Dbfetch

ID   FN908171; SV 1; linear; genomic DNA; STD; HUM; 3058 BP.
XX
AC   FN908171;
XX
DT   10-JUN-2010 (Rel. 105, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*040101
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3058
RA   Qu J.;
RT   ;
RL   Submitted (03-JUN-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J.;
RT   "full length of HLA-C, alleles";
RL   Unpublished.
XX
DR   MD5; 5f1c7d679cd5c3f3110db5fe628cd613.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3058
FT                   /organism="Homo sapiens"
FT                   /isolate="D10000511"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(107..179,310..579,826..1101,1689..1964,2086..2205,
FT                   2645..2677,2785..2832,2997..3001)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D7GN69"
FT                   /db_xref="IMGT/HLA:C*04:70"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GN69"
FT                   /protein_id="CBM42642.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWMEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <107..179
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=1
FT   intron          180..309
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=1
FT   exon            310..579
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=2
FT   intron          580..825
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=2
FT   exon            826..1101
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=3
FT   intron          1102..1688
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=3
FT   exon            1689..1964
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=4
FT   intron          1965..2085
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=4
FT   exon            2086..2205
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=5
FT   intron          2206..2644
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=5
FT   exon            2645..2677
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=6
FT   intron          2678..2784
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=6
FT   exon            2785..2832
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=7
FT   intron          2833..2996
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=7
FT   exon            2997..>3001
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*040101"
FT                   /number=8
XX
SQ   Sequence 3058 BP; 579 A; 880 C; 967 G; 632 T; 0 other;
     ctcccattgg gtgtcgggtt ctagagaagc caatcagcgt ctccgcagtc ccggttctaa        60
     agtccccagt cacccacccg gactcagatt ctccccagac gccgagatgc gggtcatggc       120
     gccccgaacc ctcatcctgc tgctctcggg agccctggcc ctgaccgaga cctgggccgg       180
     tgagtgcggg gttgggaggg aaacggcctc tggggagagg agcgaggggc ccgcccggcg       240
     agggcgcagg acccggggag ccgcgcaggg aggagggtcg ggcgggtctc agccactcct       300
     cgtccccagg ctcccactcc atgaggtatt tctccacatc cgtgtcctgg cccggccgcg       360
     gggagccccg cttcatcgca gtgggctacg tggacgacac gcagttcgtg cggttcgaca       420
     gcgacgccgc gagtccaaga ggggagccgc gggagccgtg gatggagcag gaggggccgg       480
     agtattggga ccgggagaca cagaagtaca agcgccaggc acaggctgac cgagtgaacc       540
     tgcggaaact gcgcggctac tacaaccaga gcgaggacgg tgagtgaccc cggcccgggg       600
     cgcaggtcac gacccctccc catcccccac ggacggcccg ggtcgccccg agtctccccg       660
     tctgagatcc accccgaggc tgcggaaccc gcccagaccc tcgaccggag agagccccag       720
     tcacctttac ccggtttcat tttcagttta ggccaaaatc cccgcgggtt ggtcgggact       780
     ggggcggggc tcgggggacc gggctgacca cgggggcggg gccagggtct cacaccctcc       840
     agaggatgtt tggctgcgac ctggggccgg acgggcgcct cctccgcggg tataaccagt       900
     tcgcctacga cggcaaggat tacatcgccc tgaacgagga tctgcgctcc tggaccgccg       960
     cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc      1020
     ggagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga      1080
     aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcccgtag      1140
     atctcccggg atggcctccc acgaggaggg gaggaaaatg ggatcagcgc tagaatatcg      1200
     ccctcccttg aatggagaat gggatgagtt ttcctgagtt tcctctgagg gccccctctg      1260
     ctctctagga caattaaggg atgaagtcct tgaggaaatg gaggggaaga cagtccctgg      1320
     aatactgatc aggggtcccc tttgaccact ttgaccactg cagcagctgt ggtcaggctg      1380
     ctgacctttc tctcaggcct tgttctctgc ctgacgctca atgtgtttga aggtttgatt      1440
     ccagcttttc tgagtccttc ggcctccact caggtcagga ccagaagtcg ctgttcctcc      1500
     ctcagagact agaactttcc aatgaatagg agattatccc aggtgcctgt gtccaggctg      1560
     gcgtctgggt tctgtgcccc cttccccacc ccaggtgtcc tgtccattct caggatggtc      1620
     acatgggcgc tgttggagtg tcgcaagaga gatacaaagt gtctgaattt tctgactctt      1680
     cccatcagaa cacccaaaga cacacgtgac ccaccatccc gtctctgacc atgaggccac      1740
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagtggga      1800
     tggggaggac caaactcagg acaccgagct tgtggagacc aggccagcag gagatggaac      1860
     cttccagaag tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacgtgcca      1920
     tgttcagcac gaggggctgc cggagcccct caccctgaga tggagtaagg agggggatga      1980
     ggggtgatgt gtcttctcag ggaaagcaga agtcctggag cccttcagcc gggtcagggc      2040
     tgaggcttgg aggtcagggc ccctcacctt cccctccttt cccagagccg tcttcccagc      2100
     ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc ctagctgtcc      2160
     taggagctat ggtggctgtt gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga      2220
     ggagtggggt ctgggttttc ttgttccact gggagtttca agccccaggt agaagtgtgc      2280
     cccacctcgt tactggaagc accatccaca catgggccat cccagcctgg gaccctgtgt      2340
     gccagcactt actctgttgt gaagcacatg acaatgaagg acagatgtat caccttgatg      2400
     attatggtgt tggggtcctt gattccagca ttcatgagtc aggggaaggt ccctgctaag      2460
     gacagacctt aggagggcag ttgcttcaga acccacagct gctttccccg tgtttcctga      2520
     tcctgccctg ggtctgcagt catagttctg gaaacttctc ttgggtccaa gactaggagg      2580
     ttcccctaag atcgcatggc cctgcctcct ccctgtcccc tcacagggca ttttcttccc      2640
     acaggtggaa aaggagggag ctgctctcag gctgcgtgta agtgatggcg gtgggcgtgt      2700
     ggaggagctc acccacccca taattcctct tgtcccacat ctcctgcggg ctctgaccag      2760
     gtcttttttt ttgttctacc ccagccagca acagtgccca gggctctgat gagtctctca      2820
     tcgcttgtaa aggtgagatt ctggggagct gaagtggtcg ggggtggggc agagggaaaa      2880
     ggcctaggta atggggatcc tttgattggg acgtttcgaa tgtgtggtga gctgttcaga      2940
     gtgtcatcac ttaccatgac tgacctgaat ttgttcatga ctattgtgtt ctgtagcctg      3000
     agacagctgc ctgtgtggga ctgagatgca ggatttcttc acacctctcc tttgtgac        3058
//