spacer

EBI Dbfetch

ID   FN985097; SV 1; linear; genomic DNA; STD; HUM; 3148 BP.
XX
AC   FN985097;
XX
DT   19-JUN-2010 (Rel. 105, Created)
DT   19-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*02:07variant
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3148
RA   Qu J.;
RT   ;
RL   Submitted (18-JUN-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Full length of HLA-A novel allele A*02:07variant";
RL   Unpublished.
XX
DR   MD5; 5e00ac7ffc401cd5f866e17cd6b7d76b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3148
FT                   /organism="Homo sapiens"
FT                   /isolate="D09018126"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(52..124,255..524,766..1041,1642..1917,2017..2133,
FT                   2572..2604,2747..2794,2964..2968)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GNM8"
FT                   /db_xref="IMGT/HLA:A*02:265"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GNM8"
FT                   /protein_id="CBN72525.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMCGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITRTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            52..124
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=1
FT   intron          125..254
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=1
FT   exon            255..524
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=2
FT   intron          525..765
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=2
FT   exon            766..1041
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=3
FT   intron          1042..1641
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=3
FT   exon            1642..1917
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=4
FT   intron          1918..2016
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=4
FT   exon            2017..2133
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=5
FT   intron          2134..2571
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=5
FT   exon            2572..2604
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=6
FT   intron          2605..2746
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=6
FT   exon            2747..2794
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=7
FT   intron          2795..2963
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=7
FT   exon            2964..2968
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:07variant"
FT                   /number=8
XX
SQ   Sequence 3148 BP; 613 A; 901 C; 969 G; 665 T; 0 other;
     ctaaagtccg cacgcaccca ccgggactca gattctcccc agacgccgag gatggccgtc        60
     atggcgcccc gaaccctcgt cctgctactc tcgggggctc tggccctgac ccagacctgg       120
     gcgggtgagt gcggggtcgg gagggaaacg gcctctgtgg ggagaagcaa cgggcccgcc       180
     tggcgggggc gcaggacccg ggaagccgcg ccgggaggag ggtcgggcgg gtctcagcca       240
     ctcctcgtcc ccaggctctc actccatgag gtatttcttc acatccgtgt cccggcccgg       300
     ccgcggggag ccccgcttca tcgcagtggg ctacgtggac gacacgcagt tcgtgcggtt       360
     cgacagcgac gccgcgagcc agaggatgga gccgcgggcg ccgtggatag agcaggaggg       420
     tccggagtat tgggacgggg agacacggaa agtgaaggcc cactcacaga ctcaccgagt       480
     ggacctgggg accctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccggcc       540
     cggggcgcag gtcacgacct ctcatccccc acggacgggc caggtcgccc acagtctccg       600
     ggtccgagat ccgccccgaa gccgcgggac cccgagaccc ttgccccggg agaggcccag       660
     gcgcctttac ccggtttcat tttcagttta ggccaaaaat ccccccaggt tggtcggggc       720
     ggggcggggc tcgggggacc gggctgaccg cggggtccgg gccaggttct cacaccgtcc       780
     agaggatgtg tggctgcgac gtggggtcgg actggcgctt cctccgcggg taccaccagt       840
     acgcctacga cggcaaggat tacatcgccc tgaaagagga cctgcgctct tggaccgcgg       900
     cggacatggc agctcagacc accaagcaca agtgggaggc ggcccatgtg gcggagcagt       960
     tgagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga      1020
     aggagacgct gcagcgcacg ggtaccaggg gccacggggc gcctccctga tcgcctgtag      1080
     atctcccggg ctggcctccc acaaggaggg gagacaattg ggaccaacac tagaatatcg      1140
     ccctccctct ggtcctgagg gagaggaatc ctcctgggtt tccagatcct gtaccagaga      1200
     gtgactctga ggttccgccc tgctctctga cacaattaag ggataaaatc tctgaaggaa      1260
     tgacgggaag acgatccctc gaatactgat gagtggttcc ctttgacaca cacaggcagc      1320
     agccttgggc ccgtgacttt tcctctcagg ccttgttctc tgcttcacac tcaatgtgtg      1380
     tgggggtctg agtccagcac ttctgagtcc ttcagcctcc actcaggtca ggaccagaag      1440
     tcgctgttcc ctcttcaggg actagaattt tccacggaat aggagattat cccaggtgcc      1500
     tgtgtccagg ctggtgtctg ggttctgtgc tcccttcccc atcccaggtg tcctgtccat      1560
     tctcaagata gccacatgtg tgctggagga gtgtcccatg acagatgcaa aatgcctgaa      1620
     tgatctgact cttcctgaca gacgccccca aaacgcatat gactcaccac gctgtctctg      1680
     accatgaagc caccctgagg tgctgggccc tgagcttcta ccctgcggag atcacacgga      1740
     cctggcagcg ggatggggag gaccagaccc aggacacgga gctcgtggag accaggcctg      1800
     caggggatgg aaccttccag aagtgggcgg ctgtggtggt gccttctgga caggagcaga      1860
     gatacacctg ccatgtgcag catgagggtt tgcccaagcc cctcaccctg agatggggta      1920
     aggagggaga cgggggtgtc atgtctttta gggaaagcag gagcctctct gacctttagc      1980
     agggtcaggg cccctcacct tcccctcttt tcccagagcc gtcttcccag cccaccatcc      2040
     ccatcgtggg catcattgct ggcctggttc tctttggagc tgtgatcact ggagctgtgg      2100
     tcgctgctgt gatgtggagg aggaagagct caggtgggga aggggtgaag ggtgggtctg      2160
     agatttcttg tctcactgag ggttccaaga cccaggtaga agtgtgccct gcctcgttac      2220
     tgggaagcac cacccacaat tatgggccta cccagcctgg gccctgtgtg ccagcactta      2280
     ctcttttgta aagcacctgt taaaatgaag gacagattta tcaccttgat tacagcggtg      2340
     atgggacctg atcccagcag tcacaagtca caggggaagg tccctgagga ccttcaggag      2400
     ggcggttggt ccaggaccca cacctgcttt cttcatgttt cctgatcccg ccctgggtct      2460
     gcagtcacac atttctggaa acttctctga ggtccaagac ttggaggttc ctctaggacc      2520
     ttaaggccct gactcctttc tggtatctca caggacattt tcttcccaca gatagaaaag      2580
     gagggagcta ctctcaggct gcaagtaagt atgaaggagg ctgatgcctg aggtccttgg      2640
     gatattgtgt ttgggagccc atgggggagc tcacccaccc cacaattcct cctctagcca      2700
     catcttctgt gggatctgac caggttctgt ttttgttcta ccccaggcag tgacagtgcc      2760
     cagggctctg atgtgtctct cacagcttgt aaaggtgaga gcctggaggg cctgatgtgt      2820
     gttgggtgtt gggcggaaca gtggacacag ctgtgctatg gggtttcttt ccattggatg      2880
     tattgagcat gcgatgggct gtttaaagtg tgacccctca ctgtgacaga tacgaatttg      2940
     ttcatgaata tttttttcta tagtgtgaga cagctgcctt gtgtgggact gagaggcaag      3000
     agttgttcct gcccttccct ttgtgacttg aagaaccctg actttgtttc tgcaaaggca      3060
     cctgcatgtg tctgtgttcg tgtaggcata atgtgaggag gtggggagac caccccaccc      3120
     ccatgtccac catgaccctc ttcccacg                                         3148
//


spacer
spacer