPPDIFQKKTEFATEEKMMIINHPKIGIEFLKDKHFLNAYVKQAT
FT                   LQHHEKLDGTGYPLRISGEEINTVSQIVGITDVYDAMTSDKPYRRATTPHEAIEYLMAG
FT                   SGRLFDSNVVSVFTKKINPYPPGSLVKLSTGDIAVVDEVIKGLPLRPKLRLIKGTEGNY
FT                   SYEPLDLTINHKIFIDSLVYNID"
FT   gene            593241..594737
FT                   /locus_tag="CLOST_0501"
FT   CDS             593241..594737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0501"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20627"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20627.1"
FT                   /translation="MNIFSEKLKEVFFSVLPVTIIVILLNFTIVPLGYNLMFRFVIGAM
FT                   FIVIGLTLFLLGVDLGVTPFGAVLGDEITKRNKLWIVVAAGLVLGFFISYAEPGLLILA
FT                   NQIDTVTIGNISSNSILIVVSAGIACMMVLGFLRILFDLPLYIILNVSYLIVLILGFFV
FT                   SEEFLAIAFDASGSTTGVLAVPFILALSFGISARKKNSKSSEKDSFGLVAIASVGAIAS
FT                   VMILDIFSKTSEFAGILPSSQFENLSIARVFMREVFPAFHDSSIAFLPLLIIYIVTLLI
FT                   SKSISKRENRRMIFGFIYAFLGLIIFFIGVNAGFMEVGSLIGSHLVEQEKYIFLISIGF
FT                   VLGIVTILAEPAVYVLTHQIEEVTAGYVKRRSVLVALSAGVGLAVALSMLRIVTSDIRL
FT                   WHYLLPGYIIAVTLTFFAPKLFVGIAFDAGGVATGPMTATFILAFTQGAANSYPNADLL
FT                   ADGFGMIAMVAMMPIITLQILGLVFKVKNRKTIEGEEKSS"
FT   gene            594734..595387
FT                   /locus_tag="CLOST_0502"
FT   CDS             594734..595387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0502"
FT                   /product="Nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20628"
FT                   /db_xref="GOA:E3PW13"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20628.1"
FT                   /translation="MIIYDMNVLILKHGMGSKAIALAKDCNISGGTVLLGKGTIRNSFL
FT                   SFFELAESTKEIVLIIANRELGCKFLERANSEFNLINQNHGIAFSIELSKVMGYTSYKK
FT                   DTLNYCQTGGEVMLNYDSIFVIVDKGKGEDVVDAASEAGARGATIVNARGSGIHETSKI
FT                   FAIEIEPEKEIVLILTKDDITQAVCDNINRKMKLDEPGNGILFVQKVNKAYGIY"
FT   gene            complement(595519..596058)
FT                   /locus_tag="CLOST_0503"
FT   CDS             complement(595519..596058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0503"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20629"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20629.1"
FT                   /translation="MVNKKLIGVFKTETDAIKVIESLRANGYSDKEISVMAKHHDEIRN
FT                   VENVTDTKIKTEDTARNTTTGVVTGGIIGGAGALLAEIGVLAIPGVGPFLAAGPIAATL
FT                   GGIIAGGAVGGLAGALVDLGVDEAELDEFKGYLDQGYIIVAVDERDDYKRDLVYTHYRD
FT                   NNSVIMDKYDYDNRVL"
FT   gene            complement(596289..596747)
FT                   /locus_tag="CLOST_0504"
FT   CDS             complement(596289..596747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0504"
FT                   /product="putative Hemerythrin HHE cation binding region"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20630"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20630.1"
FT                   /translation="MDIFKEIKKEHEEFRKLSDEINETTDRAIKTRQSKFEKLYIDLTA
FT                   HHEAEEAVLVPKLKENKDTKDMGLEILEEHHVIEDLLEKLKNLPVDDETWIIKFGVMKE
FT                   IMEHHLDEEENEISEEAHKQFDQKTLDSLGEQFEIEEQKQKEKLLSQK"
FT   gene            596952..598151
FT                   /locus_tag="CLOST_0505"
FT   CDS             596952..598151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0505"
FT                   /product="putative Oxidoreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20631"
FT                   /db_xref="GOA:E3PW16"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20631.1"
FT                   /translation="MKLYEGNMYWPKTKKSIKYDSLNADIDTDIAIIGAGMSGILCGYE
FT                   LAKRGHEVVLVEAEEIAKGSSSANTGLLQYSSDKMLYEFIDELGKENAVLFYRMCHEAM
FT                   KDLKALSEKLPERGDFVTRNSLYLASKIEDITKLKKEYKALLENDFPVEYIDSKALETD
FT                   YGIKGTEAMLTKEDAEVNPYKFILEISEEAVRLGLDIFENSKVLDIDKSDDCFIIKTKD
FT                   GSIKAKKLVYATGYKANDYSEIKDGEINRTYALATEPISGDSWKDRCLIWETARPYFYA
FT                   RMTEDNRIILGGEDEEKDSVTNSEEKLQKNTLKLLEKLTNLFPHIETKIEYSWNAVFGE
FT                   SDDGIPFIGQDTDDKDVYYCLGFGGNGTVYSMAGSKIIADLIEGKSNKYAHIVSLDRQG
FT                   "
FT   gene            598213..599568
FT                   /gene="dsdA"
FT                   /locus_tag="CLOST_0506"
FT   CDS             598213..599568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsdA"
FT                   /locus_tag="CLOST_0506"
FT                   /product="D-serine ammonia-lyase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.3.1.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3053699, 6343359, 795658, 89034191, 89123371, 91056090,
FT                   9222324; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20632"
FT                   /db_xref="GOA:E3PW17"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20632.1"
FT                   /translation="MLEKIVQGKSLETWFNEFPKLREVYDLKEVLWINDKYESIKSKTS
FT                   FEPSMDDILDAMNRLGRFASYIKVAFPVTRESDGIIESELFEIEMMKNDLAKKVNMDLE
FT                   GRLFIKGDHALPISGSIKARGGIYEVLKHAEDLAISHGLLKEGMDYSAFDSEEFRALFS
FT                   QHSIAVGSTGNLGLSIGIISARLGFKVYVHMSSDAKKWKKDLLRSKGVTVIEYESDYSK
FT                   AVEEGRKQSELDDKMYFVDDENSVNLFLGYAVAALRLSKQLKDMNIAVDSEHPLFVYLP
FT                   CGVGGGPGGVAYGLKLIFGDNVHCFFAEPTHSPCMLIGMMTSLHDKVSVQDFDIDNKTA
FT                   ADGLAVGRPSGFVGKILENLLSGVYSVTDENLFIMLSDLADLEEIYLEPSALAGVKGIV
FT                   HMHSEEAKGYIEKNNLADKMKDSVHIVWATGGSMVPEAEMKLYYETGDKLRK"
FT   gene            599700..601664
FT                   /gene="uvrB"
FT                   /locus_tag="CLOST_0507"
FT   CDS             599700..601664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="CLOST_0507"
FT                   /product="excinulease of nucleotide excision repair, DNA
FT                   damage recognition component"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.3 : Degradation of DNA"
FT                   /function="15.5 : Detoxification"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10371161, 10631326, 10946234, 11421287, 11689453,
FT                   12145219, 2843804, 3008099, 3515321, 89367292, 90237003,
FT                   90368795, 99400633, 99419077; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20633"
FT                   /db_xref="GOA:E3PW18"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20633.1"
FT                   /translation="MEFKIVSDYKPMGDQPQAIDTMVRSIESGAKHQTLLGVTGSGKTF
FT                   TMANIIERTQKPTLVIAHNKTLAAQLYGEFKEFFPENAVEYFVSYYDYYQPEAYVAHSD
FT                   TYIEKDSSINDEIDKLRHSATAAVLERRDVIIVASVSCIYGLGDPSDYEEMMVSLRPGQ
FT                   NKDRDDVIKELVEIQYERNDINFVRGTFRVRGDIIEILPINTDERGIRIEFFGDEIERI
FT                   SEIDYITGEIVGVRNHVAIFPASHYVTSKEKLAKAIEKIEVELEERIEYFKERDMFLEA
FT                   QRIEQRTKYDLEMLKEIGTCKGIENYSRHLSGRDEGERPFTLMDFFPDDFLIIIDESHV
FT                   MLPQLHAMYAGDRSRKGTLIDYGFRLPSAFDNRPLRFEEFEQVANQILYVSATPSKYEM
FT                   EHSVAFGEQVIRPTGLVDPEIEIRPIKGQIDDLLFEINERVKKKERVLITTLTKKMSEN
FT                   LTQYLKEASVKVRYLHSDIETLERIEIIRDLRLGEFDVLVGINLLREGLDLPEVSLVAI
FT                   LDADKEGFLRSETSLIQTVGRAARNSNGKVIMYADNMTGSMQRAITETYRRREIQINYN
FT                   KENNITPTTIFKEIRGVIAATSAAEGEGNYSVRETIDRERVKDEIIKLSTEMVEAAEAL
FT                   EFEKAASLRDRIRELESKL"
FT   gene            601701..604529
FT                   /gene="uvrA"
FT                   /locus_tag="CLOST_0508"
FT   CDS             601701..604529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CLOST_0508"
FT                   /product="ATPase and DNA damage recognition protein of
FT                   nucleotide excision repair excinuclease UvrABC"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.5 : Detoxification"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11421287, 12145219, 1826851, 2550431, 2843804, 3007478,
FT                   6283374, 6310514, 91142142, 91214984, 91250460, 99400633;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20634"
FT                   /db_xref="GOA:E3PW19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20634.1"
FT                   /translation="MERSEIIIKGAKEHNLKNVDVTLPRNKFIVFTGLSGSGKSSLAFD
FT                   TIYAEGQRRYVESLSSYARQFLGQMEKPNVEYIEGLSPSISIDQKTTSRNPRSTVGTVT
FT                   EIYDYLRLLFARIGVPHCPVCHEPISQLTVQEIVDKVMELHDRTKIQIMSPVVRGKKGR
FT                   HEKLLEAIRKDGYVRIRVDGENMEITDDIELDKNKKHTIDVVVDRIAVKSGIESRLSDS
FT                   IETAVKLSDGLVIIDVIDDKEMLLSTKFACPEHGVGIEELTPRMFSFNAPYGACETCNG
FT                   LGSMKKVDEYLVVPNQDLSLRQGAVDAWFSSGSGANEDTYYFKMIESLATTYKASLDVP
FT                   FRDLDKEFKQKLLYGTPDMIEFKYESKYGGNRTYKAPFEGVIPNLERRYKETPSEYIRE
FT                   KIESYMFESPCPSCHGARLRPEILSVTLGNRNISEVTDFSVNEILDYVDSLELTPKQEF
FT                   ISKEILKEIKVRTNFLKNVGLDYLTLSRKAGTLSGGESQRIRLATQIGSALVGVLYVLD
FT                   EPSIGLHQRDNDKLLASLRHLTDIGNTLIVVEHDDDTMRAADHIVDIGPKAGIHGGEII
FT                   AQGTLEDIKKNPNSITGQYLSGKKRIEVPKERRTPNGAKLTIKNASENNLKNIDVDIPL
FT                   GVFTCVTGVSGSGKSSLINEILYKGAAAKTQRLKERPGKHDEILGLEQIDKVVDIDQSP
FT                   IGRTPRSNPATYTGVFDMIRDVYALTPEAKARGYSKGRFSFNVKGGRCEACKGDGIIKI
FT                   EMHFLPDVYVPCEVCKGERYNRETLQVKYKGKSISDVLSMNVEEALEFFENIPKIKRKL
FT                   ETLSEVGLAYITLGQPSTQLSGGEAQRIKLATELSKRATGKTLYILDEPTTGLHVDDVK
FT                   KLIEVLQKLVDGGNTVVVIEHNLDVIKTCDHIIDLGPEGGDKGGSVLIEGTPEEIIKCK
FT                   DSYTGFFLKKYL"
FT   gene            604662..605258
FT                   /locus_tag="CLOST_0509"
FT   CDS             604662..605258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0509"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20635"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20635.1"
FT                   /translation="MKKLTKLLAVLLVLGIMVTGCNNQIKPSEPDKIPVESNEGQENPD
FT                   NQANPEDEPTINKDLKQVNAIFYSMDADKADMIILDSNSDSKNIILKDEARVFLTDKEV
FT                   NTVVSLQIKESSKGIEVYNAKDADKATAKAKYIGFADNNFAEFEIMNKAFVLQIPEALK
FT                   TELEKVNTNELLEITIKTNEIPIANPVLESFKRGQ"
FT   gene            605428..606069
FT                   /locus_tag="CLOST_0510"
FT   CDS             605428..606069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0510"
FT                   /product="Two-component response regulator yhcZ"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20636"
FT                   /db_xref="GOA:E3PW21"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20636.1"
FT                   /translation="MIKTIVVDNDALIRDIVQKILEDNSQIELVHKAEDGFDALEYLEI
FT                   NKVDLVLLDIGMPKINGIEVLQKIKNLYPHIKVIMLTSCKDKEIVLKCLNLGADGYLSK
FT                   DVGCEGIIDAILRVYDGEMVTFPKVSDLIIEDMDYVRKQIEENTKSQKLTKRELQVMSL
FT                   ISKGMSNKAIAKHLEISDKTVKNHVSSILRKLSLNDRTQIAVYTLSNNIF"
FT   gene            complement(606209..607027)
FT                   /locus_tag="CLOST_0511"
FT   CDS             complement(606209..607027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0511"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20637"
FT                   /db_xref="GOA:E3PW22"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20637.1"
FT                   /translation="MSNSVNKPIYNNDISSLFQNEGFELVVSMDCEGTNYDKNLENNVL
FT                   NLERFLKLATNNNITCILFITPYFADMLSKLNLIDKIKENYKVIFGLHIHPDNLPEDIA
FT                   SKCSFIRPDEEYLASYSYEQQKQIINLCMEYLDNKGIEPIQIYRGGCFSMNEDTSKILE
FT                   ELTDIKYESHNPYREQYTPLNGLLNPMPVYALSRDEELRLEFFTTEKLQHMVSEAYDKG
FT                   TKTIAITHSYMLDSNDFHYERDAIIDDIHARLEKILETIQEKSTVPKIAN"
FT   gene            607152..608282
FT                   /locus_tag="CLOST_0512"
FT   CDS             607152..608282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0512"
FT                   /product="Alanine dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20638"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20638.1"
FT                   /translation="MKTLGFPRMHKEEGEIRAFLPDFFEKLEINGAKIYIEEGYGSKMG
FT                   YTKEDYLSVNKNIEFVSKEESYKQDIIIVLRSPEFDELELIPDGKILVSMLHYPTRAKR
FT                   IKVLKRKNIKAVSLDSIRGDFMQRLVFNAKGTSLHGMEIAFSELEKIKSDFYSNTRGPL
FT                   EVSIIGMGMVGLQAGKAASKFALPEIAKKIKEAKAKGVLINMLPRNITSDREEMIKILK
FT                   RTDILVDASTRDNPYEYIVDNELLGNLKKEAIILDLTADPYLVDEEGIQVKAIEGIPTG
FT                   TLDKYVIYKDDKEYYDIPDTVNTSNRRTVVSCDAWPGVKPRECMELYAVQMLPLITKLL
FT                   EKEFEQMSLESPYYFERAIYRATLDYFFKYDKVKTE"
FT   gene            608308..608925
FT                   /locus_tag="CLOST_0513"
FT   CDS             608308..608925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0513"
FT                   /product="GntR-family transcriptional regulator
FT                   (Transcriptional regulator, GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20639"
FT                   /db_xref="GOA:E3PW24"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20639.1"
FT                   /translation="MKGQKKAAYVSIALDIANKILNGEFREKQKISGRSTLASMYNVSP
FT                   ETIRRAIVLLEDMDVVNSSRGSGIDVISKSAAEKFIEKNKSSRYISSIKDEIRDLMQQK
FT                   KKIDEQIQESFDTIFDYIERFKSDTPYTFIEIKVTADSKKIGKKINEVRLWQTTGTTMV
FT                   AYRRKGETVISPGPDYVFEEGDTIVVIGSNNVYEKVYEFLYS"
FT   gene            608946..610526
FT                   /locus_tag="CLOST_0514"
FT   CDS             608946..610526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0514"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20640"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20640.1"
FT                   /translation="MKKKLAWGLVILNFLILLIALGTWIYSNTLRPPNPDMSRGILQKI
FT                   LKADTIEQNISNKSKLLDLGDDAFAVGYLEKGNLFFEFYDENLNKVNQLKTEFTGVKDF
FT                   AIKVDGDNFILYTLADGNIRKTIVESKNLKRIGKDIRIDEANFMVQKDGYLIYVKNDGL
FT                   GVVEKDGKTYILKTQDKVINADIKVSDEGVKIVYATISDMTTHLRYTKYLNARFSDYRD
FT                   IAELGTDINRKLRSLVLESNQNQSTLIYGIKDHKSQNVAYYTVDIDKAEAKPVSVSSLH
FT                   QDSAPVFYNGTSEMILLIDDVKGNSVYTQAAIADLNASEPKKLLTKGKITAYNPEMISI
FT                   NGHDYLKYENVMANKKEVYLASSSPSIMEKTSKPSVDEVNGILGETVAASVFGYAFSLS
FT                   YFGYIFIFISLLFFSAMLFFVSWTERNPGKIIIAAAVMHLIAQLMTMSSYLIQNAPSNI
FT                   ALPFYLKNPVIVIAMIVISLLVSLAFIFYRHTRNDMKQRLWGTYFEFFTVNTILYMLIF
FT                   FPYLAVYYI"
FT   gene            complement(610642..611958)
FT                   /locus_tag="CLOST_0515"
FT   CDS             complement(610642..611958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0515"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20641"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20641.1"
FT                   /translation="MPLFITILAITIAQLPGLAMRYLPFSKSLELGRKKKLFLYYTAAF
FT                   IFQHLAVYILVKGDYNNVTLLTYKRLLFLLSTIYVFINISFIKGNLYKHIFIYGMQGGY
FT                   SLFLHSIVALFVGRISTATPLYIQLSIQTIGYSILFTLFFIPLWKKVSNSIIFNSQLTN
FT                   DYYWNVIWMIPALAIYSDAMVTMNNQWINSLPQIISRIMTALSLIISWKWITLDFESLE
FT                   NMLYLKNQNKIMNLQTEGILAQAEILRESENHIKICKHDMRHNLGIIRSLIQDKKTEDV
FT                   LNYIEELDTTMKANKPLVYCKNTIVNSALLVYMSKAKEKNIDVKLELNIPDKLPWNSND
FT                   IAILIANAFENAIIASSKQSLDEQEIYISARFYDEKLAIIFKNRFNGEILIGSSGFPTS
FT                   TEPGHGIGMQSILSIVNKYKASASCTSNNGWFNMTFLFT"
FT   gene            complement(611958..612692)
FT                   /locus_tag="CLOST_0516"
FT   CDS             complement(611958..612692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0516"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20642"
FT                   /db_xref="GOA:E3PW27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20642.1"
FT                   /translation="MKIAVVDDLAQERNEIISLVTDYFSVRFQQFDITPEFCEYESGEA
FT                   FLDGFMPAEFDLVLLDIYMAELTGIETAEKLLLLDKNIKIIFFTTSTEHILDGYGVHAL
FT                   SYILKPVTKHMKAFYKALDYFVELLNLDKCGITIKTSSGDMFVLNKNIVYIESSVRNLF
FT                   FHFASEVVQASGKYSDYSKVLREDHRFLECYRNLTVNMDYIVKPIENDFLLKTGEKIPI
FT                   SRRRKAEVIEQYTTYFINRRGF"
FT   gene            612921..617501
FT                   /locus_tag="CLOST_0517"
FT   CDS             612921..617501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0517"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20643"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20643.1"
FT                   /translation="MKSSQLKTNNKKKVLSMLLALTMIFQISIPAVFAEGEENQKKIIA
FT                   FEELADDVKNITVEVDSTEEEVVAKMPSSLKASYQETTTGSAIEITIENVTWELYETNS
FT                   ASATFDSSQSGASYTYKAKLPATDSIGDELVLESGVSLPTITVLVGAVPILLGGDLDEA
FT                   SITEQGGNITTYATIEEAITVAQTVENCTVTLLKDVETENLILINNGTFTLDLNGKWLN
FT                   NTANDGICAIGLQGAVSLKIKDSVGTGGITTIETYSIYSSGYCSLKIEGGSYKGIMWSY
FT                   NNVGDALENGYVYRNISDNSLVTDVNTLSNFEIYNVKVTPAPVIITAQPEDTIIAPGYT
FT                   VDQAPTLTVIAQTVPTDSGQTISYQWYKDDVAIAGATNSSYTVPTGLTEGTYYYYCAVT
FT                   CEGVLVKSNNAELYIYSNTGDYEVTDSNSNTSKYPALEAAITFAKSKPGSTVKLLADAN
FT                   TVSSVKVSSGTFTIDLNGHIWTSTATDRALDVSLANHITLKDSHGGGKFTTSTAECLVL
FT                   VSRSSLTIESGIYENTVGKVSYASAIDNTHKITIKDGSFIGTATGQRLFEFHRIGVLIN
FT                   NGSFSGNPVYFATYENITQSVFLAGGTYDRIQMFSGSLGTLLEEDYAFNQSGTWINNPS
FT                   GTDISNVIVKLKPVAISQQPQNATNATYGYTQGPNISVTAQKTATGTGDISYKWYRVKS
FT                   GSEPADMEVGTNSNTLEIPSGLPAGTHSFYCVVSCDGYILNTETVTFTVEKATPIVDIV
FT                   EENTSDRVFGDTIQIKAKVSGIYFENLAGTITLKEGSTTIATAILSNGSAILEWTNVPT
FT                   GDHNLLVEYTAPSNSNYTDEISSNISFNVVKAPQASLHINEVTGKKFLDGNFTLGTAGG
FT                   TGTGAVSYSASSNDVLSISGNTATIIGAGTVTVTATKAEDENYLSATAQTVITIDKASA
FT                   PTISFPTASGITYGQKVLDSILDGGSITLGRFSWSQPEQNLVPNVVNGGTYTAKVIFTP
FT                   NATTVKNYEEIPQVDREADISFTVNKAQPSVNLSTKSTGTSGNRTTEIKINLSKSGFGN
FT                   YPQGTIKLVDCTEATEKDIVGAENVPLLNGEASYTWTGLSDKIYKVKAIYLGDENYLPA
FT                   SSSVSEFDTTKNEQENFKLSNPGSKTYGDNAFTLTTSGGNGTGAVSYVSSDESIISISG
FT                   DTATIHKAGTANITAIKAGDDNYNPAMNTLAVDVAKKALNIKADDKLNIVKGSIMPNLS
FT                   YTVNGLLGTDSLTKEPVITTSAKDTNAVGEYVISISEAEVSNSDSYEISYTNGKMTVIN
FT                   SSNGDSGNNSGNSSSGGSSSKDNKDDKEPNKAPVNQTPPAQGELPLQTTEQNSTKAPVF
FT                   ADTENHWAKSDIEFVTKRGLFGGTGDGKFSPNMPMTRGMFVTVLGKLAKADLTGFTSSS
FT                   FKDVKSDAYYLPYIQWANTSGIVNGISSEEFAPDMPISREQMAVMLLNYIKAMNIDLAK
FT                   LNEENQFADTDEMSAWAKEAVNAIQMSGILSGKPDNKFDPKGIATRAEVSSMLRRFIEF
FT                   MEESTK"
FT   gene            617747..621442
FT                   /locus_tag="CLOST_0518"
FT   CDS             617747..621442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0518"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20644"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20644.1"
FT                   /translation="MLLKSKKKFFAILLVLTMIFQVSMPVTYAGEIPKYVAFEELAEAI
FT                   RNQTVPVGTTKEAIIATLPTAVGGTLLETATTTGSALSVTVNIERWDCYDFSSEVPGEE
FT                   YYFIGTPPWPHEIATGVEYPKVKVKIAGELQLPPGVTLVDGATYGGDITQRGLNLRNSG
FT                   LPDKKMQYKAGSGYVLFTPQGQGVANPTIELNNATFLYGGNPLDLPDVESDLIFKGRTV
FT                   LAGSLPNDCNFKLEPNAKFELRKPDASGSWLDLFLENKMIIGENATFIINEEVAVIVTE
FT                   RGEGNTSLIENSGSIIVRGELVFEDPAYRDDIANLNISTEDRGKVLVDGEPFIIGDLLF
FT                   DEAAGLELSPENEGVYKAGNGSITWEPEIAPFGELIGGVLTLDNASFNMEEGSRGCIRV
FT                   FERKNIPITINVIGENNLENIYGEVIAIDNLKLTGSGNLTVKGESPIIYEDSFDKTGFN
FT                   GELNAIVIKRIYEMGYGHSLYETAYGRTSYVDGNDATEFTVSQGAVLTIEQGANLETKT
FT                   FVNNGEVINNGSISMQVDVNDANLYTWAYDYLNLKGSGVLIVSQTSGGGISATFTNDGK
FT                   LINETFTPLDFSSVTEDKGNLEVDGYFWNHATKTLTLQNIILHESSSTVNNSAISLPQG
FT                   ENVTLELKGYNKIKGFKKAIYQGDPIFDNPNEKIDPSGSLTIKGNGILVGEKSELGGYR
FT                   EDVITTTGKLIVESGTLNMYSPHKKGILAIGMEIKGGNIGSEFVKSPLICLGDFVMSGG
FT                   KIIGANTDGGSIEVFGNMNISTGEIYANGVANAIDVIGGDLTLTNGKVKVQDSLIGIKL
FT                   REGNFTMTGGDVQIYNSNDELSSGIVLVDMMGSNRTFSITGGTVDIKVLMSAFNFMSFG
FT                   NGSTFSFESGGMNVTTSPVGGVLRSETFSMPEPGDIPPDAVNPGAGPIPPDSINPGAGP
FT                   TPGSMPGITVTSFTTDERLDVSFMSEIMIENACTGLKIVKENTPDEPTNPTNPTNPSNG
FT                   NTSGDSGNNSGNGSSGGSSSKDDKDDKEPNKAPVNQTPQAQAELPLQTSEQNSTKAPVF
FT                   ADTENHWAKSDIEFVTKRGLFGGTGDGKFSPNMPMTRGMFVTVLGKLAKADLTGFDSTD
FT                   FKDVKSDAYYLPYIQWANTSGIVNGISSEEFAPDMPISREQMAVMLLNYIKAMNIDLAS
FT                   LNQENQFADTDEMSTWAKEAVKAIQMSGILSGKPDNKFDPKGIATRAEVSSMLRRFIEL
FT                   MEESTK"
FT   gene            621659..625141
FT                   /locus_tag="CLOST_0519"
FT   CDS             621659..625141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0519"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20645"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20645.1"
FT                   /translation="MNLKQKKKMLSALLAFTMVLQMSVPVVFAEGEDSSSGADDIMLSG
FT                   SNQPTTTGGAITIDLDGLVAENLASLNEGDIVTIDGKEVTYKGDATATGINIAESEYVA
FT                   DGKQVIYKAGNGYILITWPTQAGVPYLVTLHDANIDIAGTGDIDAIDIVGKVIMNLEGA
FT                   NRLKAPRDGIRIGTIQPIITIGGNGSLYIESLCGINQTHISGEFIIQEDAVLDLRCTGF
FT                   GMHTGYSGKITIKDNAKVNISVSPGTNNAACICKYLYVKGNAEVNTNGEHPIIDAVSTE
FT                   VEPTTSLNAIVRGVLSTTEWPHTVYGTVTVPENAILDFGAEYHKNGPLSAAEGASLINN
FT                   GIIKVNDGVSVEQLKALNITNNGILMLGSKAVQLFGDTLYEDKGTITGNIDFKTNMPTE
FT                   PTYYRKSGGYIMFRPASGAENASIKLHGINLEADNNLLIFPDELVDVIIEGENEVDIIR
FT                   ASKNFNLKGNGTLNALRIETTEENVQMNIGSDVKLNSEYRTGSNMIMTSTFYGKNEVDY
FT                   ADGLMVRGDQKVVLKAGSELKLSINEGIIGFMQIDEGALGDIIIEEGASIVNNSHIFLP
FT                   IGTTVEQIKALNLKGTGVVRVVKEYDNGLPSIWDTFSNEGKSVTVMNGNLTLDDIEITE
FT                   SDNKGYTWTKTEESGNKVWTLELKNIIIDGLINVPNTKTIINTQEDSNVNGGISKSTSY
FT                   SLDLVFKGNGVLTIGGTISGGTNGDIVTIENGARINILGNISVGASGGGVDGTVIIDGR
FT                   GTELIINSGYDSGIVCDTVKVQNGANVEIHSETRGIMALSGGVSVENGSTLETNCEYGV
FT                   YILDGKLNVDDTSILITDGSRAPFAIVDLSGEKGESDVVRLPGMPTDTKINSVTGDFDF
FT                   YGTKRKYWSVHDTGVLGVTDENSEPVKLTGAAIGRYIFKKAVVPTDPTPTDPTPTDPTP
FT                   TDPTPDKPSKPSKPSSDDDKEKEKNDVEQEVPIPPTVVAEAEPSKPIFIDVNDDDWFKP
FT                   AVDFVTGKGIMNGVEKNRFGPYISTTRGMIVTIFWQMENKPMPNGSQNYTDVNQGQYFA
FT                   DAVNWATENNIVVGYGNGNFGPNDIITREQMATILYQYSKYKNYDLTQGGMKVREFSDY
FT                   ENISPWALEYMTWAVNNQIISGVGNNMLNSRGHATRAQVAAILKNFYAIIDKQ"
FT   gene            625564..626187
FT                   /gene="hisG"
FT                   /locus_tag="CLOST_0520"
FT   CDS             625564..626187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="CLOST_0520"
FT                   /product="ATP phosphoribosyltransferase (ATP-PRTase)
FT                   (ATP-PRT)"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20646"
FT                   /db_xref="GOA:E3PW31"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20646.1"
FT                   /translation="MLRIALAKGRLQEDFLDLIYQNQGTMSQNKRSLRLTDRLRNWEIL
FT                   LPKSQDVPQYLDMGMADIGVVGKDVLLECKSNLKEVMDLELGRCKMVIAGPTENKGKVK
FT                   YKTVATKYPNIAKDIFKNKGIDAEIIYLQGSVELAVATGIADVIVDIVQTGTTLKENGL
FT                   VVYEELFDINAKLVVSNEISSRKFAMIDSLINELKRGGERCEYI"
FT   gene            626174..627448
FT                   /gene="hisD"
FT                   /locus_tag="CLOST_0521"
FT   CDS             626174..627448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="CLOST_0521"
FT                   /product="bifunctional histidinal dehydrogenase and
FT                   histidinol dehydrogenase"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="1.1.1.23"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11842181, 2194167, 3018428, 3062174, 6246067, 86310273,
FT                   89094829, 90301483, 9298646; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20647"
FT                   /db_xref="GOA:E3PW32"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20647.1"
FT                   /translation="MNIFKLNSERARAFLNKISSRQADMEDKVLDAVREIINKVKQNGD
FT                   NALISYAKQFDKVELKSLEVSSIELSQTELKIDKAVKKAIDKAYENIWEFQSAQKPEDF
FT                   IYEKEGIISKTRYIPIETAGIYVPGGKAAYPSSVLMNAIPARAAGVKNIIMTVPCDENG
FT                   VISPEVLYAAKLCKVDRIFKVGGAQAIAALAYGTESIPKVDIITGPGNIYVSVAKKLVY
FT                   GTVNVDMIAGPSEILIVSDGNQNPSYIAADLISQAEHDELASSILLTLSDKEAEAVSNE
FT                   VGIQLSKLPKSKIASESIKNYGAILVCDTKQELIDIANQIAPEHLEVLFEDKKITDSLT
FT                   NAGCIFSGEYSPEPLGDYMAGPNHILPTNGSAKAFSPLGIQSFMKRSNYIEASKEGLEK
FT                   IYKDIACFAKAENLDGHANSILRRF"
FT   gene            627450..628472
FT                   /locus_tag="CLOST_0522"
FT   CDS             627450..628472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0522"
FT                   /product="putative Histidinol-phosphate aminotransferase 1
FT                   (Imidazole acetol-phosphate transaminase 1)"
FT                   /EC_number="2.6.1.9"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20648"
FT                   /db_xref="GOA:E3PW33"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20648.1"
FT                   /translation="MMSNILKLDANERAKGYEAEIIASIIQKSVFSKVSINRYPDAKAI
FT                   KLRKAYSKYSKIPYENLIAGNGSDELIDLAFSVFAQSKTVVCFDPDFSMYEVYSKKYNA
FT                   SLIKVKTMKLEDLINAARINMASVIVFSNPNNPTGKGFLKSDVEQLIKTFWGTVIVDEA
FT                   YMDFYNQSVSDLISKYDNLVITKTCSKALGLAGIRVGFLGSESNNIDKIEQVRSPYNVN
FT                   SLTQNIATEILSYPKLIAKYIKEVKCSRDDLYYKLIAELNDEIQIYESSANFIYMKTKY
FT                   SADIYEYLLEKGILIRSFEDGIRITVGNIEDNVKLVSELKRAISLAKEERRGYQNERAV
FT                   "
FT   gene            628456..629040
FT                   /gene="hisB"
FT                   /locus_tag="CLOST_0523"
FT   CDS             628456..629040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="CLOST_0523"
FT                   /product="Imidazoleglycerol-phosphate dehydratase (IGPD)"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20649"
FT                   /db_xref="GOA:E3PW34"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20649.1"
FT                   /translation="MRGQYKRLTSETKIEILLDTRADEYKSLESDTGIGFFDHMLITFG
FT                   RYANLNGYIKVEGDLFVDTHHTIEDTAIALGKTLKMMIKDTSINRYANAIIPMDEALVR
FT                   TVIDMGGRAYLDFDYEFKREKIGAYDTDMTLEFLRAIANNSESTIHIDVLKGKNDHHIT
FT                   EAIFKSLGLAIKQAITVVDGEIFSTKGKVEE"
FT   gene            629041..629667
FT                   /gene="hisH"
FT                   /locus_tag="CLOST_0524"
FT   CDS             629041..629667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="CLOST_0524"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit with HisF"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11551184, 3062174, 8494895, 89094829, 93264432, 94237842;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20650"
FT                   /db_xref="GOA:E3PW35"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20650.1"
FT                   /translation="MIGILDYNAGNLKSVESALENIEAKSMVITCPAQLSEISGLIIPG
FT                   VGSFKTAIENLKAKGFTKEVISEFAKTKKVLGICLGMQIFYDFGTEEGLSTGLGFFSGK
FT                   VDLLDKAVVTPHMGWNQIELRKSTRLTRGLDDKFDGYFAHSYRAYEQKDEVVGICSYTE
FT                   DMPVIVAKDNIYGLQFHPEKSGNSGLKILRNFKEMCYENYTICRH"
FT   gene            629639..630373
FT                   /gene="hisA"
FT                   /locus_tag="CLOST_0525"
FT   CDS             629639..630373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="CLOST_0525"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
FT                   methylideneamino] imidazole-4-carboxamide isomerase
FT                   (Phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase)"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20651"
FT                   /db_xref="GOA:E3PW36"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20651.1"
FT                   /translation="MKIIPSVDIKSGRAVRLYQGDFAKETVVGENPVAIVNNFLNLGAE
FT                   EAHIVNLDGALGDKFANMGIIKEICKSKTSQRQKIQLGGGIRTIEDIETALELGIDSVV
FT                   IGSMIAEDFELFAKAVEIYKDKIVAALDVKGEVLMTRGWLDGSEALVYDITSKLENLNV
FT                   RRIVLTDITKDGTLLGPNINLALELSKIYSGEIIVSGGVADYKDLESIKDNKLAGAILG
FT                   KSIYSGRIDLEKAFELGGSYGI"
FT   gene            630363..631121
FT                   /gene="hisF"
FT                   /locus_tag="CLOST_0526"
FT   CDS             630363..631121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="CLOST_0526"
FT                   /product="imidazole glycerol phosphate synthase, catalytic
FT                   subunit with HisH"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10222209, 4934198, 93264432, 94237842; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20652"
FT                   /db_xref="GOA:E3PW37"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20652.1"
FT                   /translation="MAYKRIIPCLDVKDSKVVKGINFEGLKSIADPVELAQKYYMDGAD
FT                   ELVFLDISATLEARKTMLEMVEKVAKSIFIPFTVGGGISTVEDMRNVILKGADKVSINS
FT                   SAVKNPKLITDGAKLFGSQCIVVAVDTKKINGREEVVINGGTTQTGIDALEWIKKAADL
FT                   GAGEILLTSMDSDGTKNGYDTEFLDKVTKAVNIPVIASGGCGSKEDILEVFEKTGATGA
FT                   LAASIFHYNQDSIGSVKKYLSQNEISVRVG"
FT   gene            631096..631428
FT                   /gene="hisI"
FT                   /locus_tag="CLOST_0527"
FT   CDS             631096..631428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="CLOST_0527"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase (PRA-CH)"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20653"
FT                   /db_xref="GOA:E3PW38"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20653.1"
FT                   /translation="MKYQLGWDKAMVDFSKGLVPVIVQDYNTNQVLMLGYTNEEAYSKT
FT                   LETNCVYFYSRSRDKLWKKGETSGNILKVKELYLDCDSDTVLIKALPEGPTCHTGETSC
FT                   FFNQIV"
FT   gene            631541..631819
FT                   /gene="hisE"
FT                   /locus_tag="CLOST_0528"
FT   CDS             631541..631819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="CLOST_0528"
FT                   /product="Phosphoribosyl-ATP pyrophosphatase (PRA-PH)"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20654"
FT                   /db_xref="GOA:E3PW39"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20654.1"
FT                   /translation="MKNLSELYEVVLNRKANRVEGSYTSYLFDKGLDKILKKIGEESAE
FT                   VIIAAKNDDKSELIYEISDLLYHLTVLMVEKGVDYKDIDEELEKRRK"
FT   gene            631914..632477
FT                   /locus_tag="CLOST_0529"
FT   CDS             631914..632477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0529"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20655"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20655.1"
FT                   /translation="MDIKSVNSQGQILPQGKPVKEKLAEKDKDVSSPKVENNPAVKYEK
FT                   SEKVEEKYITYDKTAVDKLKAEAEQRHANLRNMVKELLKRQGLTFKDVFEDGKEVKVDE
FT                   QTRLEAQASIDEGGEYSVDAVATRIVDFAKAISGGDKAQIGKLKAAIEDGFKQAKEALG
FT                   GYLPEISQKTYDEVMKRMDEWANE"
FT   gene            complement(632532..633080)
FT                   /locus_tag="CLOST_0530"
FT   CDS             complement(632532..633080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0530"
FT                   /product="Signal peptidase I precursor"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20656"
FT                   /db_xref="GOA:E3PW41"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20656.1"
FT                   /translation="MKNVIFEWIKTIVIAFAAAFLINVFITPLQVHSVSMNPTLVENDY
FT                   LILNDHAKIERGDIVSFTSDIPFEEYELQSFNFIQKFQAGDTKNLIKRVIALPGDQLQI
FT                   YDGKVYLNGELQEEPYILGDFTFGDIYIEEIPEGEIFVMGDNRDNSLDSRSFGTVSIDK
FT                   VQGRAMVRLFPFNKIGILE"
FT   gene            complement(633199..633981)
FT                   /locus_tag="CLOST_0531"
FT   CDS             complement(633199..633981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0531"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20657"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20657.1"
FT                   /translation="MDSSILELSFIQLGLAYIFVLITLVIIRKRKLNREKELLISTIRM
FT                   TIQLILTGYVLVYIFDNVSMLYTICIIILMECFAIYTIFKQSKHPLSSKLKKIIAFSMS
FT                   IGTLSSLFYFLIIVVRISPWYDPRYFIPIAGMLIGNSMTGISLGISTLIKGMTTQKDKV
FT                   ETALMLGATPKQASKEFIDSAFDSAILPTINSMLGMGIIFLPGMMTGQILSGTSPVVAI
FT                   RYQIAIMLGILGSVSFTTILSLSLGYKTFFNSNKQLDY"
FT   gene            complement(633985..634623)
FT                   /locus_tag="CLOST_0532"
FT   CDS             complement(633985..634623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0532"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20658"
FT                   /db_xref="GOA:E3PW43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20658.1"
FT                   /translation="MFKIENLKYKNILDVKNLEIRSNIVTTIVGKSGSGKTTLLKLLNK
FT                   LISPESGKVYYLGNDLEQVDSIAHRRKVVMLSQTPVVFAGSVKDNLLIGLDFSEKPHPS
FT                   DYKLIEVLHKVHLNLSLSADADKLSGGEKQRLSLGRILLMNPEVYLLDEPSSALDKETE
FT                   GIVISTLYTHVKETNKTLIMVSHSTEVADDYSDCIIKMENGSVIDIKEV"
FT   gene            complement(634633..634938)
FT                   /locus_tag="CLOST_0533"
FT   CDS             complement(634633..634938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0533"
FT                   /product="putative transcriptional regulator, PadR family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20659"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20659.1"
FT                   /translation="MADQILRKFFLGFIQIHILHHAKKEPIYGTWMIEELEEHGYDMSP
FT                   GTLYPILHSMENKGLLTKEDRNVDGKIRKYYSITPLGEDILEQAKAKAYELFKEIK"
FT   gene            complement(635044..635925)
FT                   /locus_tag="CLOST_0534"
FT   CDS             complement(635044..635925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0534"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20660"
FT                   /db_xref="GOA:E3PW45"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20660.1"
FT                   /translation="MTKQLKADIALLLVTVGWGASFILTKNSLSELQSYNFLALRFIFA
FT                   FFISAVIYYKKIISIDKFTLKHGILLGLLLFATYAFQTVGINYTTASKSAFITGFSVIL
FT                   VPIFSAIIARKLPNLLTVISVALAFSGLALITLNQDVGGLNIGDIYTGVCAVFFAIYII
FT                   LVGKFTVKAESIAFAIVQIGVVGFLSLIVSLAIETPTVPVSLPVWINLAILSLVCTSGA
FT                   YIVQNVAQKYTSATHTALIYTCEPVFAAIFAYLAVGEVLGVKGSMGAVLIVVGMLLIEL
FT                   DIPKLLYKKTHP"
FT   gene            636250..637134
FT                   /gene="folD"
FT                   /locus_tag="CLOST_0535"
FT   CDS             636250..637134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="CLOST_0535"
FT                   /product="Bifunctional protein folD [Includes:
FT                   Methylenetetrahydrofolate dehydrogenase ;
FT                   Methenyltetrahydrofolate cyclohydrolase ]"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20661"
FT                   /db_xref="GOA:E3PW46"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20661.1"
FT                   /translation="MGEIIKGKPVADSITEELIQEVELLSVRGITPKLAIVRVGARGDD
FT                   LAYEKGALTKCKKVGIETQVVELAADITQDDFIAKIQELNNDASVNGMLIFRPLPQQLD
FT                   ESVIKYIISPEKDVDCFSPVNVGKMTEGDETGFPPCTPTAVMEILKFYDVDVKGKDVTV
FT                   VGASMVVGKPVSILLLNEFATVTTCHIFTKDSSKMTKEADVVVVGVGVPRLVKENWVRE
FT                   GAVVIDVGINVDKDGNMCGDTDFDNIVDKAAMITPVPGGVGSVTTSILAKHVIKACKQQ
FT                   HHVNSKEIETVMN"
FT   gene            637256..637633
FT                   /gene="yjgF"
FT                   /locus_tag="CLOST_0536"
FT   CDS             637256..637633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgF"
FT                   /locus_tag="CLOST_0536"
FT                   /product="ketoacid-binding protein"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10493123, 10595546, 12515541, 9298646; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20662"
FT                   /db_xref="GOA:E3PW47"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20662.1"
FT                   /translation="MSKKVIATEKAPGAIGPYSQAMRIGNMIFTSGQIPLNPATGEMVT
FT                   EIAAATKQSLENVKAILEVEGATMDNVIKTTVFLSDMNNFVAMNEVYATYFPQNPPARS
FT                   AVEVARLPKDAVVEIEVIAAL"
FT   gene            637723..638793
FT                   /gene="ydgJ"
FT                   /locus_tag="CLOST_0537"
FT   CDS             637723..638793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgJ"
FT                   /locus_tag="CLOST_0537"
FT                   /product="putative oxidoreductase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20663"
FT                   /db_xref="GOA:E3PW48"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20663.1"
FT                   /translation="MKIENKENKTVINVGLVGYGLSGRFFQGGVLRGLKEFDIKMIVTT
FT                   NPEKKFQAKLDFPRAEIVDNIDEITKNDTIDLVIISTPNQLHFELANKALDAGKHVVIE
FT                   KPFTPDSLSAKALIEKAEKLKLVLSAYQNRRYDGDYLTLKSLIASGNLGRLVELESHFD
FT                   RFRPEVKKDGWRECSLPGSGVLFDLGSHLIDQALDLFGMPDELYCDIARQRQSSEVDQF
FT                   EMILYYEEKNLKVTLKAGSLVNVVLPRFMALGTKGSYATYGLDPQENALRCGESYPIPA
FT                   VDEESYGILHEEDNQKVIPTLTGDYRLYYKGIYEAIVNKTIPPVTALEAYQVIRLIELG
FT                   HMSDAEKRRISVKDNI"
FT   gene            638824..639789
FT                   /locus_tag="CLOST_0538"
FT   CDS             638824..639789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0538"
FT                   /product="Periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20664"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20664.1"
FT                   /translation="MLRGLVRLIKKYSISLLVIAICLASVVLGQLKAINSKLVEEAPDY
FT                   HFYFIAQSSTDPFWQKVEEGVKKAALDYNVYVEYVSPRFSNAQEAYKYLDIATISNVDG
FT                   IITYVPRLADYSKRIDQAFEQNIPVVTVDSDASSSKRQVYIGANSYTFGKEAAKLMHEA
FT                   TGGVAKIAVISNEDIGSDTLEYDLKMSGFFDFLKEQPNMEIVKVYTSAMGVISSEEITQ
FT                   DIISNHPEINAILTLSTSDTLGSARLIVDRNRVGKIKLVGTGSSDKIKDYIDKGIIHST
FT                   IESDGYSMGYMSVESMVNINKGYYTPTYINTQINIQKQGR"
FT   gene            639794..641305
FT                   /locus_tag="CLOST_0539"
FT   CDS             639794..641305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0539"
FT                   /product="Histidine kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20665"
FT                   /db_xref="GOA:E3PW50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20665.1"
FT                   /translation="MKNYFAKFIGIRKKLIIYFLVPIFLLGSVSMISYFTAVFLKSNTQ
FT                   DIIVDYVYLNNLKNDVTELNMELEKYLISASSEDLLDYYSHYNSLNNLAAKIPRKLSYN
FT                   RDEMLLKDIGFMLEDLLAETDKAVISKRGRVSSQYTEHFARSNEIRAYIDSYIVEMLNN
FT                   RLEEGSKRYDVLNQTMRFLFILNLGLIISMIVVTLIVAIRSSYKLTQPLTDLSHNAEEI
FT                   AKGNFYIEMKKTHTGDEIDILSEAFIKMMDSVKGHIVDIKNQAEVENRLRDQEVQNFKM
FT                   KALLKESELKFLQSQINPHFLFNTLNAASQLAVIEDAETTSLFIQNIADIFRYNLKSLD
FT                   ELVPLSDELEFVSNYMSILKMRFGERIAYEYNIDKKSLGIKIPRITLQPIIENAYIHGL
FT                   QNLERNGTIRLETKVENEVLLISIEDDGMGMTKEQVDNLINEDNAGETAAENSNKHLSG
FT                   IGVSNVIKRLKLSFQVEEKQKIIDIVSTPDKGTKVILSLPLNNRL"
FT   gene            641315..642862
FT                   /locus_tag="CLOST_0540"
FT   CDS             641315..642862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0540"
FT                   /product="putative Response regulator receiver protein"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20666"
FT                   /db_xref="GOA:E3PW51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20666.1"
FT                   /translation="MLRILIADDEYLAIEAVKKIIKNNIEDVNIVATASSGKEAIIKVN
FT                   ELSPDIAIMDIQMPGIDGLEAIRQIKASNPNILFIVLTAYDLFDYAKESIGLGAVEYLL
FT                   KPIKKDQLLMAIEKASKIVKSKQIQNKWEYELKEKLTLVSPLLENQFITQHMYAFEDFF
FT                   SKDFYENLFEINLEKGCAITLKITEDGPDDYKTSSQIQAFFETARILLKKIAPCIVSQS
FT                   VASKQYAWVPNTDDRRISDFLIDEIKSLHQKLSRQFPYEFKIGIGSLKDYENIYESLKE
FT                   SELAAFGDYKVNVYEADNSVNESEVKDYAYQLVRLAENIGRLDFVGAKHSLKKFHDKIS
FT                   HLPAHIYKQRLLEALVICEKHLPIDMTQKTGEKIERLLNSDSILEMANQFSNFILQWDS
FT                   EAKAQLLSIEEGVIPDALKYIDKHYNENISMDFVAKQVNISYHYFSKIFKQKIGKSFTD
FT                   YLTDLRIEKSLEMLSRTQKSVKDISLEIGYNDPNYYCKIFKKITGLTPTEYRAGSDK"
FT   gene            642862..643938
FT                   /gene="xylF"
FT                   /locus_tag="CLOST_0541"
FT   CDS             642862..643938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylF"
FT                   /locus_tag="CLOST_0541"
FT                   /product="D-xylose transporter subunit ;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7037773, 8581399, 90239116, 9298646, 94316500; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20667"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20667.1"
FT                   /translation="MNKPKLDTKKIIIGALIITLSALVIMIAYEANIYLKANEKNDSIL
FT                   KAENKLTKIGLTLGTLKEDRWIKDSGLLRAKAAEYGVDLIVLNANNNDNDQIEQVKYLL
FT                   KQEIDVLMIVPTDYKAAAEAVSLAKAKGVPVISYDRLVQNANVDLYISFDNFKVGQLMA
FT                   QTVVDEQVQDLLIINGAKSDNNTNMIKQGYDSILKPYIKSGEINLIEEYWATNWLKEEA
FT                   FRYTEETLKSDIKPDAIISGNDSLAEAAFEALSEYRLSGEVILVGQDADLTACQRIVEG
FT                   TQLMTVYKPIDDLVTIAIEMAIKLANGEKIETKATMNDGTYDIKCLFLEPVAVDKSNID
FT                   QTIIKDGFHLKSDVYRKQ"
FT   gene            644119..645210
FT                   /locus_tag="CLOST_0542"
FT   CDS             644119..645210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0542"
FT                   /product="ribose ABC transporter (ribose-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20668"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20668.1"
FT                   /translation="MKKVLALLMFVVVLMGLTACSGQSAQVDVGIVLPTKDEPRWVQDE
FT                   TRFREALKDTEYSVEILFSQGSSAKEKENVDALIAKGIKTLIICPHDGGAAAAAVEAAK
FT                   AEGINVISYDRLITDTEAVDYYVTFDSIAVGEAQAQYLVDNATGTGHPLYLYAGAASDN
FT                   NAFLFFEGAWNVLQPKIADGTFVIKNSSEAIALQDKATLTRDEMGKIIGQITTNWDFNE
FT                   AKNKAEAHLTSAADADKGDVFILAPNDGTARAIADAFGSDAAVTSYLVTGQDAEIASVQ
FT                   YIIDGKQSMTVFKDVRTLVKDSIDMAVALLSGGTPDTTGSYNNGNIDVKAKQTEVIVVD
FT                   KENVKAELVDSGYYKAEEFTGLE"
FT   gene            645303..646823
FT                   /gene="xylG"
FT                   /locus_tag="CLOST_0543"
FT   CDS             645303..646823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylG"
FT                   /locus_tag="CLOST_0543"
FT                   /product="fused D-xylose transporter subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 94316500; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20669"
FT                   /db_xref="GOA:E3PW54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20669.1"
FT                   /translation="MSEYILEMNNISKTFPGVKALDEVSFKVKKGEIHCLVGENGAGKS
FT                   TLMKVLSGVYPHGDYEGDIVFNGQVQKYSGISDSEKAGIAIIYQELALVPELTVYENIF
FT                   LGHEIKKGRLIDWNETILKSKELLNKVKLNVDPSSKVKEHGVGKRQLIEIAKALSKEVK
FT                   LLILDEPTAALNEDDSENLLTLLKELKSHGVTSIMISHKLKEVIAIADTVTVLRDGKTI
FT                   CSKSNEDEPISEPFIIKNMVGRDIDNIYPKREEHNIGDVIFEVKNWNAFDYKQGRDILK
FT                   NIDFDVREGEVVGIAGLMGAGRTEFAHSVFGNISNYKLSGEIEFLGKAVQLRNPYDAIK
FT                   AGIAYVSEDRKGDGLILIDDIKQNITLANLKKFSPNGLINKNEEVKIASWYKDSMNIKA
FT                   PSIEQKVGNLSGGNQQKVSFAKWLFVSPKLLILDEPTRGIDVGAKYEIYTIINDLISKG
FT                   LSIIMISSELPEILGMCDRVYVMAEGKMTGVLSSEEANQEIIMQMATN"
FT   gene            646834..648009
FT                   /gene="xylH"
FT                   /locus_tag="CLOST_0544"
FT   CDS             646834..648009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylH"
FT                   /locus_tag="CLOST_0544"
FT                   /product="D-xylose transporter subunit ; membrane component
FT                   of ABC superfamily"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 94316500; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20670"
FT                   /db_xref="GOA:E3PW55"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20670.1"
FT                   /translation="MSLINEAKGLIKQNIREYGMYIALIIIMVTFSAATGGLFMSSRNI
FT                   SNLINQTGYIAVLAVGMTLVMVIKHIDLSVGFLAGFLGAIAAILMMRFNVSVPVTILLV
FT                   LVLGTITGTFTGFLVAKMGIPAFVASLAAMLVFRGALLMVTEGTGTIVISNKAFNAIGN
FT                   GFIPDFVNMGNLHVLTLIIGIVGIAAYVWSEIKTRNDKIKYNFEVISSTMFTVKLVAIS
FT                   AVIGYITWILAGYNGLSWTVVITIIVVLIYHFITTKTIIGRHVYAVGGNSEAARLSGIN
FT                   VERITMIVFASMGMLSALSGILYTSRLQSATTTAGTLFELDAIAAAYVGGVSANGGVGK
FT                   VTGSIIGAFVMASLTNGMNLVGVGISYQYIIRGIILAVAVIFDVKTRNRSK"
FT   gene            complement(648068..648340)
FT                   /gene="ysdA"
FT                   /locus_tag="CLOST_0545"
FT   CDS             complement(648068..648340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ysdA"
FT                   /locus_tag="CLOST_0545"
FT                   /product="putative membrane component"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20671"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20671.1"
FT                   /translation="MNTLSFVLLASSLMSIVGFILMYMDKRRAKKNHWRIKESTLFITS
FT                   ALLGSPGVLLGMYAFRHKTKHSSFVYGVPAILFIQIFALYYFNII"
FT   gene            648477..649172
FT                   /locus_tag="CLOST_0546"
FT   CDS             648477..649172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0546"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20672"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20672.1"
FT                   /translation="MLGTIVNALSIVAGSLIGLFLKGGIPVSMGETISKGLGLCIIYIG
FT                   MSGTMSTQNLLLVIFSLVIGAIIGELIDIDKRFAELGDFVEKKLSKNGESKIAEGFVNA
FT                   SLLFCVGSMAIVGSLQSGLEGNHETLFTKSVLDGITSIIFTSTMGIGVILSAVSVFIYQ
FT                   GAVTLLASSIKVLLTDAIVAEMTAVGSLLILGIGLNMVGATKIKVANILPAVLIPFIYG
FT                   MIMKIGIGM"
FT   gene            649240..651003
FT                   /gene="uvrC"
FT                   /locus_tag="CLOST_0547"
FT   CDS             649240..651003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="CLOST_0547"
FT                   /product="UvrABC system protein C (Protein uvrC)
FT                   (Excinuclease ABC subunit C)"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20673"
FT                   /db_xref="GOA:E3PW58"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20673.1"
FT                   /translation="MKDKDKKVIYVGKAISLKNRVRQYFQSKKNMDAKVRAMVSHIDEF
FT                   EYIVTDSEMEALILENNLIKEYKPQYNILLRDDKTYPYIKVTLNEYFPRVLKVRKVEKD
FT                   KAKYFGPYTNAFIVNETLDVIKEIYPIRTCTRDIKRSIEKKERPCLNLYIKKCVGPCTG
FT                   KVDEAEYMKMIYEIIDFLSGKSEDMISILEEKMRQAAKNLDFEEAATLRDKISSMKGML
FT                   ERQKIVSASTIDQDYIAVAKEEDLSCVQVFFVRGGKVVGRENFIFDKSRNSQAEEIISS
FT                   FIKQFYMSVNYVPKELVVDTDFEDMQIMSDWLSSKKGQKVQITVPQKGDKKHLLDLVRK
FT                   NAFETIKQKSNLKMAKLERTVGVMKELQEFLQLDEMPIRVEAFDISNIQGVDSVGAQVV
FT                   FVNGEKAKKLYRRYKIKSVDGPNDYASMEEIIRRRLKHPDLPDLILMDGGKGQVSVAKK
FT                   VIAEEGLSIPVLGMYKDSRHKTLGLTTENQAVELSKHSLIYRFIASVQEEVHRFAISYH
FT                   RSLRDKGMEKSELDEISGIGKTRKMALISEFKTIERLKNATMEELASVEGMNKKSAQAV
FT                   FEHFRKGQKSD"
FT   gene            650969..651937
FT                   /gene="hprK"
FT                   /locus_tag="CLOST_0548"
FT   CDS             650969..651937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="CLOST_0548"
FT                   /product="HPr kinase/phosphorylase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20674"
FT                   /db_xref="GOA:E3PW59"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20674.1"
FT                   /translation="MNILERGKKVIDKSDTKKVSIRKIIEDLKVGVAYIPDGVDYHIST
FT                   TDINRPGMQLNGYYDHFPNDRIQVMGKVEYSYYLSLDEETKKERMDKYMSYDLPVVIVA
FT                   RAQIPDDIMINAARKYNRIILTTPMGTTKFIYKLLDYLNELLAPETMMHGVLVDVDGMG
FT                   ILITGESGVGKSETALELIKRSHRLVADDAVEIKKIEDDMLVGKSPETIRYFMEIRGLG
FT                   ILDIKSLYGIGAVKPTKIIDLVAHLEPWVEGKYYDRIGLDDEFIEILGVAVEKITIPVK
FT                   PGRNLAVILEIAARNNRLKRMGYNAAQTFNENLMKRLSEEG"
FT   gene            651939..652895
FT                   /gene="glcK"
FT                   /locus_tag="CLOST_0549"
FT   CDS             651939..652895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="CLOST_0549"
FT                   /product="Glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20675"
FT                   /db_xref="GOA:E3PW60"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20675.1"
FT                   /translation="MSRFYIGVDIGGTEVKTALVDENDKAVFAQNIPTESEKGYVHTIN
FT                   MIANQIKGLLDENNVSISMVNSIGIGIPGLTDGKSKIYKAPNISWVDIDISTEMDRHFP
FT                   NTKVFIANDASVAALAEHHFGAIKGAKNAVMITLGTGVGGGVIINDKLYSGTNGIASEI
FT                   GHLIVGENFYNCNCGNNGCLETYCSATAIIKYAQRLFVDSPCSKIIEMTDSKPENITAK
FT                   LIFDAYKEKDLMAKIIVKRFVTYLSIGIINLMNVYDPEVFVIGGGVSKAYDLFIDELEK
FT                   EVDERLTFKNAPRGKIVKAKLGNDAGAIGAAMLGLYI"
FT   gene            652915..653568
FT                   /locus_tag="CLOST_0550"
FT   CDS             652915..653568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0550"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20676"
FT                   /db_xref="InterPro:IPR024264"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20676.1"
FT                   /translation="MSLTDDRQGRVPFEYIREKFSKANPEIMAINTFSKLIDSTIHMDF
FT                   MGRPYAVEHPSGKIFDENNKEVEFYTVRTLFLRFLVNGQGIKPTGKDVTYKDIPGGLVY
FT                   YPNFSKRTIERLAKSYGSDLEKFESDMQSIGAVKVLQGDKAYKFPFMNETYMTFIIWEK
FT                   DEEFPPAANILFDQNIQFYFDAEDLAVVPDVAIDIIKNKGIMPDWIGLYKKKSI"
FT   gene            653590..654543
FT                   /locus_tag="CLOST_0551"
FT   CDS             653590..654543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0551"
FT                   /product="conserved membrane protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20677"
FT                   /db_xref="GOA:E3PW62"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20677.1"
FT                   /translation="MSYLLLVIGFIILIKGADFFVDGASSIAKIAKMPTLLIGLTIVAF
FT                   GTSAPEAAVSINAALKGSNDIAIGNVIGSNIFNLLVAVGISAMIRPIKVQKTTIIKEYP
FT                   LSMYSVALLIILSLDNLFAGNDANLLTRGDGLILLLGFGVFMFYLIEMAVLSKEADDEV
FT                   EEIVKLPLSKSIIFSLLGLIGIVFGGDIVVKSATNIALQLGMSQTLVGLTIVAVGTSLP
FT                   ELVTSVTAARKGESDIAIGNIIGSGLFNIFFVLGISATIHPIAVSSKLIFDFIILAIVT
FT                   VISHVFAYSKKEVDKKEGFALTAMYIAYMVYIIIRN"
FT   gene            654558..655892
FT                   /locus_tag="CLOST_0552"
FT   CDS             654558..655892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0552"
FT                   /product="Poly A polymerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20678"
FT                   /db_xref="GOA:E3PW63"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20678.1"
FT                   /translation="MIDNELIKEALEIINIIEESGYEAYIVGGSLRDSLLGMQPKDIDI
FT                   ASSASPTEIKRIFNSYKTIDTGIDFGTVTLIYNDKPVEITTFRSESVYLDSRRPDSVSF
FT                   EKNVDEDLKRRDFTINAMAYNQSKKLVDLFSGEEDLNNKLIRCVGSPDERFSEDALRML
FT                   RAVRFACVLNFDIEKKTFEAIKHNASRIEYISKERIQAELNKILMSSKPSRGIRLLLDS
FT                   KLLDYILPEISRLSGFNQHNPFHHLELLEHTLCVMDKVEPRLQLRLAALFHDAGKVDTI
FT                   TLDENGIGHFYGHDSVSEEIAKSVLKRLRYSNEIIELTSQLVRYHMIQANVIGKKGIQK
FT                   LLRIFGENNIFELADLHFADSSCTIIEVNEDAFRLKIRQVLDENIPFSVKDLDIDGYDL
FT                   MKIGAKGKQIGDILNELLELVSEDASKNNKNQLMLYAKEIYSNFE"
FT   gene            656113..656976
FT                   /locus_tag="CLOST_0553"
FT   CDS             656113..656976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0553"
FT                   /product="putative phospholipase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20679"
FT                   /db_xref="GOA:E3PW64"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20679.1"
FT                   /translation="MKDIGLVLEGGGMRGIYTAGVLDFFMDKNFYLPYVIGVSAGACQG
FT                   VSYVSRQRGRGKNAILNHIENPRYISKRNLVFKRSIMDMDFLFDEIPNKYELFDYDTFF
FT                   ENEQKCILVGTSCKTGEALYFDAKKDKSKQFVLDTCRASSSLPFVTPIVDVRGEPVLDG
FT                   GIADSIPIKKAIADGNKKNIIVLTRGREYRKKPSNTAFISKKVYKNYPKLQETISSRYR
FT                   VYNETLDYIESLEEQGEVFVIRPRRKVEIDRMERNKSKLADFYKTGYEDAHDIWTDLSD
FT                   WMNKIK"
FT   gene            657074..657868
FT                   /locus_tag="CLOST_0554"
FT   CDS             657074..657868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0554"
FT                   /product="putative Nitroreductase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20680"
FT                   /db_xref="GOA:E3PW65"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20680.1"
FT                   /translation="MNYSNIMEEIKSTRDYKETVVKSELLKEIISAGDTALENHGLDIV
FT                   LFEDGEQTKQKLEGKAGYFGKFIGAPHYIAVLSDDGRKSKEDAAYIMEMMRFKAHKEGL
FT                   GSCWITIPNTDEIKADLGIDIARSLCGFLAIGYRYAGIFKKDIQEKAFRQGAIEITYMD
FT                   EWGNTPAWEDLEARGLDQVFYLTRFAPSWGNKQPWKFLILKNHVVLAVEKDSSTDTDLD
FT                   TGIIKFYFEKACIDKGLSLQTAEESGEFIIPENYEIRVVYNI"
FT   gene            657881..660043
FT                   /gene="pcrA"
FT                   /locus_tag="CLOST_0555"
FT   CDS             657881..660043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="CLOST_0555"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="16.6 : Maintain"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12073041, 12682299, 14594837, 16267290; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20681"
FT                   /db_xref="GOA:E3PW66"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20681.1"
FT                   /translation="MDLTGLNKDQLSAVTRVEGPLLILAGAGSGKTRVITYRIAHMIED
FT                   LKISPYSILAITFTNKAAKEMKERVSALIGDRAKDMWISTFHSLCVRILRRDIERIGYN
FT                   RSFVIYDTQDQLSLIKECIKECGLREDSFKPSSVLSAISGAKDKLLNPKAFEARYFNDF
FT                   RLSKISKVYDLYQRKLKSNNALDFDDLIFKTVELLKTDEFVRDFYQRKFQYVMVDEYQD
FT                   TNHAQYVLINLLSEMHKNLCVVGDDDQSIYGWRGADIANILDFEKDYKDAFVVKLEQNY
FT                   RSTEVILDGANSVIKRNLGRKNKKLWTQLKEGEKIKLHKAYDEKDEANFIAREIKKRQE
FT                   EEDRNLRDFALLYRTNAQSRALEEALIKQSISYKIFGSLKFYDRKEIKDIMAYLRLVQN
FT                   PLDDLALKRIINVPKRGIGAKTLEKLEERALVTGESLFGLLHDLSGFDLSTKVKTTLNK
FT                   FVMMINSFMDMKEILPLTEFVQKVIDNTKYVDELKAEETDEANGRIENIEEFKSVVMEF
FT                   MQNSEEKTLEEFLSSVSLVSDLDSIDEEDDFVTLMTLHSAKGLEFPVVFLAGVEEGIFP
FT                   ISRAMLDENQLEEERRLCYVGMTRAKQILYITYANERTLYGRRNHAIASRFISEIDESL
FT                   FEENAKIEKTKPQSLYDRYKDKYKIGQDDKPKFDGQDDITVGSKIKHPKFGIGMVVAKT
FT                   GTVYTIAFEGQGIKQIDTTFISLSKL"
FT   gene            660075..661355
FT                   /gene="apeB"
FT                   /locus_tag="CLOST_0556"
FT   CDS             660075..661355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apeB"
FT                   /locus_tag="CLOST_0556"
FT                   /product="putative M18 family aminopeptidase 2"
FT                   /EC_number="3.4.11.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20682"
FT                   /db_xref="GOA:E3PW67"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20682.1"
FT                   /translation="MEKKAVALDMMKFLDASKTPYHAVKISVEKLKEAGFKRLNLNKKF
FT                   EVKEGKGYYIEYGTALIAFRVHTKTDGYQIIGSHTDSPAMMIKPKAVIKDNGYVKLNTE
FT                   IYGGPILNTWMDRPLSLGGRVLLRSGKSMEPTEVLIDFEKPVAIIPNLAIHLNRDVNKG
FT                   IELNKQKDMLPLVSLSGDFIGEDHLIHKIAEYLSIEKQGILDYELYVYDPQPSSFVGFN
FT                   DEFISAPRIDNLSMLHASLKALIEAEKGTGIKMVVSFDNEEVGSMSRLGADSTILADAL
FT                   ERIDLALGLNKEEHMINIDKSFMISADMAHAVHPNSPEKHDPTNRPKLNAGPVIKLSAN
FT                   KRYTTDGYSSAVFKNLCEEASAPYQTFVNPSDQVGGSTIGPISSSHLSIKSIDIGNPML
FT                   SMHSIRELCGSDDQYYLTKIFYKFFTV"
FT   gene            661358..661990
FT                   /locus_tag="CLOST_0557"
FT   CDS             661358..661990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0557"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20683"
FT                   /db_xref="GOA:E3PW68"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20683.1"
FT                   /translation="MNYEHIWDVIYRLSGRVRVSKSLINRNEEILLHISDTPYSIFSAL
FT                   DSLIMTLKPEYIVHTGDLVDNIKLELYPKSLPRYKLYLKNLMKIMQKPFVKGIYISLGN
FT                   HDDIEAISEYKKIDNRITLGIEPNSIKLGGKTIQYAHYLEALKDTPNSYGLYGHDLSVK
FT                   DEISENSIYLNGIKTINIIMLKSGTIYKLQYPIGTDDARLKKGRIGF"
FT   gene            662024..663034
FT                   /locus_tag="CLOST_0558"
FT   CDS             662024..663034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0558"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20684"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20684.1"
FT                   /translation="MFSFFRNGVNFIVWASDDISMLRDNILEISKGQELSLEEAFDSSG
FT                   EDDTIVILTKEMADKVSSENLEKVIIANISSEDLLSRFISQENPPQNTKVRSAPSIIVM
FT                   RYFGDVEKIISEIEHDYDCREGTFVDLLEQGNDKGVILSFTDRSLKSDVFIRSLYKKAL
FT                   YIKLPYETFMADMRMHALRYINEGIGKKDWYELEIRIYDRYQAYSLQYDRLIEILEELE
FT                   LGLVLGEAWSKDYPRMFMPVGVYRIRFFTFNPPKDIKKVLLGFEYTSDGTRIVDMDLYQ
FT                   GKTKINWTDTLEKELPRIRFKMAEVFRQRSISQMREDVVDNINKLDEMILNTRVE"
FT   gene            663135..664382
FT                   /locus_tag="CLOST_0559"
FT   CDS             663135..664382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0559"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20685"
FT                   /db_xref="GOA:E3PW70"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20685.1"
FT                   /translation="MDQNNGRLEILTFGSFDILIDGESLLTQFGKSQKALSLLKYFISN
FT                   RGKKIPVNRIIEANFKLYDYTDYNNALRSQVHRLRKIIKDINSKLESEVMRLDFVAGNY
FT                   VFNLEKDYILDVELFEDYVCRFSLKPLELEADFERLSELRTALKLYRGDYIEGTEFYDW
FT                   IFPLRIHYKRQYLMLFSQYIGYLVKKDRYDEVISECESALSINFFDEVIHEYLLEALFK
FT                   SNKANQALNHYNYVTSRFYTEMNMKPSEKMKEIYQKVQKRENSEYGTDLFTLERTIRLA
FT                   EQSDGVFFCDKDFFINLYRLELRKKERDIGKTMVGIVTVSAYDLREISEEESVKIVEDI
FT                   GPVVDKYMRKYDVITKLNKNQFAFMMFNSSEEMIKRINQRMNFLLNQVKKKHRILFTLS
FT                   CKSIQATDENYNETAF"
FT   gene            664604..667225
FT                   /locus_tag="CLOST_0560"
FT   CDS             664604..667225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0560"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20686"
FT                   /db_xref="GOA:E3PW71"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20686.1"
FT                   /translation="MKKIKLWQIIILIFALTFVNIHPALIYASQLEVDTQDVSSEAIED
FT                   EADIQSEDAPQAEVSDEEQSIESQEGEGEQNPDEQVEGEDESAPLGEPQAEDDIENPDG
FT                   DVENPDGNVENPDGEEVIEDEETPQGPVDGEIPPSEGEPVDGELPPVDEQVDPNAPSIE
FT                   EPVDPNAPPVDPNAPPVDPVVDPTVPVIGGGGVIIPPIIAIPGEEIIVTKTADKDQVNP
FT                   GETINYTIEVTNNSGGDLTGITVEDPMINLIETFDLLTGETKVFTGSFEVKKPEPIMVA
FT                   GEEIITAPEEPPVITNTVRVYGTGPVGEINKTATVVVNGVLEEVLEVMSEEFIEDPGEI
FT                   YLDLSEFDSQPMMRSFQMMTVNPYENDHLSIDKTATTLDLEERMYQVDFEITGTPPEKP
FT                   VDVILVIDTSGSMGTRIPGDSKAPLYYAKLAAINFANSIIDENPDSRVGVIEFSGGYYG
FT                   YASDASTVINLTNNKANLASSINGLTTHNMTNIQAGFRLAYNKISAISSTRDSVKSVVF
FT                   LTDGVANVSIGNWSSSNPVVHNTHTIAAYTEGQSLYSYINGNLFTIGLFGAISNSSVKS
FT                   IARDTLQKAVYDDLEKYYEASSAVDLGPVYETISQKLEYAATNAGVVDFMSIPVNDHFE
FT                   VITSSITASKGTALYNPTTKKIEWDIGDIREETVTMSYQIKVIDDMWPTTAWSSNWSSL
FT                   DTVGPFGYQNEPDSGLNPVYTNSSATLSYKNPDNENSTMDFPMPKVPVPPVLRLNIIKA
FT                   INGAGLAKEFEINISGNLLNQTTMNFNHFTYGGTHKFWGLKQGMYTATENYLPYNYEKV
FT                   SISAPVTISYDNPEDTITVTNKPKTTGWFYGDDEQKNYFHVGGVIVADMNFDSKKIEIA
FT                   KA"
FT   gene            667236..667808
FT                   /gene="sipW"
FT                   /locus_tag="CLOST_0561"
FT   CDS             667236..667808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sipW"
FT                   /locus_tag="CLOST_0561"
FT                   /product="type I signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20687"
FT                   /db_xref="GOA:E3PW72"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20687.1"
FT                   /translation="MGMLKKITSILFNSIFIIVTVVSLVFVYTMLQNAGRIPDIMGYRL
FT                   YVVQSGSMEPDIHTGSLVISKRVSPENLAIGDVVTFKSKDDSTTLVTHRIEQISKENGE
FT                   LSFITKGDANDVIDLEPVKPENIIARVQYDIPYLGYMTDFIKTKQGMLLVVIIPALALL
FT                   LIEIFKLIGYASELDKQKKAQNHEIKF"
FT   gene            667897..668556
FT                   /locus_tag="CLOST_0562"
FT   CDS             667897..668556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0562"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20688"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20688.1"
FT                   /translation="MLQRKMLMSIASVLVLVALIAGATMAWFTDSETVAATFTAGTVDV
FT                   GINDPTDIEIINPGDIIKFGELEDEGYYHNAPIERGMPQGGYDRVLQIDYTGTKAAYVR
FT                   VLVDFDWAGDLDNSNLSVNAPTGGNWIYDGVDTQTGKHIFRLNGILNGSAEDLGGFALA
FT                   NVKNVPFELVINGASTGNQYQGVALNMNFEVQAVQAANVDPNAIPFESVVQPVPTP"
FT   gene            668648..669202
FT                   /locus_tag="CLOST_0563"
FT   CDS             668648..669202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0563"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20689"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20689.1"
FT                   /translation="MKRKWMIPLLTGIFAASLIIGITTAYFSDSAAVSPDITAGTVVID
FT                   LSENFNPPTNWQAGETTPKEILIKNTGNKRAYVRVRVAGVWQKDEADTALDINNVQVIN
FT                   NSSDWVLSEGYYYYKHVLNAGATTSPLDLSVKLISKDERYDGHTFMLKAYSQAVQATNG
FT                   AYMDVWGLSSLPPEVEILSLP"
FT   gene            669241..670110
FT                   /locus_tag="CLOST_0564"
FT   CDS             669241..670110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0564"
FT                   /product="exported protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20690"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20690.1"
FT                   /translation="MYKRIAIGISSIALSLALIVSGLILQSPSIAFAQNVIVDSDSEGL
FT                   VVIPLGGKFFELSTMGPGDMPDDLKTVDEDALKGLITVTNSYTEPYEVFLSAKRTSPIP
FT                   EGADLYDMLMLEVKFRGGTLNEKTELMKGFATSEISLGTFAPGDTQNIELGVSLPGEEV
FT                   GNEYQGTSVDVLWTFRAVVPEPGPGPGPGPGPDDDDDDEDEPEDVPEEPVPLAVVEPVP
FT                   EEIIPEEIVPLAVPEVEEAIEEEPVPLAIPKLPRTGGMAPIFFYSAGAVLLGAGVVILR
FT                   RKDDDDEK"
FT   gene            670227..670796
FT                   /locus_tag="CLOST_0565"
FT   CDS             670227..670796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0565"
FT                   /product="Metal dependent phophohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20691"
FT                   /db_xref="GOA:E3PW76"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20691.1"
FT                   /translation="MSVIPTRTQAWELLNEYNQTEYLIKHALEVEGVMRYFANLLGEED
FT                   IDRWALVGLLHDLDYEKYPDEHCIKVQEILRERDVDESIIKSIVSHGYGLVADIKPEHQ
FT                   MEKVLFCIDELCGLIHAAAIMRPSKSVMDMEVKSVRKKFKSPSFAAGVSREVIQQGLDM
FT                   LGWELDYAIEHTILGMREVAEEIGLK"
FT   gene            671076..672590
FT                   /locus_tag="CLOST_0566"
FT   CDS             671076..672590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0566"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20692"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20692.1"
FT                   /translation="MGIEDILKFAVPGVGILLLIIIIVVGYVKASPDEAVIISGVKRTP
FT                   RIIRGRASVMIPFFERKDRLTLKVIKIDVKTKESVPTQEFINVNVDAVVTVKISSDEDL
FT                   LPIAAQNFLNKDEAYIQAIVGEVLEGNVREIVGTMTLENMISNRQEFALKVQQNAVPDM
FT                   QKMGIEIVSFNVQNFSDKSGIIEDLGIDNTMKIKKVAAISKADAERDIQIAQSRADKES
FT                   NDARIDAEREIAVRNNELAMRKADLKKAEDTKKAEADAAYEIQKEEQRKTIEITTANAN
FT                   LARQEKEIVIKERDVQIKERTLEAEIKKKAEADKFARQQQAEAELFERQKKAEADKFEE
FT                   IAKAEALKAKAEAERIAKEEEAMGVRAFMLAEAEGIRAKALAEAEGIEKKAIAMEKMKE
FT                   AAILEMYFNVLPDIAKNVAEPLTNIDKITMYGEGNSAKMVKDIINSTTQISEGLTEGLG
FT                   IDMKALISGIVGGKMVMNHEKAEPKEINEVKNIIETNKTDNITPTE"
FT   gene            complement(672739..674964)
FT                   /gene="zntA"
FT                   /locus_tag="CLOST_0567"
FT   CDS             complement(672739..674964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="CLOST_0567"
FT                   /product="zinc, cobalt and lead efflux system"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="3.6.3.3"
FT                   /EC_number="3.6.3.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10660539, 12746428, 21305696, 9364914, 9405611, 98070750,
FT                   99428388; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20693"
FT                   /db_xref="GOA:E3PW78"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20693.1"
FT                   /translation="MIMMELTLYINGMMCANCSQKLEEKASKLAEIEEIHVNYASAKIN
FT                   VKFKKDSDKNTVFEKLNKLCTQIEPKAYLTDKEPMSLGLASSVPVNKKENDSCDCDGHN
FT                   HSHDEDHSHGHSHSHGHADINVSHSLADHKKETLIIGITIAIYAFGIMYKGSDMIKLAI
FT                   FIIAYIIIGKDVLLSAFKNILRGEVFDENFLMSIATLGAFAIGEYPEAVAVMLFYNVGE
FT                   LFQDMAVNRSRKSIKALMNIKPDYANLKVDNNFEIVKPEAVNIGDIILVKPGEKVPLDG
FT                   TLLSESTQMDTSNLTGESVPRIVNKGDTVLSGFINKTHAIEMKVEKTFGESTVNKILEL
FT                   VENASAKKAPTEKFITKFSRYYTPAVVFFALALAIIPPFFTGFNFSEWLYRALIFLVVS
FT                   CPCALVVSIPLGFFGGIGAASKHGILIKGGNYLEALKNAEIAVFDKTGTLTEGIFKVQE
FT                   ITPMHGMNDNELLELAAYAESHSSHPIGVSILKAYNTPIDYDRIQSYENLPGYGVRAVI
FT                   DGKKVLAGNEKLMQEEKIDYINDKFGTIVHLSVDGIYAGSISIYDKIKEDSKLAMQKLK
FT                   SVGIHSIAMLTGDNEKTALDIAEKIGIDNVKYDLLPDQKVAAFEELMKMASPKGKVIFT
FT                   GDGINDAPVLARADIGIAMGSLGSDAAIESADVVIMTDEPSKIAEAIKIAKFTNKVVWQ
FT                   NIYFSLGIKGLVLILGAFGMANMWEAVFADVGVAVIAVLNATRISKI"
FT   gene            complement(674961..675320)
FT                   /locus_tag="CLOST_0568"
FT   CDS             complement(674961..675320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0568"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20694"
FT                   /db_xref="GOA:E3PW79"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20694.1"
FT                   /translation="MAKDAPKCSCDTIHEDTVNDIKSKMPKDENLYDLAEFFKVFGDTT
FT                   RIKIIYVLFQSELCVCDIAALLGMTQSAISHQLRVLKQARLVKYRKDGKVVYYSLDDEH
FT                   VQTIFNMGYAHILER"
FT   gene            675505..676026
FT                   /gene="ppiB"
FT                   /locus_tag="CLOST_0569"
FT   CDS             675505..676026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="CLOST_0569"
FT                   /product="peptidyl-prolyl cis-trans isomerase B (rotamase
FT                   B)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number="5.2.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1606970, 1864365, 8601841, 90272647, 91175755, 9298646,
FT                   9600841; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20695"
FT                   /db_xref="GOA:E3PW80"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20695.1"
FT                   /translation="MSQNPIVTMKIEDRGEVKIELYPHIAPNTVNNFISLVKKGFYDGL
FT                   IFHRVIQGFMIQGGDPKGNGTGGPGYGIKGEFSKNGHVNNLSHEPGVISMARSAHPDSA
FT                   GSQFFLMTSVSPHLDGSYAGFGRVVEGMDIVEALEKVKTNFSDKPLEDILIESVTVDTF
FT                   GVEYPEPITQ"
FT   gene            complement(676783..679266)
FT                   /locus_tag="CLOST_0570"
FT   CDS             complement(676783..679266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0570"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20696"
FT                   /db_xref="GOA:E3PW81"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20696.1"
FT                   /translation="MKKILIVGGVAGGATTAARLRRLDEESQIVMFERGEYISFANCGL
FT                   PYYIGEIIPQRDALLVQTVDGMSERFNMDIRNLSEVTAINREKKTVTVKNLKLGTTYEE
FT                   RYDVLVLSPGANPIKPPIKGLDEADNVFTLRNIPDTDAIKAHVDNKKPKSAVVIGGGFI
FT                   GVEMAENLVHRGIKVTLVEMADQIMAPFDSEMVSILHKHVTDMGVELILSDGVSYFDQK
FT                   GTKIGLNSGKVLDTELTILSIGVRPENELAKSSGLELGERGHIKVDQNMMTSDPNIYAI
FT                   GDAIETIDYIYNEPAMVPLAWPANKQGRIVADRICGIDSKYPGTLGTSIAKVFDLTAAS
FT                   TGHNEKALARLGKTNYKTIHIHPGSHAGYYPGAFPISLKLIFEVPSGKILGAQGIGYDG
FT                   VDKRIDVIATAIKGNLTVRDITNLELAYAPPYSSAKDPVNMAGYVASNILDGLVDVVYY
FT                   NEIDKLIADGGLLIDVREPMEREMGFIEGSINIPLHEIRERLDEIPKDKELYVSCQVGL
FT                   RGYLAARILKQHGYNVKNLDGGYKTYSDVYGAPEAAGCAYVDDAGEMHIADHNIDSFTG
FT                   STSPDLTVDARGLQCPGPIAQVYAAVSTMENGQMLEVLATDPGFSKDISAWCKKTGNTL
FT                   ISSEFDKTHFRTLLRKGTDTPRVAPALGATNAPVVKEKNGATMVVFSGDLDKAMASFII
FT                   ATGAASMGKEVTMFFTFWGLNVLRKPGVKVEKDALENMFSKMMPEGAKKLKLSNMNMGG
FT                   MGSKMINYVMKKKNVDDVETLIANAQKMGVKLVACAMSMDIMGIKQEELIDGVEIAGVA
FT                   SYLAETEDSGLNLFI"
FT   gene            complement(679376..679660)
FT                   /locus_tag="CLOST_0571"
FT   CDS             complement(679376..679660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0571"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20697"
FT                   /db_xref="GOA:E3PW82"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20697.1"
FT                   /translation="MNNFDMDFKQLEETSELLKALAHPVRLCIVRGLIGNGPCNVSNMH
FT                   SCLNLPQSTVSQHVSKLKSAGIIKGERKGTEIIYEISDSRIKKLVECIF"
FT   gene            679967..680995
FT                   /gene="ltaE"
FT                   /locus_tag="CLOST_0572"
FT   CDS             679967..680995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="CLOST_0572"
FT                   /product="L-allo-threonine aldolase, PLP-dependent"
FT                   /function="1.5 : Serine family"
FT                   /EC_number="4.1.2.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 98355671; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBH20698"
FT                   /db_xref="GOA:E3PW83"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:E3PW83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBH20698.1"
FT                   /translation="MKYIDLRSDTVTEPTQRMREAMMDAIVGDDVYEDDPTMKELEEYA
FT                   ANLVGKEAALFVPSGTFANQLAIFTWCNRGDEVILPHDCHVVMHEVGAASVIAGVQLRS
FT                   MPAINGQMNPQMVKEAIREDDIHYPETGLICMENAYSDGTVLPLEHMQEIYAIAKAHDI
FT                   PVHLDGARVFNAATALKVDAKDILRYTDSVMFCLSKGLCAPVGSILAGSKEFIAKARKK
FT                   RKLLGGGMRQVGMLGAAGLIALKEMRLRLIEDHDNAKYLAEELDKIQGIEVIKDALDIN
FT                   MVFFKITDERLEAQLTEENFFKNGIKINPAEGGLMRFVCHYYINKSDIDKVLGVINEMR
FT                   RY"
FT   gene            681017..681916
FT                   /locus_tag="CLOST_0573"
FT   CDS             681017..681916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLOST_0573"
FT                   /product="putative lipid kinase"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:CLOST_0573"
FT