spacer

EBI Dbfetch

ID   FN908086; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   FN908086;
XX
DT   08-JUN-2010 (Rel. 105, Created)
DT   08-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*24new, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lu J.;
RT   ;
RL   Submitted (01-JUN-2010) to the INSDC.
RL   Lu J., Chinese Marrow Donor Program, Room 203, No.53 Ganmian
RL   Hutong,Dongcheng, District,Beijing 100010, CHINA.
XX
RN   [2]
RA   Liu X., Li L., Yang W.L., Chen L., Wang Z.D.;
RT   "Identification of a novel HLA-A allele";
RL   Unpublished.
XX
DR   MD5; 43ddf0e693d0732b5b03adf1e03fffe8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China:AnHui"
FT                   /collected_by="Chinese Marrow Donor Program"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GN23"
FT                   /db_xref="IMGT/HLA:A*24:02:39"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GN23"
FT                   /protein_id="CBM42055.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 165 C; 193 G; 76 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaagacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggacggg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer