Dbfetch

ID   FN908175; SV 1; linear; genomic DNA; STD; HUM; 2968 BP.
XX
AC   FN908175;
XX
DT   10-JUN-2010 (Rel. 105, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*010201v
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2968
RA   Qu J.;
RT   ;
RL   Submitted (03-JUN-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J.;
RT   "full length of HLA-C, alleles";
RL   Unpublished.
XX
DR   MD5; 1f1ff8df1d52ca176768c131fa0dfd1b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2968
FT                   /organism="Homo sapiens"
FT                   /isolate="LHLAD0000447/975"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(24..96,227..496,743..1018,1606..1881,2003..2122,
FT                   2562..2594,2702..2749,2914..2918)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D7GN71"
FT                   /db_xref="IMGT/HLA:C*01:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GN71"
FT                   /protein_id="CBM42646.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWASSHSMKYFFTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <24..96
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=1
FT   intron          97..226
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=1
FT   exon            227..496
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=2
FT   intron          497..742
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=2
FT   exon            743..1018
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=3
FT   intron          1019..1605
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=3
FT   exon            1606..1881
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=4
FT   intron          1882..2002
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=4
FT   exon            2003..2122
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=5
FT   intron          2123..2561
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=5
FT   exon            2562..2594
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=6
FT   intron          2595..2701
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=6
FT   exon            2702..2749
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=7
FT   intron          2750..2913
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=7
FT   exon            2914..>2918
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=8
XX
SQ   Sequence 2968 BP; 557 A; 857 C; 941 G; 613 T; 0 other;
     tcagattctc cccagacgcc gagatgcggg tcatggcgcc ccgaaccctc atcctgctgc        60
     tctcgggagc cctggccctg accgagacct gggcctgtga gtgcggggtt gggagggaaa       120
     cggcctctgc ggagaggaac gaggtgcccg cccggcgagg gcgcaggacc cggggagccg       180
     cgcagggagg agggtcgggc gggtctcagc ccctcctcgc ccccagcctc ccactccatg       240
     aagtatttct tcacatccgt gtcccggcct ggccgcggag agccccgctt catctcagtg       300
     ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag tccgagaggg       360
     gagccgcggg cgccgtgggt ggagcaggag gggccggagt attgggaccg ggagacacag       420
     aagtacaagc gccaggcaca gactgaccga gtgagcctgc ggaacctgcg cggctactac       480
     aaccagagcg aggccggtga gtgaccccgg cccggggcgc aggtcacgac ccctcctcat       540
     cccccacgga cggcccgggt cgccccaagt ctcccggtct gagatccacc ccgaggctgc       600
     ggaacccgcc cagaccctcg accggagaga gccccagtca cctttacccg gtttcatttt       660
     cagtttaggc caaaatcccc gcgggttggt cgggactggg gcggggctcg ggggacgggg       720
     ctgaccacgg gggcggggcc agggtctcac accctccagt ggatgtgtgg ctgcgacctg       780
     gggcccgacg ggcgcctcct ccgcgggtat gaccagtacg cctacgacgg caaggattac       840
     atcgccctga acgaggacct gcgctcctgg accgccgcgg acaccgcggc tcagatcacc       900
     cagcgcaagt gggaggcggc ccgtgaggcg gagcagcgga gagcctacct ggagggcacg       960
     tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca gcgcgcgggt      1020
     accaggggca gtggggagcc ttccccatct cccgtagatc tcccggcatg gcctcccacg      1080
     aggaggggag gaaaatggga tcagcgctag aatatcgccc tcccttgaat ggagaatggg      1140
     atgagttttc ctgagtttcc tctgagggcc ccctctgctc tctaggacaa ttaagggatg      1200
     aagtccttga ggaaatggag gggaagacag tccctggaat actgatcagg ggtccccttt      1260
     gaccactttg accactgcag cagctgtggt caggctgctg acctttctct caggccttgt      1320
     tctctgcctc acgctcaatg tgtttgaagg tttgattcca gcttttctga gtccttcggc      1380
     ctccactcag gtcaggacca gaagtcgctg ttcctccctc agagactaga actttccaat      1440
     gaataggaga ttatcccagg tgcctgtgtc caggctggcg tctgggttct gtgccccctt      1500
     ccccacccca ggtgtcctgt ccattctcag gatggtcaca tgggcgctgt tggagtgtcg      1560
     caagagagat acaaagtgtc tgaattttct gactcttccc gtcagaacac ccaaagacac      1620
     acgtgaccca ccatcccgtc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1680
     tctaccctgc ggagatcaca ctgacctggc agtgggatgg ggaggaccaa actcaggaca      1740
     ccgagcttgt ggagaccagg ccagcaggag atggaacctt ccagaagtgg gcagctgtga      1800
     tggtgccttc tggagaagag cagagataca cgtgccatgt gcagcacgag gggctgccgg      1860
     agcccctcac cctgagatgg ggtaaggagg gggatgaggg gtgatgtgtc ttctcaggga      1920
     aagcagaagt cctggagccc ttcagccggg tcagggctga ggcttggagg tcagggcccc      1980
     tcaccttccc ctcctttccc agagccgtct tcccagccca ccatccccat cgtgggcatc      2040
     gttgctggcc tggctgtcct ggctgtccta gctgtcctag gagctgtggt ggctgttgtg      2100
     atgtgtagga ggaagagctc aggtagggaa ggggtgagga gtggggtctg ggttttcttg      2160
     ttccactggg agtttcaagc cccaggtaga agtgtgcccc acctcgttac tggaagcacc      2220
     atccacacat gggccatccc agcctgggac cctgtgtgcc agcacttact ctgttgtgaa      2280
     gcacatgaca atgaaggaca gatgtatcac cttgatgatt atggtgttgg ggtccttgat      2340
     tccagcattc atgagtcagg ggaaggtccc tgctaaggac agaccttagg agggcagttg      2400
     cttcagaacc cacagctgct ttccccgtgt ttcctgatcc tgccctgggt ctgcagtcat      2460
     agttctggaa acttctcttg ggtccaagac taggaggttc ccctaagatc gcatggccct      2520
     gcctcctccc tgtcccctca cagggcattt tcttcccaca ggtggaaaag gagggagctg      2580
     ctctcaggct gcgtgtaagt gatggcggtg ggcgtgtgga ggagctcacc caccccataa      2640
     ttcctcttgt cccacatctc ctgcgggctc tgaccaggtc tttttttttg ttctacccca      2700
     gccagcaaca gtgcccaggg ctctgatgag tctctcatcg cttgtaaagg tgagattctg      2760
     gggagctgaa gtggtcgggg gtggggcaga gggaaaaggc ctaggtaatg gggatccttt      2820
     gattgggacg tttcgaatgt gtggtgagct gttcagagtg tcatcactta ccatgactga      2880
     cctgaatttg ttcatgacta ttgtgttctg tagcctgaga cagctgcctg tgtgggactg      2940
     agatgcagga tttcttcaca cctctcct                                         2968
//