spacer

EBI Dbfetch

ID   FN995096; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FN995096;
XX
DT   24-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*30:04new, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Tran H.;
RT   ;
RL   Submitted (23-JUN-2010) to the INSDC.
RL   Tran H., University of Heidelberg, Transplantation Immunology, Im
RL   Neuenheimer Feld 305, Heidelberg D-69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01667.x.
RX   PUBMED; 21447147.
RA   Heyder J., Heinold A., Kudlek E., Opelz G., Tran T.H.;
RT   "Characterization of three new alleles HLA-A*02:241, HLA-A*02:242 and
RT   HLA-A*30:04:02";
RL   Tissue Antigens 78(2):152-153(2011).
XX
RN   [3]
RP   1-1022
RA   Tran H.;
RT   ;
RL   Submitted (29-JUL-2010) to the INSDC.
RL   Tran H., University of Heidelberg, Transplantation Immunology, Im
RL   Neuenheimer Feld 305, Heidelberg D-69120, GERMANY.
XX
DR   MD5; 8e45f1e49c9b06e9212ac5af9d76826e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Turkey"
FT                   /isolation_source="peripheral blood"
FT                   /sex="male"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30:04new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D8MIW0"
FT                   /db_xref="IMGT/HLA:A*30:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D8MIW0"
FT                   /protein_id="CBN86245.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQTDRENLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30:04new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30:04new"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*30:04new"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 173 A; 248 C; 280 G; 121 T; 200 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagagaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtatga acagcacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc ccccaagaca catatgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggagagga       960
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer