Dbfetch

ID   FN908176; SV 1; linear; genomic DNA; STD; HUM; 2966 BP.
XX
AC   FN908176;
XX
DT   10-JUN-2010 (Rel. 105, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*030404
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2966
RA   Qu J.;
RT   ;
RL   Submitted (03-JUN-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J.;
RT   "full length of HLA-C, alleles";
RL   Unpublished.
XX
DR   MD5; deeefe05be47eaf45bb483add4913ffc.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2966
FT                   /organism="Homo sapiens"
FT                   /isolate="2D10001351"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(28..100,231..500,746..1021,1609..1884,2006..2125,
FT                   2565..2597,2705..2752,2917..2921)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q53YP1"
FT                   /db_xref="IMGT/HLA:C*03:04:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YP1"
FT                   /protein_id="CBM42647.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <28..100
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=1
FT   intron          101..230
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=1
FT   exon            231..500
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=2
FT   intron          501..745
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=2
FT   exon            746..1021
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=3
FT   intron          1022..1608
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=3
FT   exon            1609..1884
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=4
FT   intron          1885..2005
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=4
FT   exon            2006..2125
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=5
FT   intron          2126..2564
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=5
FT   exon            2565..2597
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=6
FT   intron          2598..2704
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=6
FT   exon            2705..2752
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=7
FT   intron          2753..2916
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=7
FT   exon            2917..>2921
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*030404"
FT                   /number=8
XX
SQ   Sequence 2966 BP; 555 A; 845 C; 955 G; 611 T; 0 other;
     ggactcagat tctccccaga cgccgagatg cgggtcatgg cgccccgaac cctcatcctg        60
     ctgctctcgg gagccctggc cctgaccgag acctgggccg gtgagtgcgg ggttgggagg       120
     gaatcggcct ctgcggagag gagcgagggg cccgcccggc gagggcgcag gacccgggga       180
     gccgcgcagg gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc       240
     catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc acttcatcgc       300
     agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagtccgag       360
     aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg accgggagac       420
     gcagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc tgcgcggcta       480
     ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgacccctcc       540
     tcatccccca cggacggccc gggtcgcccc aagtctcccg gtctgagatc caccccgagg       600
     ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta cccggtttca       660
     ttttcagttt aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg       720
     gggctgaccg cgggggcggg gccagggtct cacatcatcc agaggatgta tggctgcgac       780
     gtggggcccg acgggcgcct cctccgcggg tatgaccagt acgcctacga cggcaaggat       840
     tacatcgccc tgaacgagga tctgcgctcc tggaccgccg cggacacggc ggctcagatc       900
     acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta cctggagggc       960
     ctgtgcgtgg agtggctccg cagatacctg aagaatggga aggagacgct gcagcgcgcg      1020
     ggtaccaggg gcagtgggga gccttcccca tctcctgtag atctcccggg atggcctccc      1080
     acgaggaggg gaggaaaatg ggatcagcgc tagaatatcg ccctcccttg aatggagaat      1140
     gggatgagtt ttcctgagtt tcctctgagg gccccctctg ctctctagga caattaaggg      1200
     atgaagtcct tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc      1260
     tttgaccact ttgaccactg cagcagctgt ggtcaggctg ctgacctttc tctcaggcct      1320
     tgttctctgc ctcacgctca atgtgtttga aggtttgatt ccagcttttc tgagtccttc      1380
     ggcctccact caggtcagga ccagaagtcg ctgttcctcc ctcagagact agaactttcc      1440
     aatgaatagg agattatccc aggtgcctgt gtccaggctg gcgtctgggt tctgtgcccc      1500
     cttccccacc ccaggtgtcc tgtccgttct caggatggtc acatgggcgc tgttggagtg      1560
     tcgcaagaga gatacaaagt gtctgaattt tctgactctt cccgtcagaa cacccaaaga      1620
     cacacgtgac ccaccatccc gtctctgacc atgaggccac cctgaggtgc tgggccctgg      1680
     gcttctaccc tgcggagatc acactgacct ggcagtggga tggggaggac caaactcagg      1740
     acactgagct tgtggagacc aggccagcag gagatggaac cttccagaag tgggcagctg      1800
     tggtggtgcc ttctggagaa gagcagagat acacgtgcca tgtgcagcac gaggggctgc      1860
     cggagcccct caccctgaga tggggtaagg agggggatga ggggtgatgt gtcttctcag      1920
     ggaaagcaga agtcctggag cccttcagcc aggtcagggc tgaggcttgg gggtcagggc      1980
     ccctcacctt cccctccttt cccagagccg tcttcccagc ccaccatccc catcgtgggc      2040
     atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt ggtggctgtt      2100
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggagtggggt ctgggttttc      2160
     ttgttccact gggagtttca agccccaggt agaagtgtgc cccacctcgt tactggaagc      2220
     accatccaca catgggccat cccagcctgg gaccctgtgt gccagcactt actctgttgt      2280
     gaagcacatg acaatgaagg acagatgtat caccttgatg attatggtgt tggggtcctt      2340
     gattccagca ttcatgagtc aggggaaggt ccctgctaag gacagacctt aggagggcag      2400
     ttgctccaga acccacagct gctttccccg tgtttcctga tcctgccctg ggtctgcagt      2460
     catagttctg gaaacttctc ttgggtccaa gactaggagg ttcccctaag atcgcatggc      2520
     cctgactcct ccctgtcccc tcacagggca ttttcttccc acaggtggaa aaggagggag      2580
     ctgctctcag gctgcgtgta agtgatggcg gtgggcgtgt ggaggagctc acccacccca      2640
     taattcctct tgtcccacat ctcctgcggg ctctgaccag gtcttttttt ttgttctacc      2700
     ccagccagca acagtgccca gggctctgat gagtctctca tcgcttgtaa aggtgagatt      2760
     ctggggagct gaagtggtcg ggggtggggc agagggaaaa ggcctaggta atggggatcc      2820
     tttgattggg acgtttcgaa tgtgtggtga gctgttcaga gtgtgatcac ttaccatgac      2880
     tgacctgaat ttgttcatga ctattgtgtt ctgtagcctg agacagctgc ctgtgtggga      2940
     ctgagatgca ggatttcttc acacct                                           2966
//