Dbfetch

ID   FN908174; SV 1; linear; genomic DNA; STD; HUM; 3057 BP.
XX
AC   FN908174;
XX
DT   10-JUN-2010 (Rel. 105, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*010201v
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3057
RA   Qu J.;
RT   ;
RL   Submitted (03-JUN-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J.;
RT   "full length of HLA-C, alleles";
RL   Unpublished.
XX
DR   MD5; b9f8c9b73140b44e888ca0d3cb97a51a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3057
FT                   /organism="Homo sapiens"
FT                   /isolate="D10001094"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(136..208,339..608,855..1130,1718..1993,2115..2234,
FT                   2674..2706,2814..2861,3026..3030)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YNW6"
FT                   /db_xref="IMGT/HLA:C*01:02:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YNW6"
FT                   /protein_id="CBM42645.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMKYFFTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMCGCDLGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVMVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <136..208
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=1
FT   intron          209..338
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=1
FT   exon            339..608
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=2
FT   intron          609..854
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=2
FT   exon            855..1130
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=3
FT   intron          1131..1717
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=3
FT   exon            1718..1993
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=4
FT   intron          1994..2114
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=4
FT   exon            2115..2234
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=5
FT   intron          2235..2673
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=5
FT   exon            2674..2706
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=6
FT   intron          2707..2813
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=6
FT   exon            2814..2861
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=7
FT   intron          2862..3025
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=7
FT   exon            3026..>3030
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*010201v"
FT                   /number=8
XX
SQ   Sequence 3057 BP; 578 A; 888 C; 963 G; 628 T; 0 other;
     gaatactcat gacgcgtccc caattcccac tcccattggg tgtcgggttc tagagaagcc        60
     aatcagcgtc tccgcagtcc cggttctaaa gtccccagtc acccacccgg actcagattc       120
     tccccagacg ccgagatgcg ggtcatggcg ccccgaaccc tcatcctgct gctctcggga       180
     gccctggccc tgaccgagac ctgggcctgt gagtgcgggg ttgggaggga aacggcctct       240
     gcggagagga acgaggtgcc cgcccggcga gggcgcagga cccggggagc cgcgcaggga       300
     ggagggtcgg gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaagtattt       360
     cttcacatcc gtgtcccggc ctggccgcgg agagccccgc ttcatctcag tgggctacgt       420
     ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agtccgagag gggagccgcg       480
     ggcgccgtgg gtggagcagg aggggccgga gtattgggac cgggagacac agaagtacaa       540
     gcgccaggca cagactgacc gagtgagcct gcggaacctg cgcggctact acaaccagag       600
     cgaggccggt gagtgacccc ggcccggggc gcaggtcacg acccctcctc atcccccacg       660
     gacggcccgg gtcgccccaa gtctcccggt ctgagatcca ccccgaggct gcggaacccg       720
     cccagaccct cgaccggaga gagccccagt cacctttacc cggtttcatt ttcagtttag       780
     gccaaaatcc ccgcgggttg gtcgggactg gggcggggct cgggggacgg ggctgaccac       840
     gggggcgggg ccagggtctc acaccctcca gtggatgtgt ggctgcgacc tggggcccga       900
     cgggcgcctc ctccgcgggt atgaccagta cgcctacgac ggcaaggatt acatcgccct       960
     gaacgaggac ctgcgctcct ggaccgccgc ggacaccgcg gctcagatca cccagcgcaa      1020
     gtgggaggcg gcccgtgagg cggagcagcg gagagcctac ctggagggca cgtgcgtgga      1080
     gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg      1140
     cagtggggag ccttccccat ctcccgtaga tctcccggca tggcctccca cgaggagggg      1200
     aggaaaatgg gatcagcgct agaatatcgc cctcccttga atggagaatg ggatgagttt      1260
     tcctgagttt cctctgaggg ccccctctgc tctctaggac aattaaggga tgaagtcctt      1320
     gaggaaatgg aggggaagac agtccctgga atactgatca ggggtcccct ttgaccactt      1380
     tgaccactgc agcagctgtg gtcaggctgc tgacctttct ctcaggcctt gttctctgcc      1440
     tcacgctcaa tgtgtttgaa ggtttgattc cagcttttct gagtccttcg gcctccactc      1500
     aggtcaggac cagaagtcgc tgttcctccc tcagagacta gaactttcca atgaatagga      1560
     gattatccca ggtgcctgtg tccaggctgg cgtctgggtt ctgtgccccc ttccccaccc      1620
     caggtgtcct gtccattctc aggatggtca catgggcgct gttggagtgt cgcaagagag      1680
     atacaaagtg tctgaatttt ctgactcttc ccgtcagaac acccaaagac acacgtgacc      1740
     caccatcccg tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct      1800
     gcggagatca cactgacctg gcagtgggat ggggaggacc aaactcagga caccgagctt      1860
     gtggagacca ggccagcagg agatggaacc ttccagaagt gggcagctgt gatggtgcct      1920
     tctggagaag agcagagata cacgtgccat gtgcagcacg aggggctgcc ggagcccctc      1980
     accctgagat ggggtaagga gggggatgag gggtgatgtg tcttctcagg gaaagcagaa      2040
     gtcctggagc ccttcagccg ggtcagggct gaggcttgga ggtcagggcc cctcaccttc      2100
     ccctcctttc ccagagccgt cttcccagcc caccatcccc atcgtgggca tcgttgctgg      2160
     cctggctgtc ctggctgtcc tagctgtcct aggagctgtg gtggctgttg tgatgtgtag      2220
     gaggaagagc tcaggtaggg aaggggtgag gagtggggtc tgggttttct tgttccactg      2280
     ggagtttcaa gccccaggta gaagtgtgcc ccacctcgtt actggaagca ccatccacac      2340
     atgggccatc ccagcctggg accctgtgtg ccagcactta ctctgttgtg aagcacatga      2400
     caatgaagga cagatgtatc accttgatga ttatggtgtt ggggtccttg attccagcat      2460
     tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt tgcttcagaa      2520
     cccacagctg ctttccccgt gtttcctgat cctgccctgg gtctgcagtc atagttctgg      2580
     aaacttctct tgggtccaag actaggaggt tcccctaaga tcgcatggcc ctgcctcctc      2640
     cctgtcccct cacagggcat tttcttccca caggtggaaa aggagggagc tgctctcagg      2700
     ctgcatgtaa gtgatggcgg tgggcgtgtg gaggagctca cccaccccat aattcctctt      2760
     gtcccacatc tcctgcgggc tctgaccagg tctttttttt tgttctaccc cagccagcaa      2820
     cagtgcccag ggctctgatg agtctctcat cgcttgtaaa ggtgagattc tggggagctg      2880
     aagtggtcgg gggtggggca gagggaaaag gcctaggtaa tggggatcct ttgattggga      2940
     cgtttcgaat gtgtggtgag ctgttcagag tgtcatcact taccatgact gacctgaatt      3000
     tgttcatgac tattgtgttc tgtagcctga gacagctgcc tgtgtgggac tgagatg         3057
//