spacer

EBI Dbfetch

ID   FN908397; SV 1; linear; genomic DNA; STD; HUM; 2978 BP.
XX
AC   FN908397;
XX
DT   11-JUN-2010 (Rel. 105, Created)
DT   25-JUL-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*206variant
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2978
RA   Qu J.;
RT   ;
RL   Submitted (11-JUN-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RX   DOI; 10.3109/13693786.2010.549155.
RX   PUBMED; 21208025.
RA   Hageskal G., Kristensen R., Fristad R.F., Skaar I.;
RT   "Emerging pathogen Aspergillus calidoustus colonizes water distribution
RT   systems";
RL   Med. Mycol. 49(6):588-593(2011).
XX
DR   MD5; fcedee868a44319f80c453cf7b833abc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2978
FT                   /organism="Homo sapiens"
FT                   /isolate="LHLAD000466/467"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(10..82,203..472,724..999,1600..1875,1975..2091,
FT                   2530..2562,2705..2752,2922..2926)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GN81"
FT                   /db_xref="IMGT/HLA:A*02:259"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GN81"
FT                   /protein_id="CBM43070.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAVVPRLSLHEVFLHLRVPARPR
FT                   GAPLHRSGLRGRHAVRAVRQRRREPEDGAAGAVDRAGGSGVLGRGDTESEGPLTDSPSG
FT                   PGDPARLLQPGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADTA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <10..82
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=1
FT   intron          83..202
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=2
FT   intron          473..723
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=2
FT   exon            724..999
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=3
FT   intron          1000..1599
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=3
FT   exon            1600..1875
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=4
FT   intron          1876..1974
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=4
FT   exon            1975..2091
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=5
FT   intron          2092..2529
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=5
FT   exon            2530..2562
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=6
FT   intron          2563..2704
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=6
FT   exon            2705..2752
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=7
FT   intron          2753..2921
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=7
FT   exon            2922..>2926
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0206variant"
FT                   /number=8
XX
SQ   Sequence 2978 BP; 578 A; 848 C; 927 G; 625 T; 0 other;
     acgccgagga tggccgtcat ggcgccccga accctcgtcc tgctactctc gggggctctg        60
     gccctgaccc agacctgggc gggtgagtgc ggggtcggga gggaaacggc ctctgtgggg       120
     agaagcaacg ggcccgcctg gcgggggcgc aggacccggg aagccgcgcc gggaggaggg       180
     tcgggcgggt ctcagccact cctcgtcccc aggctctcac tccatgaggt atttctacac       240
     ctccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga       300
     cacgcagttc gtgcggttcg acagcgacgc cgcgagccag aggatggagc cgcgggcgcc       360
     gtggatagag caggagggtc cggagtattg ggacggggag acacggaaag tgaaggccca       420
     ctcacagact caccgagtgg acctggggac cctgcgcggc tactacaacc agagcgaggc       480
     cggtgagtga ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggcca       540
     ggtcgcccac agtctccggg tccgagatcc gccccgaagc cgcgggaccc cgagaccctt       600
     gccccgggag aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc       660
     ccccaggttg gtcggggcgg ggcggggctc gggggaccgg gctgaccgcg gggtccgggc       720
     caggttctca caccgtccag aggatgtatg gctgcgacgt ggggtcggac tggcgcttcc       780
     tccgcgggta ccaccagtac gcctacgacg gcaaggatta catcgccctg aaagaggacc       840
     tgcgctcttg gaccgcggcg gacacggcag ctcagaccac caagcacaag tgggaggcgg       900
     cccatgtggc ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca       960
     gatacctgga gaacgggaag gagacgctgc agcgcacggg taccaggggc cacggggcgc      1020
     ctccctgatc gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg      1080
     accaacacta gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc      1140
     cagatcctgt accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg      1200
     ataaaatctc tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct      1260
     ttgacacaca caggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg      1320
     cttcacactc aatgtgtgtg ggggtctgag tccagcactt ctgagtcctt cagcctccac      1380
     tcaggtcagg accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag      1440
     gagattatcc caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat      1500
     cccaggtgtc ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac      1560
     agatgcaaaa tgcctgaatg atctgactct tcctgacaga cgcccccaaa acgcatatga      1620
     ctcaccacgc tgtctctgac catgaagcca ccctgaggtg ctgggccctg agcttctacc      1680
     ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc      1740
     tcgtggagac caggcctgca ggggatggaa ccttccagaa gtgggcggct gtggtggtgc      1800
     cttctggaca ggagcagaga tacacctgcc atgtgcagca tgagggtttg cccaagcccc      1860
     tcaccctgag atggggtaag gagggagacg ggggtgtcat gtcttttagg gaaagcagga      1920
     gcctctctga cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt      1980
     cttcccagcc caccatcccc atcgtgggca tcattgctgg cctggttctc tttggagctg      2040
     tgatcactgg agctgtggtc gctgctgtga tgtggaggag gaagagctca ggtggggaag      2100
     gggtgaaggg tgggtctgag atttcttgtc tcactgaggg ttccaagacc caggtagaag      2160
     tgtgccctgc ctcgttactg ggaagcacca cccacaatta tgggcctacc cagcctgggc      2220
     cctgtgtgcc agcacttact cttttgtaaa gcacctgtta aaatgaagga cagatttatc      2280
     accttgatta cagcggtgat gggacctgat cccagcagtc acaagtcaca ggggaaggtc      2340
     cctgaggacc ttcaggaggg cggttggtcc aggacccaca cctgctttct tcatgtttcc      2400
     tgatcccgcc ctgggtctgc agtcacacat ttctggaaac ttctctgagg tccaagactt      2460
     ggaggttcct ctaggacctt aaggccctga ctcctttctg gtatctcaca ggacattttc      2520
     ttcccacaga tagaaaagga gggagctact ctcaggctgc aagtaagtat gaaggaggct      2580
     gatgcctgag gtccttggga tattgtgttt gggagcccat gggggagctc acccacccca      2640
     caattcctcc tctagccaca tcttctgtgg gatctgacca ggttctgttt ttgttctacc      2700
     ccaggcagtg acagtgccca gggctctgat gtgtctctca cagcttgtaa aggtgagagc      2760
     ctggagggcc tgatgtgtgt tgggtgttgg gcggaacagt ggacacagct gtgctatggg      2820
     gtttctttcc attggatgta ttgagcatgc gatgggctgt ttaaagtgtg acccctcact      2880
     gtgacagata cgaatttgtt catgaatatt tttttctata gtgtgagaca gctgccttgt      2940
     gtgggactga gaggcaagag ttgttcctgc ccttccct                              2978
//


spacer
spacer