Dbfetch

ID   FN908396; SV 2; linear; genomic DNA; STD; HUM; 3002 BP.
XX
AC   FN908396;
XX
DT   11-JUN-2010 (Rel. 105, Created)
DT   25-JUL-2013 (Rel. 117, Last updated, Version 3)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*203variant
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Qu J.;
RT   ;
RL   Submitted (11-JUN-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RX   DOI; 10.3109/13693786.2010.549155.
RX   PUBMED; 21208025.
RA   Hageskal G., Kristensen R., Fristad R.F., Skaar I.;
RT   "Emerging pathogen Aspergillus calidoustus colonizes water distribution
RT   systems";
RL   Med. Mycol. 49(6):588-593(2011).
XX
RN   [3]
RP   1-3002
RA   Qu J.;
RT   ;
RL   Submitted (14-JUN-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
DR   MD5; 6cc807b0948af0b655ad0265629b7906.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3002
FT                   /organism="Homo sapiens"
FT                   /isolate="LHLAD000423-424"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(28..100,221..490,742..1017,1618..1893,1993..2109,
FT                   2548..2580,2723..2770,2940..2944)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GN80"
FT                   /db_xref="IMGT/HLA:A*02:264"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GN80"
FT                   /protein_id="CBM43069.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAVVPRLSLHEVFLHIRVPARPR
FT                   GAPLHRSGLRGRHAVRAVRQRRREPEDGAAGAVDRAGGSGVLGRGDTESEGPLTDSPSG
FT                   PGDPARLLQPGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVPDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <28..100
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=1
FT   intron          101..220
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=1
FT   exon            221..490
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=2
FT   intron          491..741
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=2
FT   exon            742..1017
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=3
FT   intron          1018..1617
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=3
FT   exon            1618..1893
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=4
FT   intron          1894..1992
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=4
FT   exon            1993..2109
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=5
FT   intron          2110..2547
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=5
FT   exon            2548..2580
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=6
FT   intron          2581..2722
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=6
FT   exon            2723..2770
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=7
FT   intron          2771..2939
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=7
FT   exon            2940..>2944
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203variant"
FT                   /number=8
XX
SQ   Sequence 3002 BP; 585 A; 855 C; 931 G; 631 T; 0 other;
     actcagattc tcccccagac gccgaggatg gccgtcatgg cgccccgaac cctcgtcctg        60
     ctactctcgg gggctctggc cctgacccag acctgggcgg gtgagtgcgg ggtcgggagg       120
     gaaacggcct ctgtggggag aagcaacggg cccgcctggc gggggcgcag gacccgggaa       180
     gccgcgccgg gaggagggtc gggcgggtct cagccactcc tcgtccccag gctctcactc       240
     catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc gcttcatcgc       300
     agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagccagag       360
     gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg acggggagac       420
     acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc tgcgcggcta       480
     ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgacctctca       540
     tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccgc cccgaagccg       600
     cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg tttcattttc       660
     agtttaggcc aaaaatcccc ccaggttggt cggggcgggg cggggctcgg gggaccgggc       720
     tgaccgcggg gtccgggcca ggttctcaca ccgtccagag gatgtatggc tgcgacgtgg       780
     ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc aaggattaca       840
     tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct cagaccacca       900
     agcacaagtg ggagacggcc catgaggcgg agcagtggag agcctacctg gagggcacgt       960
     gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacgggta      1020
     ccaggggcca cggggcgcct ccctgatcgc ctgtagatct cccgggctgg cctcccacaa      1080
     ggaggggaga caattgggac caacactaga atatcgccct ccctctggtc ctgagggaga      1140
     ggaatcctcc tgggtttcca gatcctgtac cagagagtga ctctgaggtt ccgccctgct      1200
     ctctgacaca attaagggat aaaatctctg aaggaatgac gggaagacga tccctcgaat      1260
     actgatgagt ggttcccttt gacacacaca ggcagcagcc ttgggcccgt gacttttcct      1320
     ctcaggcctt gttctctgct tcacactcaa tgtgtgtggg ggtctgagtc cagcacttct      1380
     gagtccttca gcctccactc aggtcaggac cagaagtcgc tgttccctct tcagggacta      1440
     gaattttcca cggaatagga gattatccca ggtgcctgtg tccaggctgg tgtctgggtt      1500
     ctgtgctccc ttccccatcc caggtgtcct gtccattctc aagatagcca catgtgtgct      1560
     ggaggagtgt cccatgacag atgcaaaatg cctgaatgat ctgactcttc ctgacagacg      1620
     cccccaaaac gcatatgact caccacgctg tccctgacca tgaagccacc ctgaggtgct      1680
     gggccctgag cttctaccct gcggagatca cactgacctg gcagcgggat ggggaggacc      1740
     agacccagga cacggagctc gtggagacca ggcctgcagg ggatggaacc ttccagaagt      1800
     gggcggctgt ggtggtgcct tctggacagg agcagagata cacctgccat gtgcagcatg      1860
     agggtttgcc caagcccctc accctgagat ggggtaagga gggagacggg ggtgtcatgt      1920
     cttttaggga aagcaggagc ctctctgacc tttagcaggg tcagggcccc tcaccttccc      1980
     ctcttttccc agagccgtct tcccagccca ccatccccat cgtgggcatc attgctggcc      2040
     tggttctctt tggagctgtg atcactggag ctgtggtcgc tgctgtgatg tggaggagga      2100
     agagctcagg tggggaaggg gtgaagggtg ggtctgagat ttcttgtctc actgagggtt      2160
     ccaagaccca ggtagaagtg tgccctgcct cgttactggg aagcaccacc cacaattatg      2220
     ggcctaccca gcctgggccc tgtgtgccag cacttactct tttgtaaagc acctgttaaa      2280
     atgaaggaca gatttatcac cttgattaca gcggtgatgg gacctgatcc cagcagtcac      2340
     aagtcacagg ggaaggtccc tgaggacctt caggagggcg gttggtccag gacccacacc      2400
     tgctttcttc atgtttcctg atcccgccct gggtctgcag tcacacattt ctggaaactt      2460
     ctctgaggtc caagacttgg aggttcctct aggaccttaa ggccctgact cctttctggt      2520
     atctcacagg acattttctt cccacagata gaaaaggagg gagctactct caggctgcaa      2580
     gtaagtatga aggaggctga tgcctgaggt ccttgggata ttgtgtttgg gagcccatgg      2640
     gggagctcac ccaccccaca attcctcctc tagccacatc ttctgtggga tctgaccagg      2700
     ttctgttttt gttctacccc aggcagtgac agtgcccagg gctctgatgt gtctctcaca      2760
     gcttgtaaag gtgagagcct ggagggcctg atgtgtgttg ggtgttgggc ggaacagtgg      2820
     acacagctgt gctatggggt ttctttccat tggatgtatt gagcatgcga tgggctgttt      2880
     aaagtgtgac ccctcactgt gacagatacg aatttgttca tgaatatttt tttctatagt      2940
     gtgagacagc tgccttgtgt gggactgaga ggcaagagtt gttcctgccc ttccctttgt      3000
     ga                                                                     3002
//