Dbfetch

ID   FN870187; SV 1; linear; genomic DNA; STD; HUM; 1251 BP.
XX
AC   FN870187;
XX
DT   04-JUN-2010 (Rel. 105, Created)
DT   04-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele HLA-C*04,
DE   exons 2-5
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1251
RA   Li J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Li J., Healthcare, Beijing Genomics Institute, Shenzhen, Beishan industrial
RL   estate,Yantian, Shenzhen/518083, CHINA.
XX
RN   [2]
RA   Li J., Chen S., Liu Y., Zhang C., Zhang X.;
RT   "Identification of a novel HLA-C allele";
RL   Unpublished.
XX
DR   MD5; cd1a13bbe2eff4b0170de732ba2dcaf5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1251
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..1022,1123..>1251)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM41"
FT                   /db_xref="IMGT/HLA:C*04:82"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM41"
FT                   /protein_id="CBM41469.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWKPSSQPTI
FT                   PIVGIVAGLAVLAVLAVLAVLGAMVAVVMCRRKSS"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=4
FT   gap             1023..1122
FT                   /estimated_length=unknown
FT   exon            1123..>1251
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04"
FT                   /number=5
XX
SQ   Sequence 1251 BP; 191 A; 283 C; 327 G; 150 T; 300 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaaca cccaaagaca cacgtgaccc accatcccgt       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagtgggatg gggaggacca aactcaggac accgagcttg tggagaccag       900
     gccagcagga gatggaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acgtgccatg ttcagcacga ggggctgccg gagcccctca ccctgagatg      1020
     gannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnagccgtct tcccagccca      1140
     ccatccccat cgtgggcatc gttgctggcc tggctgtcct ggctgtccta gctgtcctag      1200
     ctgtcctagg agctatggtg gctgttgtga tgtgtaggag gaagagctca g               1251
//